current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: GS13536A NP_812134.1 384667 PDB-2013-06-20, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MKKLFSTLTLTVCLGAFISCTNDEQEVNMVKPTNANSEIEVINDGTMIKFKDVESYENALLKVSAMSTSEQVSFLNSLSFKSQMILMQEADGELDKICNQAADKAEFDVLYEKYKHKYGDVFMFNTIDATDLSPYSRLVYVANEYFVNMKGEFMIGDSLVVDKVYTDFKERQQQFTVSTRSSVSDLSSINEAYSRQKDRKVGLYLSVSSGIIHANFTSQKKGVFGWSRYSTTYHAKVNLRGFEFAQGELLGYGPVYVNKDGIPFAIDTKEMGGNVTKVFGRKLAQECTGTIEIWSRGVPYDQRGFATVRLLast
1 -109.000GS13536A NP_812134.1 384667 PDB-2013-06-20  ali  100  1MKKLFSTLTLTVCLGAFISCTNDEQEVNMVKPTNANSEIEVINDGTMIKFKDVESYENALLKVSAMSTSEQVSFLNSLSFKSQMILMQEADGELDKICNQAADKAEFDVLYEKYKHKYGDVFMFNTIDATDLSPYSRLVYVANEYFVNMKGEFMIGDSLVVDKVYTDFKERQQQFTVSTRSSVSDLSSINEAYSRQKDRKVGLYLSVSSGIIHANFTSQKKGVFGWSRYSTTYHAKVNLRGFEFAQGELLGYGPVYVNKDGIPFAIDTKEMGGNVTKVFGRKLAQECTGTIEIWSRGVPYDQRGFATVRL 310
2 -80.100GS13854A YP_001304333.1 384463 Purified-2008-06-17  ali follow..  26  1MDK-KTVLLASACTLLMISCSNDAELINVAETTEADFQIVDYAGDKCIQFKNDSVFNAMLWEMNDMSEEERNNIFSGAGFVSQWQLMQEADQEQELIVDNYEKQPWPAHQIKEFKQKYDDVFMFEPYDSTDFIAHYKLKGSTYSSFVNRRGVFLIGDSVAHAPVYKALEEYFGSGISLYGNNEATNEKNDINLAESKYQELQTIENKNYLSLGFDYLSQKKKVL-WKKHRTMIILRLTASGSGSGFEVYNVSIKNYQNKNGVTILLHTDVYNKLLAKDQGGMLRFEFSGRMEIWSDEMPESNKGTAKISL 353
3 -74.200GS13794A YP_001299735.1 385123 Purified-2008-05-17  ali follow..  18  3IEKIFGCILSACMIVSLLSCNSENEFIGSAQETKETRSVSEYLNMPVLHFKDEQVYSETLRQLKNMTENERFTYFQQLGFEGAYILWEQADRELDKIFDMESDDSHLQEMINTYKDKYSDIFSFNTVDLFDVTPYFTFTDNDLSLLGNIKGYVVIGNSLRGPKYDYPTYDLDEVVSATRAAEPTPIEPGFKGFKDASKSTMTIGRIVNGNSFAVEFKTKKKQLFWKKSVKAGYSAMLTMKSSKFNYKNTVFCPYGKEVSILNLPIERVGNV-------------FDAVVENFKSSRGDAKGNQSFHNIRV 321
4 -38.200GS13623A YP_210088.1 385065 Crystal|NMR-2011-06-15  ali follow..  13  1MKT-ISKLFLLLSIILLSSCDETELDQTVTNQVNPQK-----EEDSRIVFNSAKEFYNTLDTLSYMTYEEQTEWIRASGIKYPLYKDLEFCEDEIMT----------------------------------------EMPRAFQALFNHKMEMQINDTVIAFEKGNMYVKSIKEKILPVPVLYGQVGVNQEESEVTTRTVYETKYGKIGTNLFLVLKLEWKGKKKWKVAEKE.............................................................................. 223
5 -18.100SP18058B ZP_01995605.1 410699 Selected-2009-11-12  ali follow..  12  1MKKILVVLLSLTLIFAFTGCTSSNNGAAEDVEIKTQEVVTSNTDDDDDNISNTENAVENVNEKDYDFSSYENDVRNITKSVNNAKRSTNASENHEQFYALKKQVDAVDDELDKLDDEFEYAYQMKEISFETYKARERAIEKLEDELELAEEAL-IDD......................................................................................................................................................... 161
6 -17.900SP13271C ZP_03460516.1 407402 Purified-2012-10-22  ali follow..  15  1MKNIFKLMALFAFLFCFSSCEDDEPVIPTLEVTPAN----LEGTWKLAEWNGASLDEGTYCYVIFNRKEQTFEMYQKFD--SFSIENNPYLGYIISGVYDYGNGDWNNKYIVTDLLESGSMTWTSKDDESDVNKYIRCEK--------------VPEEIIA..................................................................................................................................................... 150
7 -17.500SP17400A ZP_03460851.1 407644 Selected-2009-11-12  ali follow..  14  1MKKNLFMLFVVILTAVFASCSKDDDDNSGAASSLTMNGEAIKVKSIEGEYDPSTSFRAFTFWVNDASVINTGVYIQGTLSTKLENL--SAGSDITSKLGLLMEYNSGDEYITDSDFRSGNLVVQNIDTSKK----LTLEFKNLKYTNNLKKEVILNGTL....................................................................................................................................................... 155
8 -17.500GS13271A NP_809127.1 384982 Selected-2007-09-11  ali follow..  13  1MKNIFKLMALFAFVLCFASCDDDE---KVEIPALPVTAANLNGTWQLSEWNGQALAEGTYCYITFNRRELTFEMYQKFD--SFNIENDPYLGYVISGEYDFGNGDWNNDYIVTDLLESGSMIWTVKDDDSDVNKYVRCEK--------------VPESIIE..................................................................................................................................................... 151
