current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: GS13854A YP_001304333.1 384463 Purified-2008-06-17, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MDKKTVLLASACTLLMISCSNDAELINVAETTGLQTKAFVGEADFQIVDYAGDKCIQFKNDSVFNAMLWEMNDMSEEERNNIFSGAGFVSQWQLMQEADQEQELIVDNYEKDLSQPWPAHQIKEFKQKYDDVFMFEPYDSTDFIAHYKLKGSTYSSFVNRRGVFLIGDSVAHAPVYKALEEYFGSGISLYGNNEATNEKNDINLAESKYQIPGGDYVKVRAIPRFIELQTIENKNYLSLGFDYLSQKKKVLWKKHRTMIILRLTASGSGSGFEVYNVSIKNYQNKNGVTILLHTDVYNKLLAKDQGGMLGHVGENPRNSVTIVTPPRFEFSGRMEIWSDEMPESNKGTAKISLKEDWLast
1 -121.000GS13854A YP_001304333.1 384463 Purified-2008-06-17  ali  100  1MDKKTVLLASACTLLMISCSNDAELINVAETTGLQTKAFVGEADFQIVDYAGDKCIQFKNDSVFNAMLWEMNDMSEEERNNIFSGAGFVSQWQLMQEADQEQELIVDNYEKDLSQPWPAHQIKEFKQKYDDVFMFEPYDSTDFIAHYKLKGSTYSSFVNRRGVFLIGDSVAHAPVYKALEEYFGSGISLYGNNEATNEKNDINLAESKYQIPGGDYVKVRAIPRFIELQTIENKNYLSLGFDYLSQKKKVLWKKHRTMIILRLTASGSGSGFEVYNVSIKNYQNKNGVTILLHTDVYNKLLAKDQGGMLGHVGENPRNSVTIVTPPRFEFSGRMEIWSDEMPESNKGTAKISLKEDW 357
2 -80.100GS13536A NP_812134.1 384667 PDB-2013-06-20  ali follow..  26  1MKKFSTLTLTVCLGAFISCTNDEQEVNMVKPT---------NANSEIEVINDGTMIKFKDVESYENALLKVSAMSTSEQVSFLNSLSFKSQMILMQEADGELDKICNQAAD---KAEFDVLYEKYKHKYGDVFMFNTIDATDLSPYSRLVYVANEYFVNMKGEFMIGDSLVVDKVYTDFKERQQQFTVSTRSSVSDLSSINEAYSRQKDR----------------KVGLYLSVSSGIIHANFTSQKKGVFWSRYSTTYHAKVNLRGFEFAQGELLGYGPVYVNKDGIPFAIDTKEMGGNVTKVFGRKL-----------------AQECTGTIEIWSRGVPYDQRGFATVRL.... 310
3 -70.100GS13794A YP_001299735.1 385123 Purified-2008-05-17  ali follow..  19  3IEKFGCILSACMIVSLLSCNSENEFIGSAQETEVSTMDMWVKETRSVSEYLNMPVLHFKDEQVYSETLRQLKNMTENERFTYFQQLGFEGAYILWEQADRELDKIFDMESDDSHLI--QEMINTYKDKYSDIFSFNTVDLFDVTPYFTFTDNDLSLLGNIKGYVVIGNSLRGPKYDYPTYDLDEVVSATRAAEPTPIEPGFKGFKDASLTIKNGKYKSTMTIGRIV--------NGNSFAVEFKTKKKQLFKKSVKAGYSAMLTMKSSKFNYKNTVFCPY---GKEVSILNLPIERVGN---------------------------VFDAVVENFKSSRGDAKGNQSFHNIRV.... 321
4 -37.300GS13623A YP_210088.1 385065 Crystal|NMR-2011-06-15  ali follow..  13  1MKTISKLFLLLSIILLSSCDETELDQTVTNQVNPQKEE--------------DSRIVFNSAKEFYNTLDTLSYMTYEEQTEWIRASGIKYPLYKDLEFCEDEIMT-------------------------------------------EMPRAFQALFNHKMEMQINDTVIAFEKGNMYVKSIKEKILPVPVLYGQVGVNQEESEVTTRTVYETKYGKIGTSYQYEFKIPEGKSKWSNLFLVLKLEWKG-KWKVAEKE................................................................................................... 223
5 -17.700GS13235A YP_211485.1 384941 Crystal|NMR-2012-03-15  ali follow..  1MKLNKLFTFTLAALAMAACSNDDEPGIDQKGELIDAISIAFTSSSAPATRADKG----GTENNVYVAYLFAKENDPQHEGAKVGDWTVKRVAGDSNTDDKDVAAAIGEGDVATPGTKKNMCTFNGVRQGDSVYV----------------------VVNDPQMTLATAQTLAHQGDKSEAAIRAYISNLSKSYLNDLTVTKDGTQGKKYIMAGVSAIPTNP------NIPNGSTVKVSIPLNRELAK.............................................................................................................. 223
6 -16.900SP13489F ZP_02064579.1 408428 PDB-2013-03-21  ali follow..  12  1MKLDKSFLTLFVGLAMAACSNDEEMATGGQNQLPVD--------------GREAYMSVS------AMPKSTGTRALGEHHGTADEQNVKEVLLALFDASDVCLETKTLATTDYILNVGGANKAGYDGK---------------AFKVPSATAKVLAVVNPSDKFCVASASWSAINGAVEQTLDEVTGTSKNNFMMINAGDNANPTNGALVTANVKVVDGTTIPDVATAISEAQADRSMIYVDRVVAK.............................................................................................................. 216
7 -16.800GS13148A YP_001298222.1 384287 Purified-2008-05-02  ali follow..  11  1MKIKGLLLGMLAYAAMVACTNEDIVKNNVNQPEKVKGNLS---------------LVISSTSNSSRAAD--NEESGVTDPGIEGESTVTDAVIILNRLDENGNLTKEEFGGYLTKAQLNETTASGETIYNPFFTLANSGWYKV------------VVLNPT---------------ESIEAIANSQQSTDKSKYEQIAESSYTTTGDITIAAAGQFMMVNKKEIKVDVLSNNYEDPTIKEVEVEVSK.............................................................................................................. 206
8 -16.800SP17262B YP_001304020.1 412598 Selected-2009-11-12  ali follow..  1MKIRNILSVLFVGLLFTSCNSEEEVQRGNEDGRDISFSMTLTLGEVTAMTKAGGVAIFNEANGYKSVAFDGGIPNSTVTIDGKTLIAYKIDNIQAKTGKVRIVAIANSTHYEDLARLGTTTYENLKG----LSETVSGGTFDASNLVKVGELAAYDLNTAVTSISV............................................................................................................................................................................................... 189
