current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: TM0681 TM0681 282551 Purified-2001-10-17, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MPRKTTSLCRRILLENYTTRGEKMITNLSDRVFVIGTGTSANSVLVCGKKFCVLFDSTLFPEKARKIKEFAAEILGKEIAVVFNTHYHPDHTFGNEVFDRIISHSLTRKSLEEMDEEYIRKIGVEVSLKFPDETFSERENYRFGDIVVEAVHLGGHTPDSSIFVLKNEKIVICGDLLTTGIHAEIVTDSDLFGWIEALSEIEKIRADYFVPGHGKVGTIEDVRNMKDYISKVLRFREGSVKHSELLEDPNFINREHPELLTWGLENIIRLast
1 -97.900TM0681 TM0681 282551 Purified-2001-10-17  ali  100  1MPRKTTSLCRRILLENYTTRGEKMITNLSDRVFVIGTGTSANSVLVCGKKFCVLFDSTLFPEKARKIKEFAAEILGKEIAVVFNTHYHPDHTFGNEVFDRIISHSLTRKSLEEMDEEYIRKIGVEVSLKFPDETFSERENYRFGDIVVEAVHLGGHTPDSSIFVLKNEKIVICGDLLTTGIHAEIVTDSDLFGWIEALSEIEKIRADYFVPGHGKVGTIEDVRNMKDYISKVLRFREGSVKHSELLEDPNFINREHPELLTWGLENIIR 269
2 -74.500FL10934A YP_165938.1 375728 Purified-2007-06-12  ali follow..  18  1.......MAKAFASQGDMSEKKISFTEVGEGLYAFTAEGDPNSGVIIGDDSVMVVEAQATPRLAQKVIDCIREVTDKPISHVVLTHYHAVRVLGASAFGQVIMSDTARSMVVERGQEDWDSEESIPGLTWPTTTFSDSMTVYLGKRRVDIMHLGAHTAGDAVIHVPDQNVMFTGDIVEYHSACYC-GDGHFNDWGNTLDNIAWFDVDAIAPGRGDALVNAAIENTRDFVQSTYRPAARVAARGGSLKEAWDAVRAEEHCLPFNVARAYD 291
3 -47.500TM1295 TM1295 283159 Purified-2004-11-17  ali follow..  19  1.................MRKDEYRATLLEPNVWHIADYRGDSMYLVVGEEKALLVDTGMG---EGDLKGFVRSITEKPVE-VVLTHAHWDHIMQANQFEKVYLNHRDFQIIELFKINVNYE---------NFLNVKEGDRFDLGGRTLEVIEVPGHTPGSIVLLDRENRLLFSGDSVGAGHTMHLPGCLPLREYLKSLKKLKETSFEKIYHGHLTGTQLKPFG--PDYLDDLIKAVEGVIDGSLR........................ 215
4 -40.900TM0607 TM0607 282480 Purified-2001-02-22  ali follow..  20  8........................................VNIGVVYTENAAVLVDSGLDESVPRKISRLL----QKPPLYLINTHSHADHCGGNAFLKKVFAPKMEKEIIENTVFEPFYLYGAYMAEPSAVDEVIEEGTITIESVDLEIVPLSGHSTNQIGVAVD--GVLFCADAVFSEETLRIFVIYNVEKFLETLDFLEKTSYSYYVPSHGEVTRGELVEKNRKAVENIINAVLEITVNPLSTDELMKQ................. 233
5 -32.400MM3808A 13278494 354611 Purified-2003-08-14  ali follow..  16  1.......MAAALQRIEQLSSRVVRVLGCNPGPMTLQG---TNTYLVGTGSRRILIDTGSVPEYISCLKQALVE-FDTAIQEILVTHWHSDHSGGIVDICKNINNDTTYCIKKLRRNPQREEIIGNGEQ--QFIYIENGDVVKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTIF---EDLYDYMNSLNNLLKIKANIIYPGHGPVIHLEYISHRNNREEQIISLFRDNFEKSFTVTELRTM................. 244
6 -31.900MA3808A NP_057111.1 399812 Purified-2009-03-14  ali follow..  17  1.......MAAVLQRVERLSNRVVRVLGCNPGPMTLQG---TNTYLVGTGPRRILIDTGAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQ--QYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF---EDLYDYMNSLKELLKIKADIIYPGHGPV--------IHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYK 247
7 -31.100TM0894 TM0894 282763 PDB-2005-05-26  ali follow..  18  1......................MELKILVTGGNVFVPGRLSTVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFENYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK--VKVFHTPWHAREHLSFLLDTENVLITGDITNRLSYYDIIKGYGSVQVKNFLDRVGRID--LLVFPHDAP..................................................... 202