9 -17.500SP17945B ZP_02092178.1 411551 Selected-2009-11-12  ali follow..  11  7MKKFLSLFLCLTCILTLAACGKKAAPITLPQADKIT-SIDITIEENTVSHSDKTWMSEIIADISSSKPTKKESVQDVPQAESYIRIDFRHETGTITIFAYEDRGKYY------LEQPYQGIYKIERRLFERLK................................................................................................................................................................................. 132
10 -17.300SP16857A ZP_02037157.1 407190 Purified-2010-09-29  ali follow..  19  1MKRFFALLSALGLLLALAACGPAAESPAPTDTTPPPTESMEPTPPP........................................................................................................................................................................................................................................................................ 46
11 -17.100SP18220A ZP_02090546.1 411518 Selected-2009-11-12  ali follow..  1MKRLKLLAALLALTIGLAGCGGSSKGGSPASSASKNKLDGDGMTAPSTQEQEYEEPEDVAYMRLLAGEDEYRACVLYLGGSY---------EVTTDVQKVLDSQPDLRQLWGFVYDIPQDHWVVAPDGGCDLYCIFP----------EAQATLFVYETSLT------------------DDAENPLQRGKQLYYSEDGQPILLLCNISDPNTEVELYPSTGEELVFS................................................................................... 193
12 -17.000SP13489A NP_811571.1 409004 Purified-2010-06-12  ali follow..  1MKRISKYFLCLFAVVLTAGCAEDKLGETEFDPTVYEGDKAYMT---QVTMPSVPGSRSNTVEGGGSNVGVEIGKDYENNVKRMYVVLARSTDNAFIAFGDMSDKMKQSANKQAYIGTSEITKTQLSQFYNDTETPTDKKEVNVFIFCNEGGSFLMSNYSIAKRLLPNTMNDWLLYNEATPFNLSGINNAGSLSQVDNSVGGAVKVERAMARFDFRDGSR........................................................................................... 255
13 -16.600SP13271B ZP_03460302.1 407401 Purified-2012-10-31  ali follow..  13  1MKN-ILVYLMLAATFLLSACDKDEKMLEPSYLPVTYANIA--MSEGRYCYLVIKRKADEETGKRALEIYTNIDSDKSHLLTSTYELEENEDLGSIISGIYDHAAGFWNNSYLISELEADRMVWTVLEDAEDVSVYVRCEK---EDIMNGTRAI............................................................................................................................................................. 161
14 -16.500GS13521D YP_209863.1 384898 Purified-2008-05-17  ali follow..  1MNRCLGKALWLCFCLSITGCAEDDRMTPLSADSGDTADELIPIHISLTGDNDYHSSSFNDASTRSHSPLIAEWVGVKAFSPTRTGEQPDYEGPRIASMELTEDTLPRVSTRATVPAYFRLIVFRKSGNNYVFQSVADYASNGTGTPVLERGKLLTRSGTIRVVGYSFNTTADLGDMPSTYAYNSSTVSIPDMSKDFMTFDSGDITNVNSLSHNLPVSFSQK......................................................................................... 229
15 -16.500SP18220B ZP_02090547.1 411520 Selected-2009-11-12  ali follow..  1MKAMKTFAALLALAFSLAGCGAVDGDPVRPAPGSAGRGSSTAASGAD---AEPEQLAAMRQLAGENGELAGVLYLGSVP-RELYCIFAVRKEDTLFVYEKQEPAYPAQLGKELYGRQ-QPILLLCNGSREDTDTMVMVYCSTGRSL--ETGRPVPVEGVDDFSQHPTPGAA........................................................................................................................................... 211
16 -16.500SP13729A NP_816156.1 410791 Purified-2013-03-19  ali follow..  1MKKLSLVVLVLGVGLIFSACGGNTKGHETAASSTTELVTMKPVDNIN---TTKRSEVTEKSSTKPMQIKDKLAEEKVSDTYQLVEDFGNTYANFSSINDRNEKLKKLMTAECVKKNGIDVKTGAKLESKGEVSAIYQNDKKEYAVLLDCE-RVLLGNKVAEMT................................................................................................................................................... 170
17 -16.400SP17868A ZP_02080592.1 410162 Purified-2010-09-20  ali follow..  10  1MKKMFICLVGMVMAISLAGCGGQSDAQNGGSAPDSSYTSAVQVLETVISKTEELDMTLGLPESEAANIDDAASMVHMMNANTFTGAAYRLKSQVEEFSEAVKENVLAKQWMCGMPDTMVVIDV-----DGQYVLTAYGADELIETFKTNGAKVVLDAPVVE..................................................................................................................................................... 193
18 -16.400GS13667A YP_001298689.1 384384 Purified-2008-11-17  ali follow..  13  1MKFIKSISTSIFTLLLCTACESDLEQVTYSSENAIPSTLSSLNDNYILESKNASQEAFTLTSHPDLGYQASVIN-------SLEMDVKDKNFANKVILASSKTDVSHTITVSDLNSKIMALLKVYEMETAPIGIEFRISSSI........................................................................................................................................................................ 136