9 -16.700SP16580A YP_212482.1 407982 Selected-2009-11-12  ali follow..  4IKRFFLSTAAVTAALITGCTPEEEHMPVQGGDSFTLSSSEEQVITRAGDVSVS---HFTGGTKY-----RLYGLVGGAWDKKLPTMNGQEGTEAVAADGTHQIDYLSAGADEDRFEGRTLDFYALTYGNTTLPVCGSEVDGVPACGIHADDLRRAVLTKQSGILPFKHTLAKLKEVVKQKTENGSTGVDVLAGIELKGISVSDYSEGSLLLSTGEYSHTGGKSDRTLLGSGFSQTVTESVLPVTTNGQA---GGAAAECLIFPTLSGTTEGLKIKVATKGTNSADRTDTYEIRVPVVGDDENGKTVTEPFRFLPNYEYMLTITITNSDVQIITIYDWINGVMWMDRNLGATSYVYQL 401
10 -16.700GS13326A YP_213074.1 385259 Selected-2007-09-11  ali follow..  1MKYYLLFYSLIFLFIFCSCYDESLNFDHDIIQKDLDSNYTFI-----------------NEADALDLVSYFINSMENSPATRVASLDTREVEGIVTFPKTRANLLPEWLQEFNKR----------------FYIVN--------------------MKNDKGYAIISKDFYAILDHGRFN................................................................................................................................................................................. 133
11 -16.700GS13975A YP_001297735.1 384192 Selected-2007-09-11  ali follow..  11  1MKKTTTILCLGIALCMLGCSDDDDQVTTTSTVPF-SLTASLSPRSSDAEDTGILQGNWDANSQLAVIKTGSSGVPKSILTRKTDSSDFTGNLSTLVKNENEIAVFYPAAAITANSSDTLTQTLNLSGQDGTLAGITNYDYLWAQCKAGMNETTGSSACEMTSLVTIGKFQFTVNGGSPLNNITRITITATAGTLYSSAVMKLKNGEFSSTQTGNITIKNKAGISGTTYISFFPSEAQLHFTLVTTTGEVY........................................................................................................... 250
12 -16.500C.KN20883A NP_904517.1 425088 Crystal|NMR-2014-01-11  ali follow..  1MKKYLLYASLLTSVLLFSCSKNNPNEPVEDRSIEISIRVDDFTKTGEAVRYERNLLLFDQSGANPAKY-YITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTV---KRTTAMPWSTDIASPFLMSGNKTHDFLANRLNVPLVRAIAKVE....................................................................................................................................................................................... 185
13 -16.500SP13271B ZP_03460302.1 407401 Purified-2012-10-31  ali follow..  1MKNILVYLMLAATFLLSACDKDEKMLEPSYLPVTYANIAGT------------QLAEWNGVEMSEGRYCYLV--IKRKADEETGKRALEIYTNIDSDKSHLLTSTYELEENEDLGSIISGIYDHAAGFWNNSYLISELEADRMVWTVLEDAEDVSVYVRCEK---VPEDIMN......................................................................................................................................................................................... 156
14 -16.500SP13339A ZP_02069903.1 409352 Purified-2012-11-21  ali follow..  13  1MKK--VMMIAALAAALVSCQSKGTQNNDAVAMDESVMAVTGNDSSAVAVY--EGILPAADGPGIQYVL-SVDSVGPDGESGYTLVTTYLDAEGPGKNKSFTSKGKKEVIQKDVDNKK------------KTAIKLTPNDGDTPVYFVVVNDTTLR-LVNDSLQEAVSDLNYDIIQVK.................................................................................................................................................................................... 159
15 -16.400GS13959B YP_001301305.1 384525 Selected-2007-09-11  ali follow..  13  1MKTSKMFITIVTALAMASCNNDKEFANQPELEM----------------QVPEAYASFS---SIPHTSGTRSVTTRSTEPGTDAENIVKSLHIFIYDKEAPFTSTVAEFSVAANTLQQAPGNTSQWITTRPV--------------TKKADKYIFAAVNLNTEIV--------------DYITSNGLGAFNYKEFTQEVGKLADQTNGFIMFNENYPNITPATNLYEDKAEAEKHHISIPVSRVTAK.............................................................................................................. 202
16 -16.300SP16548A NP_809976.1 409008 Purified-2010-09-29  ali follow..  1MKKKNFFMLALAAVAFAACSNEDLVPTGNPG----------DDNQLVTDPTGDAWVALA----VKTPVQTRGLHNPNQEAATEDESKITTVRAIFFTANANEDAATVTADLTLDNDEAGLDANG-----------IPSGAAGKAFKVPATSKRILIIANPSPKFETDQKWPVGTTYATVNAALDDTSASMTTAGKFMMSNAKGSLEPSDENEASGTFGAPVDLALYATETAATNNPISIRIDRVVSK.............................................................................................................. 228
17 -16.200GS13959A YP_211888.1 385196 Purified-2011-03-15  ali follow..  12  1MKTSKIFMTTLVALTMAACSNDNDWVDQSRNPDVI---------------APDAYASFS------NIPHASKTRAVSTDPGIAAENTVKSLHVFIYDAESPNTPTVAEFTVAGGTLTQKPAGSSTWMTSQPI--------------TKKTDKYIFAGVNLNAEIV--------------NYITSNGLGAFSYKDFTQEITKLADQTNGFVMFNSAYPTLTPAADLYEKKSEAENNHITISVNRVTAK.............................................................................................................. 200
18 -16.100SP14088C YP_001299543.1 409783 Purified-2010-09-29  ali follow..  1MKK--VFIAAALAAMIVSCGSKGNKSAEIIAESESDSIFAVNDSTLGELQTYEGILPAADAEGINYQL-TLQEAGQDSLGTYNLTTTYLGTK--------------DGNQAFTDSGTVVTIIGIPNDSTAIVYQLISATPGHEKTNFLAEGDSALTMIGKDFKKAVSKLNYTLK....................................................................................................................................................................................... 159
