current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: TM0649 TM0649 282521 Purified-2003-11-26, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MKREQILSLIAEIDDLLNALNMVVKEIEEKKREFSDKEPDQFILRALGSLLHDFYTIIEDIFELISSEMNGVRLDSFDWHKRLLNKMTLEIPGLRPAVISKRLKEMLDEYLRFRHVFRNVYGYLLQWERMKPLLEKAGAVYERFEEEIERFKDFLRELAEKMLast
1 -62.500TM0649 TM0649 282521 Purified-2003-11-26  ali  100  1MKREQILSLIAEIDDLLNALNMVVKEIEEKKREFSDKEPDQFILRALGSLLHDFYTIIEDIFELISSEMNGVRLDSFDWHKRLLNKMTLEIPGLRPAVISKRLKEMLDEYLRFRHVFRNVYGYLLQWERMKPLLEKAGAVYERFEEEIERFKDFLRELAEKM 162
2 -11.200GD14171A YP_001302963.1 388142 Selected-2007-09-21  ali follow..  14  3.DTELALDTLSQIKDTLSMIMARTSHIHKV-DDFYMNESGMILLDSVCMKLVAVGEAIKNLDKITNKELLLKYPAVN------------------------------KDIKGMRDIIVHHY-FDIDASVILYSLQK---EVPDLYSTICVMLRDLSR..... 124
3 -10.900GD14188A YP_001301158.1 388229 Selected-2007-09-21  ali follow..  13  11.GRLTICDRLTQIKESIYYIQQWSKEINCA-DDFLASMDKVMVFNACVMRL------------------------------QVIGEQVGKLLFLQPSPLSEYKEIPWLAIYDMRNLISHEY-SNVDEQIV----------FTTIKNDLIELDKVITVLLNKY 129
4 -9.590RH20290A YP_574950.1 415944 Selected-2009-12-04  ali follow..  10  121LRNMLYVQTVTAVEAYLSSA--FIHAVLNSEELIQRLVESDPELAKQKFSLKEIFTQWEGLRITVGKYLKALIFHDLRKIKPMFKDVLG---------IEFPDIPWLFQAVLIRHDCVHRNGLDKDGNRREITKTQIMDLARSSADFVSQIDQELRCLVYG. 270
5 -9.380FM11535A BFUN_06OCT04_CONTIG482_REVISED_GENE8727 377816 Crystal|NMR-2007-07-26  ali follow..  121...........................AEVFDEFLGQAEHLLEAGYFQPAAVLAGSVLEDGLRKLCIANDITLPDKAK--DWMNSELAKK------GKYSKLMQKRITTIADLRNSAAHGKWDEFEKADVESMLRDVRDFMTKHYD................ 232
6 -8.980TM1000 TM1000 282869 Selected-2001-10-12  ali follow..  14  1............MNEKEKIIEYWRRRARECLDDAKLLLKNERLHSAVNRIYYALFYQVSALLLAKGL--------SFSKHSGVLAAFNREF--VKTGKVNKELGKFYNRMFEHRKTGDYGELVEFEEENVKDWIRKA----EGFLDAIEKLIEDLKR..... 131
7 -8.160SP17489A NP_390493.1 406724 Purified-2010-01-14  ali follow..  114..................................................MIRLYGAVKNLYEKVSEKDDAADKSQGIGMLYMVDYLKRH------KILNDSFAESLLDIMNIVHDLEKSHISQ-------------SYIMNKFFWNVDKSVKRLMEITSNY 206
8 -8.140SC.B21060A YP_010743.1 428437 Selected-2013-01-04  ali follow..  10  1MAELQLQSTPATLGFNFTELMEWATGITADYEGLVVTEDMVPGIKSEMAGLNKMKAQLDSARKQAVRQVSEPIRQFEARIKEVCAVFDAAYAALATQV-ERQREEKRREVLFLIADTVDEHGVPGLEVAVQDSWLNKSKPLKAIKAEVESIILRHLQEERER 165
9 -7.280CL6083A 1591138 359363 Diffraction|HSQC-2007-10-17  ali follow..  15  8.................................................YLNHILESIELIEEYTKDKTEDDFFTSKFLQDAVIEIIGEAIKNLPMEFREKYNHIPWKEFAEMRDILIRKY-FGVDLGLTWEVVKK---DIPKLKEEILKIMEELDKNKNN. 118
10 -6.980TT6894A NP_241844.1 404909 Selected-2009-08-14  ali follow..  4LDVNQHLSELDEHIKVLKSYGDVFEEVEARITRVINMDGAFKGAQGVINNHAHVQLPTIRSIRAFLISYAETLEKMKANITEY----PASNGSVSEDFWKNQLPKGYDRYEEKLEEREATINQATA--EVSHILHLGKLQTGDVYNSIDSARKHADTVLEGL 162

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.