19 -16.300SP17037A ZP_02072335.1 409550 Purified-2012-08-30  ali follow..  16  1MKYINKILSLFVIALIATSCDPDAESYTPGELEDGNQGICFVGNYTQTVEPGITSFDLTLTRSLTDAAGTVTVINNEENIFVCPSTVSFAAGEKTAKLTVETPSAAEGITYN...................................................................................................................................................................................................... 116
20 -16.300GS13326A YP_213074.1 385259 Selected-2007-09-11  ali follow..  11  1MKYYLLFYSL-IFLFIFCSCYDESLNFDHDIIQKDLDSNYTFI--------NEADALDLVSYFINSMENSPATRVASLDTREVEGIVTFPKTRANLLPEWLQEFNKR-------------FYIVN--------------------MKNDKGYAIISKDFYAILDHGRFNFNS.......................................................................................................................................... 136
21 -16.200GS13235A YP_211485.1 384941 Crystal|NMR-2012-03-15  ali follow..  1MK-LNKLFTFTLAALAMAACSNDDEPGIDKGGQKGELIDAIS-----IAFTSSSA--------TRADKGEIEGVGTENNVYVAYLFAKENDPQHEGAWTVKRVAGDSNTDDKDVAAAIGEGDVATPGTKKNMCTFNGVRQGDSVYVVNDPQMTLATQGDKSEAAIRAYISNLSKSYLNDLTVTKDGTQGKKYIMAGVSAIPTNPNIPNGSTVKVSIPLNR.......................................................................................... 219
22 -16.200SP17045A ZP_02068612.1 409559 Purified-2010-09-29  ali follow..  12  1MKIMKYMMQVLLAGGLLTSCIEDADVTAYLTEDQLGNVAQEDPDKAF-----SAAVAGMYTDMQQYVDVNMSH--NYFGQKSFDYLTSLMGNDM........................................................................................................................................................................................................................ 87
23 -16.100GS13425B NP_812610.1 384744 Purified-2010-09-29  ali follow..  1MKKHLIYTGMFLAAIGFSACNEDFKDWADPQSNPQEESAGQLTATFTAGKDASIVMDAATADSVEIAKLSSTTAEEGSKIAVNSLTLNENHTIPFSMTEDHVFKVALAQLDSVTQEAYKSRASVVRELKISINASAVTPSGEGIQLVGNEVSITL........................................................................................................................................................... 155
24 -16.100SP19020A YP_001299484.1 409920 Selected-2009-11-12  ali follow..  1MKRKTLVGILVFVSMIVYSCWQDEWSSNVTDEVIFDSNKELTIAKAEQWYNATNPSATTVRSLSADGRIPAKNWNKAKESRKGDLEVVETTSGSTFFMDNETKEKYELQDDLDKIYNVVRMVILKNLETGEIYNFIMVFIGTYDYLMHTDGKVLFYNFNYGLVNGWKYESGKITASISPGTEEGYRMSLQ........................................................................................................................ 215
25 -15.900SP18832A NP_815385.1 410831 Purified-2010-09-29  ali follow..  10  2IRKTILASSILGVGLLIGACGNQTQTQMNSTNTSESSQPKVTESSRKSSESASNNEGVSSDSSKSTSSTTESEILKGLEEKTLKEKIPSLNQTTIKKVTDNEYKRILVMEEKATGTTYKSIL---------------IKKQNRLKIVNETTDELLYNGTL...................................................................................................................................................... 147
26 -15.900SP16785A ZP_01961334.1 407098 Purified-2010-09-20  ali follow..  12  11MKKVIALLIGGIALLSMAACSDDDGRTPSPAVDPNCIG---------ASFVGDNIGYEELEDTDPKELTLTISRDKTEAAATVAIEVQANTENIFNIPQQATADLVITFEKAQLKEEYSFQISLEAAAVNPYK................................................................................................................................................................................. 144
27 -15.800SP19011A YP_001301380.1 409888 Selected-2009-11-12  ali follow..  10  1MKKIL-FTSLAVLGLGITGCSNEDLGVAKSGVDEVCATMGDAESRTAM--NGNSVVWSIGDEIGIFVTNGSSSTYTNINYS-----LSSGAGTKNAGFSGVLEGESPVKKAAFYPYGSDASY-----DGSKISLTLKDSAQDVLAFKNAGALMSI-----TVNNIPKDYTWAKLTSMTAQEKTTVPAIAGNAQIAFADGIPTLTTTETSNSSSITIN............................................................................................. 219
28 -15.800XB5477A NP_811133.1 409027 Purified-2010-09-29  ali follow..  10  1MRKIFIQFSLLVVLIIIASCSNENIIDAERNAIKQVDPNAL----------SEKEVISIVESFQKSIKSET---------NTRGEITENPIFAISEKYLISSRNSEITRSLPNDVKALVYEVEIRNS--------------------SEQGKAIVGDRVLAYIPSYNDSIFATQIGANAMIQMSKNALLDEIANNSEAITRSRPITDLDGQVWMMIEPFCTT---WGQ.................................................................................. 192