19 -16.100SP13255A ZP_01959681.1 406916 Purified-2010-09-29  ali follow..  11  1MKK--ILLAVTAALAITSCSQNEEFENEGQKTE----------------------INFTT------IVSKATRASELKTEGLKTNGGF-KVFAYNTKNNDMSAETILGETLFMNGVIVSWNSSAWTMNPVGPYYWPLKDKIQFFSYSPVANVSYVKPTSSKA----GYPSFSYTIVDSQEDLVVAYAKNETKPGVSGTPVKLDFKHVLTQINKLKGKDDGFTYKVTEITLSGINNTGNFTYVDPTESVVGTWSSPSTPKSYQYNATYT----DFTGTSGLTLATGDNALMLMPQTLGENAEITIAYSTVYGGGEVFNGEKKVSLKDVVWGAGDKILYTLLLP---GGAENVTFTTNW 319
20 -16.000SP18362A ZP_02031599.1 412768 Purified-2010-09-29  ali follow..  1MKLRNLMYATMIACAFASCSNDDVPTPDNGNPDAQGGTSLTVKFDKAADTKASGMLVFNADGKLEVVGTKVNTPAVEGGNDAVAHAELTA-KEVALIANYTVPTNLIGETKEEVFTALNKTFDSELEVGAALTMNSKTGYVNVEGLSDNDLKKPVKLYRNVAKVVLNKFILQGHKKTNLMGEDWKEYGSTNVENEWYSAYEHTTDWLNKDDKYTLVDNPTVPDGTPSWIKTTITGTVTTSNAYETVNSFYVYENTNLTNRTLLVVKGDFSYKINDTDRKTESDRYYTIALGENFQVSAESNVASELLTLRGVTGNDGKYNGLYRNLQYDLTLTVTGPGYQTPGGGGDPTTLDVQVPF 413
21 -15.900SP13537A YP_212941.1 407663 Selected-2009-11-12  ali follow..  1MKVKKILLSMCAIAALASCSQNDDVVPAGAGGEEARVVLKLEGDAVDTRADVPAVFFFNTTGFIVGT-PKYIGVAADIAKPITTTTDASQVVVIANAGVSSIDQLKTKVFSSVTTTTDPTTKHTINQTKDRLYMSGMGKVTIGS--------------TGTATVNLHFISAKIN....................................................................................................................................................................................... 185
22 -15.900SP13259A ZP_02069221.1 409319 Purified-2010-09-29  ali follow..  1MMKMKQIYLFLSLALLCACSSDEELPAVAQQPCPALE-ITDSSASGTRATDNGAATTFENGDRVGVIVLEDGTLKGNNLPYKYNGGSWSFDAATVNSEGTGKSVY---------------------------YYDNKATNVTYIVYFPYSTD-ANDVTSIEGDGGLKSKFIPKADQQSEADYRASDLMIWQSTAGIAPQKTLAAT........................................................................................................................................................ 184
23 -15.900SP16956A ZP_02068835.1 409249 Purified-2010-09-29  ali follow..  13  1MRTLTKLLWILLLGVVFSCQDNVIDAIDATIDEKNFDTKMYETSVSVEDARNVAELFTVKDAPRTRVSKSVKEIITIEGENYDNEQGF-----LLVSATKNFQPILAYAERGSANNRMPDGLSDWLGDMKNVIEERDKMPIDST..................................................................................................................................................................................................................... 150
24 -15.800SP16701A NP_809759.1 409160 PDB-2013-02-07  ali follow..  14  1MKN--ILFTLFAILILTSCSKDEEDWTELNSNNII-------GYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK..................................................................................................................................................................................................................................... 119
25 -15.700SP13339B ZP_03459209.1 407403 Purified-2012-10-25  ali follow..  12  1MKK--VMMIAAIAAALVSCQSKGNQNNDTMDEGVMTVVGNDSSAVAV-----EGILPAADGPGIQYVL-SVDSIGPDGESGYTLVTTYLDAEGPGKNKSFTSTGKRQVIQKDANNNK------------KTAYKLTPNDGEDPVYFVVVNDTTLR-LVNDSLQEAVSDLNYDIIQVK.................................................................................................................................................................................... 157
26 -15.700SP16885B ZP_03459212.1 407567 Crystal|NMR-2012-07-27  ali follow..  1MRKKLIFSLLIILIATTACEDNNDSGGNGSCPTVPFSTIRLTEDSPYEAGVPTVTYSYKRGQLAGFTTVQ-SYSVQNEPVKIENTTSVTYEEHQAIATDNFGNVSTYLLNDKGYAIQCTRQEVGATRTYGFSYFTSPEGKPYLKNITESINGKVYASIGSNPQAL................................................................................................................................................................................................ 171
27 -15.600GS13339A YP_210994.1 385274 Crystal|NMR-2009-02-27  ali follow..  10  1MKK--VIMLAAVVAALVSCQSKG----TKAEEAVADSLAVAMEPTMEETQVYEGVLPAADGPGIRYVL-TLNTLANATDTTYTLDVTYLDAEGKGKDKTFTSKGKPVKVEKTV-------------DKKKTAIKLNPSDGSEPVYFVIANDTTLT-LADDSLEVSESDLNYNIIRVK.................................................................................................................................................................................... 157
28 -15.600GS14032A YP_001304358.1 384570 Crystal|NMR-2009-04-03  ali follow..  1MKQVIYFLFSMLLFLSISCNKGEDISFEETPYYLGYFEGKVNSQDISIANQSNSHSFIDHGNFWQEVNTDLSGFYWEIPLGVHISDYPYPMLRI-EYLIDKGKLLNEEIESTVRITKDDAKIVYHPLKSSFRIQVDSIRFHEGSGTPYIEGKMEGILYNIENSIVIKDAIFGIH....................................................................................................................................................................................... 184
