current user: public




368040
Query: PE00025C YP_807469.1 368040 PDB-2006-09-01, from JCSG0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQRLast
1 -63.8002i8d_A mol:protein length:123 Uncharacterized conserved protein of COG5646  ali model follow..  100  2MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR 123
2 -60.6002oc6_A mol:protein length:124 YdhG protein  ali model follow..  45  2MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK 124
3 -53.3002kl4_A mol:protein length:118 BH2032 protein  ali model follow..  37  4MEVFAEYLKGIDHPDHRDRTEEILSWVAATFPNLEPQMKWNTPMFSNQGTFIIGFSTSKHHLSVSPEEIGISQFADAIAQAGYSTKGLFRIPWNDPVHYELLKQMIEFNIQDKE........ 118
4 -8.2802fki_A mol:protein length:126 Protein yjbR  ali model follow..  4....................SELLQYCMA-KPGAEQSVHNDWKAIKVEDVLFAMVKEVENRPAVSLLAELLRQQHSDVRPSRHLNKA-STVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKR 112
5 -7.3802a1v_A mol:protein length:144 conserved hypothetical protein  ali model follow..  1..........MSLQTPMQTVDDLRSVCDE-LPHSLETFPFDDETYLSKSRMYALTDITQDPLRLSLKVDPERGEELRQAHPQLNKKHWVTVTLDGTVPAELLGELLRGSLVTKKGFTKAERK 126
6 -6.6702od0_A mol:protein length:105 Hypothetical protein VP1028  ali model follow..  3................KPILKDSMKLF-EALGTIKSRSMFGGFGLFADETMFALVVNNQLHIRADQQTSSDFETQGLK-RGFPVVTKYYAISSELWESSDRLIEVAKKSLENAK........ 104
7 -6.0703md2_A mol:protein length:157 matrix protein 1  ali model follow..  13  3LTEVETYVLSISGPLKAEIAQRLESVFAGKNTDLEALMEWTRPILSPLTKGILGFVQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGALASCM............ 127
8 -6.0003d1t_A mol:protein length:257 UPF0343 protein NGO0387  ali model follow..  12  60MSRFVALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYMKVMIPVTSLCPCSKEISQYGAHNQRSVSLTSDAEVGIEEVIDYVETQAS........... 189
9 -5.9803f6o_A mol:protein length:118 Probable transcriptional regulator, ArsR fami  ali model follow..  10  6.EQLNGIFQALADPTRRAVLGRLSR--PATVSELAKPFDMALPSF-------------MKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTQQELWESRTDRLEQFVTEHTVTAHAKATP... 117
10 -5.8601ea3_A mol:protein length:164 MATRIX PROTEIN M1  ali model follow..  13  4LTEVETYVLSISGPLKAEIAQRLEDVFAGKNTDLEVLMEWTRPILSPLTKGILGFVQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCM............ 128

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.