29 -15.800SP16637A YP_213393.1 408012 Purified-2010-03-23  ali follow..  1MRKKSMFLWSLLAAMTMSACSEHNELPSGEVPGGNSKANFIVK----LNFEGTSM---EQGGKTRAAQSTAVPETSWSNIHQVQILLYDASNIVRFSDVVTPTAGNTTFTYTDVPAGTYTMVAIANAKSSADAINTYLDGGTTPVEWGMWQNMVMKYKTGTFPAFCSAALAGNTAYTEPAEIFMGAVSNVVISSDATATPSPIALKREVSLMRVRLNVKDKE........................................................................................ 222
30 -15.700SP17902A ZP_02421531.1 411272 Purified-2010-11-20  ali follow..  10  1MKKKIALIALAVTAVLFTACAAENTPSAVSQRESSSAVSSEDKTTALTEEAAKETVKLNMPIADKFDDNGFCYSPVESVYDTLASLKADTEKYFTKEYLDSTFYKNLADETAFYKDINGKLYKISDITDTGFTATVPYLDLYEAEYLLDNGTYKINSWTLNLDAV................................................................................................................................................. 207
31 -15.700SP16944B ZP_02091799.1 411484 Selected-2009-11-12  ali follow..  1MKKFIAALLAGLTLFTLVGCSGGSKADSSTPKDYSQIIHDARSDED----KGEDGKFTAIDGYSAEYKADQLNEEIRDILMPPLNLEDDQYTAFYAVAIVKPAEGKTNEVKAALEAYVASE-------QQSMEHYLEDQYLVAATVTVAPTGEVV........................................................................................................................................................... 165
32 -15.600SP13661A YP_001304821.1 412395 Selected-2009-11-12  ali follow..  12  1MK-LRNLLFGTMIACVFAACSNEDDPIPSVDPTPETGIADLT-----VVVKNLAK------NTQTKAADDSNAKEGETAIHNLFVVLYNEDGTFLQVSDITANKDEEQT---------------NSNNEIQFKGLKAGASYRALAFANVPKEALTANSFDLTSAYYVLTGAEANGLPMSSGISPVFTLAEGENYYGYSNATGGNSIESGKPLGLIRNVAR.......................................................................................... 195
33 -15.600SP18266A ZP_02994808.1 410441 Purified-2010-09-29  ali follow..  17  1MKKLISILIAGILTLGLVACGSTQTNNEENKNNDKPKQEQAKKESA........................................................................................................................................................................................................................................................................ 46
34 -15.600SP18670A ZP_02031592.1 412961 Selected-2009-11-12  ali follow..  10  12MKTKNIFLTAISALFIFAACTEEKIIDEPGVSGKGDLVIE-------LSPSSVIT------KAAATNEGYVYATEEELNVEDCWIFVFGENEKYITSQYFSGDALSETENEYVDTPVPNGGSQTYKKGYTITLTGLDYGTYDFWVVANPTEANDAYKSCQSLDALKEIIEGGDSYQTAFAEKADQLVKVGNKSVTTVASPIQIPLTQLAARVELKVRVDIPR........................................................................................ 224
35 -15.600SP16699A NP_812348.1 409157 Purified-2010-09-29  ali follow..  12  5IKQLLMLFALFLVAFCFIACDDQDNEEQEQRGTGHCAAWSLKDRGIGIQFVDTQKGKVVWEDYDEFD-----TYMIEGSYITFNDIAFQLAGAPWVIKSYTKNHITLIQNEASPDKDKIATIELDRVD...................................................................................................................................................................................... 144
36 -15.500GS13959B YP_001301305.1 384525 Selected-2007-09-11  ali follow..  13  1MK-TSKMFITIVTALAMASCNNDKEFANQPELEMQV-------PEAYASFS---SIPHTSGTRSVTTRSTEPGTDAENIVKSLHIFIYDKEAPFTSTVAEFSVAANTLQQAPGNTSQWITTRPVN----------TKKADKYIFAAVNLNTEIV--DYITSNGLGAFNYKEFTQEVGKLADQTNGFIMFNENYPNITPATNLYEDKAEAEKHHISIPVSR.......................................................................................... 198
37 -15.500SP13290B ZP_02065139.1 408424 Purified-2014-03-12  ali follow..  13  8KKNLLRFFFLTLASCFMVACNDDDDTTDLLDNRT---SLVLTPSDYEIELKEDTPDEVALT---NWTEADPIGSDYYISYLYKMDLENNSFGTNTMIREYIDDDFSKSYTHKELQSLLVSKWKQHPGDLVKLQARIIGSIEGPKFVKPEVSTVTI........................................................................................................................................................... 157