29 -15.600GS13436A YP_212757.1 385403 Purified-2008-11-03  ali follow..  1MKKIYFYTLLLGLLAFTACEDEKSPVMELQKAS-AFEPFSQSDFTFNDENAAAEFPEIKTAADYGVKAVVNYDVTLTNDANAKTVLLGETGTTSLKFTNGQMNTMMAK......................................................................................................................................................................................................................................................... 108
30 -15.500SP16540A YP_212841.1 407913 Selected-2009-11-12  ali follow..  1MKTKYILYLLSLVFLLSSCWKEDLKNCWMGDVTLTIVAEKFQQPATDEG---------KLEENLSTRINSIRYYLYKDNVLIHSGIIDNVTDLNTDAYKLTFPKLAFGDYCLALATNVSEEELPDTTTPEALNLNYPGVEQTKDYFTSCYDFTVDCECGYQDFVILRRTQTQFQLKQLPENITGIGIEIHKVAATCQIDTLYKGETIAEYHTTVAEVTNAEEVADFSIGTFPTSGPENASITLKLYAD---------------------------------------------------------DHSGFPIYQKTLNNISILRNQLTRISTDFN------SILGNSGFSITINPDW 288
31 -15.500GS13609A YP_001298747.1 385049 Purified-2010-09-29  ali follow..  10  1MRIVNYIVIILSLLGMTSCNDDKEVLPFHLDKKSYEVMLMGWNDIPITNGSGRLSVTTDDKEIVSVSCTTLGIDGATAMLRITGLEKGNVNLIVKDDVTNETERISVKVTDSYLVYMVGESKHPSLPNGTIMYLINNEAQDCYFFTYNNIEHEVHSDFITKGSYSF............................................................................................................................................................................................... 169
32 -15.500SP13436A ZP_02069797.1 409450 Selected-2009-11-12  ali follow..  11  4MKTKYIYLLLAGIFALMSCEEDAT-PILELKTAAALHALSQTDITITKDNKDAQFPEIADKADYGVSAVVNYVVTLTNTSTNKSIVIGETGDAKLAFTNSEMNSLLAKQTYDFTVSLVSEAYDAYTDAASNSITFK............................................................................................................................................................................................................................. 145
33 -15.400SP16785B ZP_02072330.1 409461 Purified-2010-09-29  ali follow..  11  1MNKIFFLGLAVCGLAMTACSDGVEWEPSPVPTEGVQAYIYADNTDLTYYPNDEQVFVVKIGRQKTDAAASIRLTTDAENVTVPTTVDFAA-WLNIGIGYYASQLFGEGWDQPVLKAKEANIYDCITKGYPIMFTLSDDNQELIG----WDPQPTGYDKTDYGMLYFAAA............................................................................................................................................................................................ 217
34 -15.400GS13572A YP_001304049.1 384718 Selected-2007-09-11  ali follow..  13  1MKTNNLYITLFAALAITACSKDNELPQGSAKDPNASIAINIPHTTMTKAASGRAVFIYDTDAPNTPTVAEFTVDDNSLNRAIKTKKADKYIFAAVNLNTDMVNYITANGLGSFSYNQFAQEISQLADLTNGFVMFNTSYPESTPAANLYENESLAQ--TNRMAIPVSRVVAKAA....................................................................................................................................................................................... 206
35 -15.400SP18825A YP_001297746.1 409725 Purified-2012-10-31  ali follow..  12  1MNKLRALFISVASLFFAACSDDDDKSIPVPEPSRMITGIKVHKISDVITYQGMISLTYDNNKR----LTRIYSSSPLAAVNYTYKENSEVSYTYSTENSPLVEISTSLENGRSYVCKFSNRENPVTYSYDNEGYLKSCNNNGTVLEYNWESGNLSSITTTPR................................................................................................................................................................................................... 163
36 -15.400SP19011A YP_001301380.1 409888 Selected-2009-11-12  ali follow..  13  1MKKILFTSLAVLGLGITGCSNEDLGVAKSGVDEVCATMGDAESRTAMNGSIGDEIGIFGSSSTYTNINYSLSSGAGTKNAGFESPVKKAAFYPYGSDASYDGSKI............................................................................................................................................................................................................................................................ 119
37 -15.400SP13425A ZP_02066519.1 408273 Crystal|NMR-2013-06-25  ali follow..  1MKNLKLFTLTMGLLALSACEADRDSNPVLNEPDTFVLNVPAFASNNVYDLKNSESLELTTQPDYGIPMATTYSVQISLEEIFVDA-------HAETNTEANYTTLGTTHSSAKMEVKALEFALALGD-----LWSASSDEEFPTTPIPVYVRLKAELTNSGRGIAFSNVI........................................................................................................................................................................................... 160
