current user: public




Query: PE00025C YP_807469.1 368040 PDB-2006-09-01, from JCSG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQRLast
1 -78.7002i8d_A mol:protein length:123 Uncharacterized conserved protein of COG5646  ali model follow..  100  2MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR 123
2 -75.5002oc6_A mol:protein length:124 YdhG protein  ali model follow..  45  2MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK 124
3 -68.8002kl4_A mol:protein length:118 BH2032 protein  ali model follow..  35  4MEVFAEYLKGIDHPDHRDRTEEILSWVAATFPNLEPQMKWNTPMFSNQGTFIIGFSTSKHHLSVSPEEIGISQFADAIQAGYSATKGLFRIPWNDPVHYELLKQMIEFNIQDKE........ 118
4 -7.5902fio_A mol:protein length:123 Late genes activator  ali model follow..  11  1...............................PKTQRGIYHNLEYVASNTDVTFFFSSELY----------LNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRG....... 77
5 -6.1603oa7_A mol:protein length:206 Head morphogenesis protein, Chaotic nuclear m  ali model follow..  11  101.....EQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNF-AQRLHRQVYSQEMNLKKFTDQAYYDFMSTRRMIDHHLERCLDDHILEKMVK............... 206
6 -5.8004n57_A mol:protein length:321 APH(2``)-Id  ali model follow..  10  1MGSSSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTIN-GNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLP--------LPIP.............................. 90
7 -5.7702f77_X mol:protein length:100 Core protein p10  ali model follow..  12VEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM................................. 100
8 -5.7504hmy_S mol:protein length:154 AP-1 complex subunit sigma-3  ali model follow..  16...LQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVK. 133
9 -5.4903fse_A mol:protein length:365 two-domain protein containing DJ-1/ThiJ/PfpI-  ali model follow..  226LEALEKYTEKESDVEAKALFQEMITNKQRHIEYLETYLTRLGEKPSLSANIANQYAKVKTALTGSDDIYQIRSALGDI-QTGIGDIGNLCAMYTDPIATAIFKEIYKDLVKYEQRLVSLYRT 346
10 -5.4601w63_Q mol:protein length:158 ADAPTER-RELATED PROTEIN COMPLEX 1 SIGMA 1A SU  ali model follow..  16...LQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLK. 133

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.