38 -15.500SP16885B ZP_03459212.1 407567 Crystal|NMR-2012-07-27  ali follow..  11  1MRKKL-IFSLLIILIATTACEDNNDSGGNGSCPTVPFSTIRLTEDSPYEAGVPTVTTTQ-----------------TYSYKRGQLAGFTTVQSYSVQNEPVKIENTTSVTYEEHQAIATD------------------FGNVSTYLLNDKGYAI-ATRTYGFSYFTSPEGKPYLKNITESINGKVYASIGIDYSNPQALRIVQKVDTYTQTYTATTPAGNS......................................................................................... 193
39 -15.500GS13148A YP_001298222.1 384287 Purified-2008-05-02  ali follow..  1MK-IKGLLLGMLAYAAMVACTNEDIVKNNVNQPE--------KVKGNLSLVISSTSNSSRAADNEESGVTDPGIEGESTVTDAVIILNRLDENGNLTKEEFGGYLTKAQLNETTAS--------GETIYNPFFTLANSGWYKVLVVLNPTESIEAIANSQQSTDKSKYEQIAESSYTTTGDITIAAAG-QFMMVNKKEIKVDVLSNNYEDPTIKEVEVER.......................................................................................... 202
40 -15.400GS13416A NP_810996.1 385376 Crystal|NMR-2011-06-02  ali follow..  12  1MKKNLLYLWALICSVLLTACSSDDDNTVNDETTPPEEEAVVTAPDVVISMLPDGSDQEVVIADGLPKFITFSQVSDTEVKMELKEFELFINGNILKFGDIVIDKCAVKKETDASTFTGQQDLTFQQSGNATMNIQVKVPALKQTVKVAFSGVKQVEES........................................................................................................................................................ 184
41 -15.400SP13489F ZP_02064579.1 408428 PDB-2013-03-21  ali follow..  1MKLD-KSFLTLFVGLAMAACSNDEEMATGGQNQLPVDG-----REAYMSVS------AMPKSTGTRALGEHHGTADEQNVKEVLLALFDASDVCLETKTLATTDYILNVGGA------------NKAGYDGKAFKVPSATAKVLAVVNPSDKFKLDEVTGTSKNNFMMINAGDNANPTNGALVTANVKVVDGTTIPDVATAISEAQADRSMIYVDRVVAK.......................................................................................... 216
42 -15.400GS14054A YP_001304845.1 384877 PDB-2011-03-17  ali follow..  10  1MRNVVLFMLIVALLGGLSTCSSEVPIGFDTDELSFDMS---------LVLLTGDMQTKASDPNYTYATTE------ELTIQNCHVAVFDKDGKRIYFKNFYSKDLGEMKTIGNLSGYELQLEGVRTFGKED-------KKVSVLVVANANNAN---DNLTTYDGVDNSYTAKTIAKGPVTASLLVKIGKSETTLKYNQDNAPVTVSLIQLSAKIEYTGVYKK........................................................................................ 202
43 -15.300SP13339A ZP_02069903.1 409352 Purified-2012-11-21  ali follow..  13  1MKKV---MMIAALAAALVSCQSKGTQNNDAVAMDESVMAVTGNDEGILPAADGPGIQYVL-SVDSVGPDGESGY-------TLVTTYLDAEGPGKNKSFTSKGKKEVIQKDVD--NKKKTAIKLTPNDGDTPVYFVVVNDTTLR-LVNDSLQEAVSDLNYDIIQVK................................................................................................................................................ 159
44 -15.300SP13425A ZP_02066519.1 408273 Crystal|NMR-2013-06-25  ali follow..  1MKNLYKLFTLTMGLLALSACEADRDSNPVLNEPDTFVLNVPAFASNNVYDLKNSESLELTCTQPDYGIPMATTYSVQISLEEIFVDAHAETNTEANYTTLGTTHSSAKMEVKEFALALGDLWSAS-SDEEFPTTPIPVYVRLKAELTNSGRGIAFSNVI....................................................................................................................................................... 160
45 -15.300SP17904A ZP_02422611.1 411275 Purified-2010-11-20  ali follow..  13  1MRKSLVVLIAVIIAAMLCGCADDVSSSVQQEDSSSRSSTKWTVTKVADDDISCEGLVLTALNVKATDSTLLDTIFSKYGITDYCVYQQAISVELSEII-RADDTDGVKAALQSRKDSLIK----------QFGTYPEQEKIVSSTVVFQKGDLCF........................................................................................................................................................... 155
46 -15.300SP13521A YP_213699.1 407656 Selected-2009-11-12  ali follow..  10  1MNKLLWIGVMTASSLWLSECTQEEKYPFFPEKGYDSGTVIPIKISMA-GEYDSYTPENDMAPRYNAPLIAEWAGVQTLSRTRTKESPEYNGPRIASMELTENTPSTLTTRANTLSTYFRLIVFRKSGNNYVFQSAADYTSNGASSPVLKKGKLLTRSGTIRVIGYSFNTTAALGDIPASYTYNTTKIDIPNMNNDFMTYDSGDIANVNSLNYNLPVTFKQK......................................................................................... 231
47 -15.300GS13959A YP_211888.1 385196 Purified-2011-03-15  ali follow..  1MKTS-KIFMTTLVALTMAACSNDNDWVDQSRNPDVI------APDAYASFS------NIPHASKTRAVSTDPGIAAENTVKSLHVFIYDAESPNTPTVAEFTVAGGTLTQKPAGSSTWMTSQPIS----------TKKTDKYIFAGVNLNAEIVNYITSNGLGAFSYKDFTQEITKLADQTNGFVMFNSAYPTLTPAADLYEKKSEAENNHITISVN............................................................................................. 195