38 -15.400GS13896A YP_001304282.1 384805 Crystal|NMR-2009-01-30  ali follow..  10  1MKTRHLLNILLLALYTSSCNKEDTPLIKTETVKIFLLSETNRIQNEDIENHEYILAKEENQVDFQEIISAIEGFHYEKGYEYELLVEKKTLVNTNFDNNQTKYKLIELISKNKVDFK................................................................................................................................................................................................................................................ 118
39 -15.400SP18220B ZP_02090547.1 411520 Selected-2009-11-12  ali follow..  1MKAMKTFAALLALAFLAGCGAVDGDPVRPAPGSAGRGSSTAASGADSAEPERTTDVHAVLDSLPEQSWQFVADIPADRWVAAPGGGR--ELYCIFAVRKEDTLFVYEKQEPAYPAQLGKELYGR--QGGQPILLLCNGSREDTDTMVMVYCSTGRSL--ETGRPVPVEGVDDFSQHPTPGA................................................................................................................................................................................ 210
40 -15.200SP16857A ZP_02037157.1 407190 Purified-2010-09-29  ali follow..  11  1MKRFFALLSALGLLLLAACGPAAESPAPTDTTPPPTESMEPTPPPEESLPVETPEATPPQESLPPEETEEPAEPELPVSADYADEDLLSRPEDLLDDSEYRVDVAITATETVTDIQVVSIPMDDMGYRVDAVLGTLDAIVPGRPFFTDSDGAVHYCAIAKDGSLLLIP............................................................................................................................................................................................. 192
41 -15.200GS13416A NP_810996.1 385376 Crystal|NMR-2011-06-02  ali follow..  14  1MKKLYLWALICSVSLLTACSSDDDNTVNDETTPPEEEAVVTAPDVVGTYWGNLDISMLPDGSDQEVVIADFSQVSDTEVKMELKEFELFINGNILKFGDIVIDKCAVKKETDASTFTGQQDLTTCATSIEGTV---QSGNATMNIQVKVPALKQTVKVAFSGVKQVEES............................................................................................................................................................................................ 184
42 -15.200SP16619A NP_809363.1 409090 Selected-2009-11-12  ali follow..  1MKKNIQYLLLGVLALMSSCQDPEYVLPTAERQGITSLTALFTSVVYTIADASVDKYVIPTAEYMKTMRVQAKLAPNCTINPVLTILDLTKENYFTYTDAQGYKKQICITGERVKSNKCQLLSFSIPAEDISGIIDEEHKTVSLISAEDLSSCLAEYSLSSHATMS-KTEALDFNSPVELTVIAHDGVTKQTYTVQKAVPD............................................................................................................................................................. 222
43 -15.100SP18058B ZP_01995605.1 410699 Selected-2009-11-12  ali follow..  10  1MKKILVVLLSLTLIFFTGCTSSNNGAAEDVEIKTQEVVTSNTDDDDDNISNTENAVE-YDFSSYENDVRNITKSVNNAKRS-ENHEQFYALKKQVDAVDDELDKLDDEFEYAYQMKEISETYKARERAIEKLEDELELAEEALENKYGIDD.............................................................................................................................................................................................................. 161
44 -15.100GS13688A YP_001299142.1 384415 Purified-2008-11-12  ali follow..  12  1MKVNKIGMFVATATLFVSCNTDNEGDIYNGTTMGVTFATGTQSVSFPSTGYEGFDVEVLRAKSSEATTINLSATLVVGDKEQELPASITVPSSVSFAAGEFKTNI-------------------------HVTVGDITPGQNYKVKISLPEEMVTIDQTSDKVITV............................................................................................................................................................................................... 143
45 -15.100SP16955A ZP_02069545.1 409248 Selected-2009-11-12  ali follow..  1MKKL-FLFMSWVMLILSGCADEDIIERNSPSFPQSVNTRSAGDGVYDILGYGYDITPYLDTKSSRAIVFDTNKLLEKGLESRFRYSSGKDVIDFTTNMSSSLQMSTPGILKVIGGASLNIAFGGYNSDYSSRYRISEADINVLKTCLTLSTYTPEQIVEEYGDIYLGAKF------EVYYMAKSTSSSKKESINAGLGASLFSLFKMDGKFQYDESLAITNKEQSLYYFTIGGDPAVGVQGSLNPENSPSIWMASVKSSTPKFI............................................................................................. 293
46 -15.000SP18246A YP_001302643.1 412689 Purified-2013-08-22  ali follow..  1MKIRKLCMFAAMVGIMTACASDEQEEMFPGEGEPVTVKLSIDTRAAGADDFESQVYAFHNGSLVGYYYG--GEDVQPHTFKWKLPQGEVWFYAVANEQAAGKLLSENKGDIFVLPGETVGGVREVAPDRLESLTFSRLPEAEYMS-VPMTCKYRGTVTHDNQEINL--ELKRS........................................................................................................................................................................................ 200
47 -15.000SP13416F ZP_02066301.1 408298 Purified-2010-09-29  ali follow..  13  1MKKLYLLALVCSLTFFAACSSDDDDSDNKDNGNPPEEEAVITAPDVVGTYWGNLDISMIPDGSDQEIVITLSQVSNTEVKIELKEFELFINQQILKFGDIVVDKCEVKKGEGVSTFTGQQDLTTCPVTVTGTV---EDGNADMTINVKVPTLQQTVKVTYSGVKQVAES............................................................................................................................................................................................ 185