8 -30.900C.KS20803A NP_372069.1 423895 Purified-2012-05-01  ali follow..  17  13........................................TNTYFIENDKAVILIDPSGE---SEKIIKKLNQI-NKPLKAILLTHAHFDHIGAVDDIVDVYMHEAEFDFLKDNGADKFKQYGLPIITSKVTPEKLNEGSTEIEGFKFNVLHTPGHSPGSLTYVFDE--FAVVGDTLFNNGIGRTLYKGDYETLVDSIDKIFELEGDLLFPGHGPYTTVDD-EQLNPFLH....................................... 206
9 -29.600FJ9329A YP_323572.1 370290 PDB-2007-03-23  ali follow..  12  5...........................HRPDLYSWSTNIDFNGFAWIRPEGNILIDP---VALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQTYTKI-----------AGPVAEKENFPIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-TTLITGDLVRAYRAGGLEI-MNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATL..................................... 199
10 -28.100MA16092B NP_808546.1 400112 Cloned-2009-03-24  ali follow..  16  1MNGPVRTEPLHGEIPLLATSGSYSVVVLLRGYAEPQGAGDAKTALEEAVRGPILVDTGGPWA-RGALLEALATVAPEDVTLVVGTHGHSDHIGNLGLFPE--AALLVSHDFCLPEGLYLPH----------GLCETQPLILGSG---LQVWATPGHGGQRDVSVVVEGTVVVAGDVFERLGDEDSWQSEDPVAQQRSRERILSV-ADVVVPGHGAP..................................................... 238
11 -27.800TM0013 TM0013 281894 Purified-2001-08-24  ali follow..  14  17...........................FLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKI---ISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAH-HSTGNFVLYDPVAKILFSGDIGVFEKGKRYRYVDDFERHLPLVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGV................................. 244
12 -27.600FN0013A AFE_0842 378921 Purified-2007-09-27  ali follow..  16  1...........................MSQLLYDNGTGIQANQFLIVNNGEGMLLDPGGNLTYKNLLAEMASYFLPAHLDYVFASHEDPDIVASANGWAKILIANEWTRFLPHFCSKGMTAGR---------GIPAQGMRVNLAGQELFVVPAH-HSVGNFQVYDPVSKILFSGDLMDGFHRRYMGGQKVCRLW---TNMARGMDIEWIVPQHGASKGRETVLAFLDWFEGL..................................... 243
13 -27.000MA16092A NP_981942.1 400061 Selected-2008-12-22  ali follow..  16  68........................................AEAALEEAARGHILVDTGGPWA-REALLGALAGVAPGDVTLVVGTNGHSDHIGNLGLFAALLVSHDFCLPGGRYLPH--------------GLGEGQPLRLGPG---LEVWATPGHGGQRDVSVVVAGTTVVAGDVFERDGDEDSWQSEDPAAQERSRKRVLVV-ADVVVPGHGPP..................................................... 233
14 -24.300MA16095A NP_996995.1 400077 Purified-2009-03-13  ali follow..  18  12.........................................NYMYLVIEELAVAVD----VAVPKRLLEIVGR-EGVSLTAVLTTHHHWDHARGNPELARLRPG--------------LAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLPDPPALFSGDALSVAGCGSCL-EGSAQQMYQSLAELGTLPPETKV-GHSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRG........................ 208