48 -15.300SP13489C ZP_02064909.1 408264 Crystal|NMR-2012-07-13  ali follow..  11  1MKFSKLMSLLLFAAVTQYSCINDADVVIADDTHSESNGNLALF----FEIPNVAT-----SRSAESSGVTTEGSKEEYAVKSLTVYLFDSTTKTLKDQQELKNINRAVTSGQNIQYTADKI--------------VNPGTYNIFAIANGKAITGNISTQEAFLNAVDAVTYSAGKIPSVPENGFVMTNRGAANLNVEVKKPTDSDKVTSVSIGLERVVAK.......................................................................................... 199
49 -15.300SP16999A ZP_02064895.1 408450 Purified-2010-05-29  ali follow..  14  1MKKHFYFLCAIASLFTIYSCTNDVSEDFISQKKVTQDEVFSISYDETKDLEEKTLFNMVSAFANLQNGTTTRSNATSFKIVKESFINKEGEFKKQEQATRAINNDDITSKICEIEFSNG----------------------------SSIGRAIVANALIAFIPKCSSEKMMEQ........................................................................................................................................ 153
50 -15.300GS13339A YP_210994.1 385274 Crystal|NMR-2009-02-27  ali follow..  12  1MKKV---IMLAAVVAALVSCQSKGTKAEEAVADSLAVAMEPTMEEGVLPAADGPGIRYVL-TLNTLANATDTTY-------TLDVTYLDAEGKGKDKTFTSKGKPVKVEKTVK--DKKKTAIKLNPSDGSEPVYFVIANDTTLT-LADDSLEVSESDLNYNII................................................................................................................................................... 154
51 -15.300SP13667B ZP_02068473.1 408422 Selected-2009-11-12  ali follow..  11  1MKKLNNLFTLLSALLLLGACEKDGDTYFLSSPEEN--ELIASANSVVLTKETAKFYALSLA-----TDQTLQVSDPRYQPTTGVQTSVQVSRTEDFSGQILETTESGVSKTYSVSALNIVAYQLKATPEEEAPLYFRL-----AGRNGSNIAPVYSNVV....................................................................................................................................................... 148
52 -15.300SP13416B ZP_01961511.1 406934 Purified-2010-05-29  ali follow..  12  1MKKNLLYLWALICSVLFTACSSDDDNDISGNNPPEEEAVVTYWGNLDISMKPDNSDQETVIGNGIAKFITISQVSDTEVKMELKEFELFLNGTIMKFGDIVIDKCTVKKETDASTFTGQQNLTFSESGALTMNINVKVATLQQTVKVTYSGVKQVEES........................................................................................................................................................ 183
53 -15.200SP17169A ZP_02067074.1 408606 PDB-2011-11-17  ali follow..  1MRKKLLHIIYLASTILLFSCSREADVAYELPAHTTRAQLSIDLVN-----NGDVEQQEKINSMRFI-------------FGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVV----------------------IANEPQS--LTSQLDGIANLLTLQEMIYDISSILNSDGQIISARDISIAPDETKTVQMVIERAVARVDVFIEAIDGG........................................................................................ 190
54 -15.100SP16726A ZP_01962161.1 407065 Selected-2009-11-12  ali follow..  11  1MKRLKITYFILLLLPLFASCTDEEIFQGSGVTEGVPTTVD-------ISVGTAANTAKTRSALLESEERKIYNLY----FNSSGNVECSREYSRADLIQAATDLTTSTGEVDADAPTSMGLLKNISLTTGKKTLFL---------LANYKSDAD--NGISKYSDLEKVRAAMTVHTLFRPNGNLLMSLTQTVTVSTATKQIEVSLKRSEAKITLNLQTIAGLTF...................................................................................... 217
55 -15.100SP16706A NP_811365.1 409166 Purified-2010-09-29  ali follow..  15  1MRQTYYFLSFVLLLFVFISCSNDVVGKGTDTIGLETKEVFFKSSKDSIELRTRKGDDWWLTEISTKDTIYRTHSLNVQVIEGGGLYVEKTGRKSIFIRIDSNLTGLERR......................................................................................................................................................................................................... 109
56 -15.100SP17050A ZP_02072229.1 409569 Purified-2012-11-13  ali follow..  1MKKLYSLFALIALLFTASGCEDDYRSMVLFEGVEEDTVLGIDGGDGSYNVINEH------ESVASVTFTDDVNGYQRIKIHPLAE---------------------------------ETIVKVMDGSGEETQLRITVKGRRQYTLTKMGFEYGISSG........................................................................................................................................................ 143