48 -15.000GS13271A NP_809127.1 384982 Selected-2007-09-11  ali follow..  1MKNIKLMALFAFVLCFASCDDDEKVEIPALPVTAANLNGTWQLSEWNGQALAEGTYCYITFNRRELTFEMYQKFDSMYARYITGSFNIEN--------DPYLGYVISGEYDFGNGDWNNDYIVTDLLESGSMIWTVKDDDSDVNKYVRCEK--------------VPESIIE......................................................................................................................................................................................... 151
49 -15.000SP13609A ZP_02068060.1 408456 Purified-2010-09-29  ali follow..  10  1MKTKHLLLSFLCTIIFFSCGNNNEEKIYPLSFEKEYYEQPLLRATDITIRGGNRTVTVEETDILSIDVDLSSSIGMGSLKVTPKKKGETKV-KVKGNITNEIVELKIKIIDSYLAYAIKESNHPALSNGTVVYLINNESKDCYFFRYSDSKNELSQNPIAKGTYDF............................................................................................................................................................................................... 170
50 -14.900SP13236A ZP_03460377.1 407617 Crystal|NMR-2014-03-31  ali follow..  11  1MKTFRLLATSLLVALVSSCGDEITNEVVQQEPDNTLELLLGTWQ--GAGEAEGETLTFNKDKTYAEI----ENETLSGRFEYFPNRYMFVIYYTTDWGEENTIYTVVKITEDELYLNNNGHSDIVIYNRKP.................................................................................................................................................................................................................................. 129
51 -14.900SP18243A YP_001304214.1 412686 Selected-2009-11-12  ali follow..  1MRRYTVAAGLCLCWLFMACGEDRGGDLPDDDPNHCVVTITLRTSRSVRPPQTKAGGMMTKADETTETDFWAKDEEYERD--------ITNWLVVAYDENADLAGYISGKDGTWTPDI------------------NEDSRTTVEMKLPFGTYHFYAFANLQSLEDGTSLYQKITEAHSLAELSEVKIL--DSGTSIDTRNEEKKGKFGGEEASRKRIPMSSYAQKHTVLPAPAENKFEIPLIRMIGK------EITNNLDKSITVNQ.......................................................................................... 244
52 -14.900SP17400A ZP_03460851.1 407644 Selected-2009-11-12  ali follow..  12  1MKKFMLFVVILTACVFASCSKDDDDNSGAASSLTMNGEAIKVKSIEGEY---------DPSTSFRAFTFWVNDASVINTGVYIQGTLSTKLENLSAGSDITSKLGLLMEYNSGDEYITDSDFRSGNLVVQNIDTSKKVLTLEFKNLKYTNNLKKEVILN--GTLTIPYKILE......................................................................................................................................................................................... 163
53 -14.900SP13271C ZP_03460516.1 407402 Purified-2012-10-22  ali follow..  1MKNIKLMALFAFLFCFSSCEDDEPVIPTLEVTPANLEKLAEWNGASLDEGTYCYVIFNRKEQTFEMYQKFDSMYARYITGSFSIENNPYLGYIISGVYDYGNGDWNNKYI-------------TDLLESGSMTWTSKDDESDVNKYIRCEK--------------VPEEIIA......................................................................................................................................................................................... 150
54 -14.900SP17387A ZP_03459300.1 407626 Selected-2009-11-12  ali follow..  1MKLNKFFMLGLAGLAFAACSNEDEVGNDLSQNSKTKIETGGYTTRASGNGAWTDGANNQSQITVNTVIVDTKTLENKSSDTFHGVSGTVTKIAAVANCQPTASGTWANVVAETFDVADYQTAENAPVYAEAVDITYKNTDTQDGYPMYEATLQLATKM---SRIELSGNLQCTNLAESAYKTLTLEYVGINGANTKFTLKGTGSEPHSVTSNLTGFPDLTPDTGTPTAFYDAAATPAPVLNDKNTPVALGTSYGYSVCGMPELLLRFNSEPVDDVKEGYIIYDPAYLKITGFKTADGNVVAMESGKIYQITDLEFTEEDITTLEKDKICITATVRVWD-----------IVAVEPSY 358
55 -14.900SP17374A ZP_03458861.1 407602 Selected-2009-11-12  ali follow..  3MKK-QFFYAAMALAVMSSCSKDNDPGIGNPEENNDKAVIALGLDVPTVTASTRGTGSVGDVAGDQNTWNSQK-MVDRNTGLEAEEGAENAKTKILDNGVLEFRAPKADAKDKGAIRIYKTYTEDSDNGVIQYKYYPTNGQYTFYGYHIDDAKNANPSITATEKKVTGVTIDGTQDLLAAKTIDMAENDATAADPESFYKDIATSLGSEWTELMKYQFGARTARKGIVPVLKFEHQLARLKFFVRAGSE............................................................................................................. 252
56 -14.900SP13795F YP_001299901.1 409856 Purified-2010-09-29  ali follow..  11  1MKLKSILYILMLLPFLWSCNNEDDVEEIFASGTWHVVDFYGKAN-KALDIIHGFNITFKADGTFTGSIQNGTIEGTWQADG--KDRTVNINFTKTPPSTSYNNEFIEALNNAIFYQGDSNVLLLAPEGKKTYIQFAHNKQD........................................................................................................................................................................................................................ 164