15 -23.200MA16095B NP_081173.1 400254 Purified-2009-05-08  ali follow..  18  12.........................................NYMYLIIEEHAVAID----VAVAERLLEIAGR-EGVSLTMVLSTHHHWDHTRGNAELAHILPGLAV--------------LGADERICALTRRLEHGEGLQFGAIHVRCLLTPGHTSGHMSYFLPDSPALFSGDALSVAGCGWHLEDTAQQMYQSLAKTLGTLPPETKV-GHSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIP........................ 209
16 -18.400TM0755 TM0755 282625 PDB-2004-09-21  ali follow..  20  26..........................RYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATVEIIASNFGKRLLEGFYGI---------------TVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNESVVLEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKK............................... 253
17 -18.100XB5432A 10175883 358570 Crystal|NMR-2005-05-26  ali follow..  17  8.....................KMTITWLRGGVTHMDGGAMTDPFLIQLDGQNILVESGIGNGRFTDLEDDLQSLTVADIDAVLMTHLHFDHASGLAKQAVIYASAREWAEMREPNIRSRNTYWEQRPVEQQVVTFEKEQEIIPG---IRMIHTGGHSDGHSIIVIEHETFIHLADIMPTHAHQVLAYDDYPMDSIFAKQKWQAFASEWYLFYHDYKYRAIKWNDEGEIVA....................................... 274
18 -16.100GD14186A YP_001299287.1 388212 Crystal|NMR-2008-04-09  ali follow..  17  18..........................ALFENLWPLPYGVSYNSYLID-DEMVALVDTVDVCYFEVYLKKIRSIIGDKPINYLIINHMEPDHSGSISLIIVIVGNKKTFEMIEGY------------GVGGERYVVGEGDFLALGHHRLRFSLIP-HWPETMVTFDETEGILFSGDAVVDTNINTDIYWNEMVRYYKALQKLQNLKITTVCSTHGPVWTEEIPRVVRIYDRLSRYEAEEGV............................. 248
19 -15.200GS0207A YP_001302908.1 384386 PDB-2009-11-06  ali follow..  11  3LKSCMLMCSLFMASLASASNFASDSFKTKSGKELTITFIKHGSLMLTYDNHSIQVDPVSEYADYTTF---------PKADIILITHEHGDHL-----------DPKAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISYMKIEAVPAPRHRDNGYILTFDGLRVYIAGDTEDIPEMKDLVNQPYTMTVSQAAKAARMFSPKILYPYHYGDTKIGELKDALK.......................................... 229
20 -13.300SP13918A ZP_03458960.1 407444 Purified-2010-09-29  ali follow..  10  102......SILYFYRTAFERVLDGVKSSTVENGTAQI----LYNMGYIITPSGCFGIDI----------SHRWAEEFAPYLDFLCVTHKHSDHY-----------SNNLIQAMYDLDKPVLSNYLQPVASYP--FYSKKSEEYTIGNFKIRTCI-TNHNEADCGDDAGGLTLIHTGDSNFKNVLIPRYAPNALTENDIIGTGTGQVTPDYVLLSHVLELSHADEEDSRWTVQSAWERASK............................... 336
21 -12.900PU1679C NP_247422.1 381581 Purified-2007-10-25  ali follow..  12  21..........................................SALIEINNKRILFDAGQNSITLRENLRLFNEKEG--FDYIVLSHGHYDHCDGLKYVGKVIAHKDAFLDKYAGNRYIGIDEEIKEYLLKKADLEIIEEPYKIDKDIIVSGYVPREYEYEMEEFQCIKDGKRVKDEVNDDMF-ILITGCSHSGIINVVEYGKKLEIKGVLGGHLVGVSDNYLNRIVDYFKSQDFWIMPMHCTGFKALTKLS.................. 240