57 -14.900CM8581A NP_813517.1 368650 Purified-2012-07-06  ali follow..  11  1MKTFRFIYQFVLLLMCTTACNEYDDSELWDRVNSLDDRV--------------TSIENQLKALNN----DITSISALVGALQNRLYLTNVTTLGDGYTLTFSDGSHITVPDGKDGINGKDAPVINVRYYNGRYYWVQTINGETTWLNDSDGN.............................................................................................................................................................. 134
58 -14.900SP17262B YP_001304020.1 412598 Selected-2009-11-12  ali follow..  1MK-IRNILSVLFVGLLFTSCNSEEEVQRGNED----------GRDISFSMTTLGEVTAMTKAGGDIAEGYTYSTEDEVKVNNVVVAIFNEANGTVGECLEYKSVAFDGGIPNSTVTIDGKTLIAYKIDNIQ----AKTGKVRIVAIANSTHY--EDLARLGTTTYENLKGLSETVSGGTFDASNLVKVGELAAYDLNTAVTSISVPMTQLAARIDMKFT........................................................................................... 203
59 -14.900GS13572A YP_001304049.1 384718 Selected-2007-09-11  ali follow..  1MK-TNNLYITLFAALAITACSKDNELPQGSAKDPNADM-----PDAYTSIA---NIPHTTMTKAASGRAIDQGIADENKVKTLHVFIYDTDAPNTPTVAEFTVDDNSLAPKSPGSSTWVTNRAIK----------TKKADKYIFAAVNLNTDMV--NYITANGLGSFSYNQFAQEISQLADLTNGFVMFNTSYPESTPAANLYENESLAQTNRMAIPVSR.......................................................................................... 200
60 -14.900GS13822A NP_811926.1 384120 Crystal|NMR-2008-10-22  ali follow..  14  1MKKILMTICLIGGLAMLWSCSDDKDSY-PVPSDIENLKATPAPGQITLSWTNPADENLYYVQIEYTIGATGKSYRKQVSQYANELVIDNLLQKYGEI..................................................................................................................................................................................................................... 96
61 -14.900SP13339B ZP_03459209.1 407403 Purified-2012-10-25  ali follow..  10  1MKKV---MMIAAIAAALVSCQSKGNQNNDTMDEGVMTVVGNDSSEGILPAADGPGIQYVL-SVDSIGPDGESGYTLVTTYLDAEGPGKNKSFTSTGKRQVIQKDANNNK---------KTAYKLTPNDGEDPVYFVVVNDTTLR-LVNDSLQEAVSDLNYDII................................................................................................................................................... 154
62 -14.900SP17738A ZP_02079225.1 410120 Selected-2009-11-12  ali follow..  2MKKAFVIAAAVLLIVSLSSCSGGSSGPVSSGGEESPSSSQSASIGDVTVTMTKERQQELLTDLREEIENAFEELAGGSATPYVTNI--TCDENFTHIVMEVEREAYEAAADMTPVTLGFSAMLYQKFSGQEPHCNITVKDAATGEAITN................................................................................................................................................................. 203
63 -14.800SP16619B ZP_02064828.1 408507 Selected-2009-11-12  ali follow..  1MKKNILYLLLGILAL-TSSCQDPEYVLPTADRQGITSLTALFTSG-----PYVDKEAVVYTIADASVDKYVIPMPWYYPENSDNETSEYMKAMRIQAKLAPNCTIEPVLSILDLTKENYFTYTDAQGYKKQICITGERVKSTKCQLLSEDITGIIDEDHKTVSLISAEDLSSCLADYSLSAHATMSPDPKTEFNSPVELTVIAHDGVTKQTYTIQKAVPDK......................................................................................... 223
64 -14.800SP18945A YP_811611.1 412046 Selected-2009-11-12  ali follow..  12  1MKKILISTTLALALLSLGACSKKSDSKAKASSSVSSTAIS----------SSSSTSSSKKVENNQENISSSFQMTVEATQKNMETTKASFKDTYSDIKVTAEAPETIVYTYTRIAS.................................................................................................................................................................................................. 106
65 -14.800GS13740A NP_813401.1 384770 Purified-2010-09-29  ali follow..  10  1MKLNIYLIGAFFGMLILASCGNDDDETPVPKDDSWYWGFKGEINGKEISLENEAHTDWSVHSVKTSASPPNNDTDSIRGMMLLSITIYHLHKGIRYITKSTKTDWIYDGIQITRDTYEDKYIYYIPQKEKPFQVEITIEGNLNGVLYRSDNSIIINGSY....................................................................................................................................................... 187
66 -14.800SP16619A NP_809363.1 409090 Selected-2009-11-12  ali follow..  10  1MKKNIQYLLLGVLAL-MSSCQDPEYVLPTAERQGITSLTALFTSG-----PYVDKEAVVYTIADASVDKYVIPIPWFYPEDSENETAEYMKTMRVQAKLAPNCTINPVLTILDLTKENYFTYTDAQGYKKQICITGERVKSNKCQLLSISGIIDEEHKTVSLISAEDLSSCLAEYSLSSHATMSPDPKTEALFNSPVELTVIAHDGVTKQTYTVQKAVPDK......................................................................................... 223