57 -14.800SP13271A ZP_02063427.1 408302 Purified-2011-12-09  ali follow..  3MKNIFKMMLLLTMALFMSCGDDDEVKLPDTKDVNYANIAGTWRLSEWNGEKIDGDTRYYYIKFDRKEKDGKRSYTIYTNLNSATSQQIPGSFTLNKEEDYGDVISGTYYYQLDTDDEWEYSYIVSGLTDISMVWTAKEDMGEIKVYTRCED--------------IPSDILT......................................................................................................................................................................................... 160
58 -14.800SP13290B ZP_02065139.1 408424 Purified-2014-03-12  ali follow..  7FKKLRFFFLTLASCFMVACNDDDDTTDLLDNRTSLVLTPSDYEIELKEDTPDEVALTLN---------TEADPIGSDYYISYLYK---------MDLENNSFGTNTMIREYIDDDFSKSYTHKELQSLLVSKWKQHPGDLVKLQARIIGSIEGPKFVKPEVSTVTI............................................................................................................................................................................................... 157
59 -14.700GS13347B YP_211607.1 385149 Crystal|NMR-2009-02-27  ali follow..  2MKVNSMLAVACTALVITSCSNEEIVPVSMSKKVSVVLNLPAMAHTRAIDNIANSKLYAKTAQDGGVVNTLTLQVSDFTGLDTGTGSKTVEISGAATYIEVEGNIDGSATKTDDVNSRQGGVTSDAVRVVGGAAIVTGGSTSTCSIEV---APEMARV........................................................................................................................................................................................................ 165
60 -14.700SP17945B ZP_02092178.1 411551 Selected-2009-11-12  ali follow..  11  7MKKLSLFLCLTCILTLAACGKKAAPITLPQADKITSIDITIEEN----------TVSHSDKTWMSEIIADISSSKPTKKESVQDVPQAESYIRIDFRHETGTITIFAYEDRGKY----------LEQPYQGIYKIERRLFERLK..................................................................................................................................................................................................................... 132
61 -14.700GS13874A YP_001299582.1 384493 Selected-2007-09-11  ali follow..  10  1MKTFRLIGMALLAIVFTSCSDDEEPSKNDDGVITNQKLL---IELRMTNEDGVSITEYSYGS--NGKLISATNTEQYDGSTHTSTYTVTWGANKIIESRNGEAITYTLENGLITHTSDSDGGDLDNTDFT-------YNANNQLVKLQYDEEDYLSYTWQGEKLT................................................................................................................................................................................................ 157
62 -14.700SP13661A YP_001304821.1 412395 Selected-2009-11-12  ali follow..  12  1MKLRNLLFGTMIACVFAACSNEDDPIPSVDPTPETTVVVKNLAKNTQTKAADDSVVLYNEDGTFLQV----SDITANKDEEQTNSNNEIQFKGLKAGASYRALAFANVPKEALTATANSFDLTSAYYVLTGA-ISPVFTLAEGENYYGYSNATGGNSIESGKPLGLIRNVARVE....................................................................................................................................................................................... 197
63 -14.600SP17275A ZP_02065814.1 408637 Selected-2009-11-12  ali follow..  10  1MKRLNILWIGLISVLMTACYDDYE-----KDYDKSSVYFASQKPLRTLIADTDMSIKVGVAIGGKREVHTDDWATFEIDPSLLDGTGLTLMPENYYQLANPNKMTISNPNLAIADVKVTFSDAFYNDNAA---------DKHYAIPFRLVDHNQDEISTDVNGNLKDYSIVVVKFVSQYH................................................................................................................................................................................. 167
64 -14.600SP13416B ZP_01961511.1 406934 Purified-2010-05-29  ali follow..  12  1MKKNLLYLWALIVALFTACSSDDDNDISGNNPPEEEAVVTAPDVVGTYWGNLDISMKPDNSDQETVIGNTISQVSDTEVKMELKEFELFLNGTIMKFGDIVIDKCTVKKETDASTFTGQQNLTTCATTVEGTV---ESGALTMNINVKVATLQQTVKVTYSGVKQVEES............................................................................................................................................................................................ 183
65 -14.600SP16619B ZP_02064828.1 408507 Selected-2009-11-12  ali follow..  11  1MKKNILYLLLGILALTSSCQDPEYVLPTADRQGITSLTALKEAVVYTIADASVDKYVIPSDNETSEYMKAMRQAKLAPNCTIEPVLSILDLTKTYTDAQGYKKQICITGERVKSTKCQLLSFSIPSEDITGII-----DEDHKTVSLILSSCLADYSLSAHATMS-KTEPLNFNSPVELTVIAHDGVTKQTYTIQKAVPD............................................................................................................................................................. 222
66 -14.600GS13938A YP_001302590.1 385154 Crystal|NMR-2009-01-30  ali follow..  1MKKY-LFLLLIGAASLTACGDDDDPVVPELNKLTKVSCYKDGASSPLFTAD----INYTSDGKISNINLGVDKLLSDGKFSVTGIHSGEVIEEYTLSGNVITSKKISQENPYASNEIYVSDEYSYRYSGSNWVLTSWNARWPKEFGTGYEERSYPEYEKENGNVV................................................................................................................................................................................................ 166