22 -12.500TM1162 TM1162 283028 Crystal|NMR-2002-09-14  ali follow..  17  7........................................GHAVVLIEGKKNIIID----PFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKVISNYEICHYLGKKG------------VKTHAMHIGGSYLFDFGRVKMPAVHGSGILDGDSMIYIEGKKIYHAGDTGLTREMELLIGGNFVMDVEDAVRAAVMIKPKKVVPMH........................................................ 190
23 -12.500GS13918A NP_809107.1 384839 Selected-2007-09-11  ali follow..  13  134........................................YNMGYIVTPSGCFAID----------ISHRWAKELAPYIDFLCVTHKHSDHY-----------NTDLIQAMFDLDKPVLSNYLKDTTYP---YTAKGDKDYEIGKFKIRTCITDHNNSGDCGDDTGNFVFMHVGDSNFKNVLIPRYAPNALTENNILGTGAGQVQPDYVLLSH........................................................ 304
24 -12.100GS13936A YP_001303382.1 384870 Purified-2008-06-17  ali follow..  13  15SAACLMDFREALAWGAKDAEVGKAWKGWKKGIHLIYTGVSESMFLIFPDGTTMLLDCGPDRHAGEWISRYVRRPQKDYVDYMMLTHYHSDHGGNNKFFSQAAEYLTFGKAFDEHMKDFYDYMLAHKKMEIEKFCLGETNQIAMKKDSVRNICANGRNGMSLGMIFTDFKFYTAGDFWELPNGKRFEIEDAIADVVEPVSVAK-------INHHGHKSMTDKLVAALRPRVVVNNVWDQLHTLPSVMERFYNRN................ 355
25 -11.200PU1679B YP_753611.1 381520 Purified-2007-11-06  ali follow..  11  2.....................NAVISILVENT-TPSPSLIGEYGFVEVDERKILFDTGSSDALFKNAENL--GVKLEEVEALVISHGHFDHTSAVIPFKKLYLHPGIPEDLVKNGAEIIFIDSATHHGLLEDRLLDDMALLVDHPEGLIIISGCAHS--GMINTIEYIREKTGRSKILAFIGGTHLITASEDRLAQTIAVLKMMDIEKIAVGH........................................................ 247
26 -10.900MA2439A NP_057291.1 399960 Purified-2009-03-27  ali follow..  15  9............................SDQLLIRPLGAGQEVGILEFKGRKIMLDCGIHPGEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETINFHEVKEVAGIKFWCYHA-GHVLGAAMIEIAGVKLLYTGDLIIESTYGTHIHEKREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQN...................................... 259
27 -10.900TM0207 TM0207 282087 PDB-2004-03-11  ali follow..  14  9.........................................ACFALEMEGKTIVTDPFDESV----------PIPNVTADVVTESHQHFDHNAHHLVKGN-------FRVIDRPGAYTVN----GVKIKGVETFHDPSHGRERGKNIVFVFEGEGHL-GDLGHVLTPAQVEEIGDVLLVPVGGTYTIGPK-----EAKEVADLLNAKVIIPMHYKTKYLKNLLPVDDFLKLFDSYERVGNI............................ 190
28 -10.700TT10477A YP_012016.1 404703 Selected-2009-08-14  ali follow..  13  151...............................................GTKHKYLLDTGWSYDWMEKSFKREGMLQAREIEALFISHEHWDHFWGLPVTIPLYVHDGFYKEGLQYIKDSGYKGTPVIQKEPMRQIIETSLAFNVKDKGLVLISGCCHQGILQMADFAYTDLKYDNDRFYGGGLHISPFEDWDPKYDDLVISLAKWNFERIGCNH........................................................ 345
29 -10.200TM0663 TM0663 282535 Purified-2004-02-02  ali follow..  14  4..........................EIFDGHRNIGG---NKIRVVDSENDGFLLDFGLNPRTGKILHDLLKFEDPVNHAFLFLSHAHADHTGMVGLIDELLMTGETFAVMRASVYTSNSNVLTQLGGKKRRKVNDKDLENSLWKNELFVEPVY-HSVIGAAARVDDLWLAYTGDFRTGPETA-----EEERYWLDTFENLKDKRPLVLIEGTRVTREENIENTEKDVFENAMRVFRGT.............................. 301

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.