67 -14.800SP17387A ZP_03459300.1 407626 Selected-2009-11-12  ali follow..  1MK-LNKFFMLGLAGLAFAACSNEDEVGNDLSQNSKTITVK-------IETGGYTT-----RASGNGAWTDGANNQSQITVNTVTLYLLDKDGAIVDTKTLENK-------------------------SSDTFHGVSGTVTKIAAVANCQP--TASGTWANVVAETFDVADYQTAENAPVYAEAVDITYKNTDTQDGYPMYEATLQLATKMSRIELSGNLQC........................................................................................ 182
68 -14.800SP13489B ZP_01961851.1 406881 Selected-2009-11-12  ali follow..  1MKFTQLMSLLFMAAVTQYSCINDADVAFSDESHTDSNGNLALF----FEIPNENH-----TRSAESSGVTETGSKDEYAVKSLTVYLFDSTTKSLKDQQELKNIRQVKGEGRNIQYTADRI--------------VNPGTYNIFAIANGKAINKEITMQDDFLNAVDEVTYSTGKIPNVPTEGFVMTNRGAANLNIEIRKPTDSDKITNVSISLERAVAK.......................................................................................... 199
69 -14.800GS13183A YP_001302937.1 384604 Purified-2013-08-21  ali follow..  13  1MNKVNILSIVFAGICAFSACTDDKDPVINDLKDSEGNNISFTASSIIDIFTEQPDYYTVQVCEGGTEFEKFESLPTTGSGEKVLIKTFELNDAMNNLGMVNPTVAYNVDFRLKAFINDSVPELYSNTVNMAITPYSGARTQVY....................................................................................................................................................................... 166
70 -14.700SP18311A ZP_02091540.1 411558 Selected-2009-11-12  ali follow..  4IKRFAAVLLAGIMALLLTACGGSDPGNPEFDPKVESAYLDALNKTFGTSFENDADIKRLAIEHIEEKHGA................................................................................................................................................................................................................................................ 74
71 -14.700SP14084F YP_001304878.1 412698 Purified-2010-09-29  ali follow..  13  1MAYLINIFLLIAVLCGFSSCEEDPYYDPYEEITYDWFVVDGLDCEQQLTFNPDGKGWDTRIYHYPSGRIDREEIPFYWDWDNTDILYMDYEDGQTTLENVWISGRTFKCLYNGEWVTFKAY............................................................................................................................................................................................. 133
72 -14.700SP18671A ZP_02034056.1 412969 Purified-2010-09-29  ali follow..  12  1MKKLSTLTTLLSIILGFAACDNEQECALYNTDAANRAVFVNASLANITVSPADPTFT--VDLVRANADSESSGTIVLTATVDEVPLAGCTVSDYTFAAGENMTKVTVNVSPLEIGKELNITLTLDNTNEP.................................................................................................................................................................................... 131
73 -14.700SP16701A NP_809759.1 409160 PDB-2013-02-07  ali follow..  1MKN---ILFTLFAILILTSCSKDEEDWTELNSNN---STGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVETGSEA..................................................................................................................................................................................................... 112
74 -14.700SP17016A ZP_02071672.1 409526 PDB-2013-11-21  ali follow..  17  1MKTQFFMLILISMAFSFISCTDEDDKVEIPQ--IVKEPVLQDDFVTCYTFNADKTYEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQHILKLTSKEMKWENASPKDGNSDKRLEKYND........................................................................................................................................................................................ 132
75 -14.700SP16671B ZP_01959320.1 407064 Selected-2009-11-12  ali follow..  1MKDIIFCIILLMLQFIPTACRDDYFMNEEIGEGNATLSVT-------LCFDDEGNAIQNINSLCMLFYDTTGKLVHNYIVKGEGLVIDPDVSGWSYNLEDNRIDEDKDEQGNQFEDSKTGTAMFKLRP-------IKRGKYYIYAVANMGDLTQYKDKITTREGLKAISLQWDPDDISQNLTPDRNAPDDLVTINSPGVQLHSWLRRAASKVTVAFDGSG.......................................................................................... 230

FFAS is supported by the NIH grant R01-GM087218-01
1 1 4 9 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.