67 -14.500SP14084E ZP_03459711.1 407439 Purified-2010-09-29  ali follow..  10  1MKILDIMLLCVITMGMASCGDDIYYTTIQNSDEKLCGKN--VDESGEDGEAYTYLLKFGANNK--------------------------------------QEVTITYEAGGKVTVDREFSWRWLDESKEAIRLTFADNTAKIFENVWVREHYLSGKLNGEVMMLVDANY........................................................................................................................................................................................... 135
68 -14.500SP16730I ZP_03457419.1 407546 Selected-2009-11-12  ali follow..  10  1MKKSFLLLAGLILLAFTACQNDELVNGGSGNETAVSFSVQLPGANAPSTRAAGDIMEYLGDKLYGERQVVPVAGNKTATFNVRQTYDFVFWADVSGEGGIKTDRHYQTTN-GLQNISLLGNYAGNDDSRDAFTGVLLSKLVTGAFNEAVE------LTRPFGQLNIKTDLGSIPTDRTALIPATASLAFKGVYKGFNAHTGAVTGDLAALSYNENAAVVDG........................................................................................................................................ 227
69 -14.500SP16785A ZP_01961334.1 407098 Purified-2010-09-20  ali follow..  14  11MKKVTLLIGGIALLSMAACSDDDGRTPSPAVDP------------------NCIGASFVGDNIGYEELEDTDPKELTLTISRDKTEAAATVAIEVQANTENIFNIPQSVSFAAGQATADLVITQLKEEYSFQISLEAAAVNPYK..................................................................................................................................................................................................................... 144
70 -14.500SP16602B ZP_02066471.1 408441 Purified-2010-09-20  ali follow..  12MKQFIYILLLTVTGIFAGCTDIDKENPYDNQLHSLQVTAVYPDGYTDHLREG--TVKIEDVDRGNSYKAKTDKNGVAQFSLTKGIYRVQVSDKGGKDIFNGLADNVKLTSGDISLNLPLIHSKAGTIIIKEIYCGGCTKLPLEGNYQ---SDKYIILHNNDSEVQYLDSLC.......................................................................................................................................................................................... 178
71 -14.500SP17037A ZP_02072335.1 409550 Purified-2012-08-30  ali follow..  14  1MKYINILSLFVIALIATSCDPDAESYTGELEDGNQGICFVGNYTQTVEVEPGITSFDLTSLTDAAGTVDVTVINNEENIFVCPSTVSFAA--EKTAKLTVETPSAAEGITYNLQLALSGNDVSNYSSGYHEISVNFAILKWESIGTGYYLDGTVANFFGVDPAVEITSTRFRFDS...................................................................................................................................................................................... 189
72 -14.500SP16602A NP_812543.1 409029 Selected-2009-11-12  ali follow..  10  1MKQSIYIILLFVTSLLGGCTDLDKGNPYEDQLHTLQVTAVYPDDYAEYLREG--TVQIEDIARGNSYKTVTDQNGTAQFALTNGIYRIQISDKADQHIFNGLADKVKLVNGDITLNVPLTHSKAGAIIIKEIYCGGCTKLPQEGTYQ---ADKYIILHNNDSQTQYLDHLC.......................................................................................................................................................................................... 168
73 -14.400SP17408A NP_811230.1 408732 Selected-2009-11-12  ali follow..  11  5MKK-NLLFAAMAVTALASCSNDDVVDVNNGGRASLDRAVTRTNVTSLQNLAAFNVTAIGDGKNYFTDLGVSSADNGVNWTT--YELAFFAYFSPAQAVADQKDLVISYNTGTKAVNEGPGVAMNFKHALSQIEVKAKCSNDKIK--IEIMGVKLVNAAA-KAEFAFPET............................................................................................................................................................................................ 199
74 -14.400SP16944A ZP_02037067.1 407258 Purified-2014-03-04  ali follow..  13  1MKRF-FSLILLPILLLAGCSAQPESQLTAQERTELYRSAIQSARDQDANDAFPIVTSAEDDTA--SFLLELMGLSAEDMSAFAISASAMNVKAAVYPAEGKDEAVKEALRGFVDRQ--KQNFEQYLADQYDIA-------------------NNARLETLEDGTIL............................................................................................................................................................................................... 146
75 -14.400SP19421A YP_096679.1 412246 Purified-2012-03-07  ali follow..  1MNNNKIVIMFIFSALLAGCAGTMKFKKPPINNPSDDATIKLAEAAVSVSDS-QARASVDWSGPIEELTARIAKAALGKSPSVPVLISISTKDESLAEILRDIDYQAGKKASIHVYPNSQVVELRYAKIYS................................................................................................................................................................................................................................... 163

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.