current user: public




281895
Query: TM0014 TM0014 281895 Purified-2001-01-30, from JCSG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKILast
1 -41.300[NT] COG0840 Methyl-accepting chemotaxis protein  ali follow..  22  385.SINYSIDQLRELVETINQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVQVSANASESSAVAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAVISMEQ-ARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTMNVIQEITSQTSAGTTATARSIGNLAKMASEMRNSV. 670
2 -21.600[NT] COG3143 Chemotaxis protein  ali follow..  32LRELGLDQAIAEAAEAIPDARDRLDYVVQMTAQAAERALNSVEASQPHQDAMEKEAKALTQRWDEWFDN-PIELSDARELVTDTRQFLRDVPGHTSFTNAQLLDIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQSARPKRENESLLNGPQVDTSKAGVVASQDQVDDLLDSL................................................................................................ 212
3 -14.600[S] COG1511 Predicted membrane protein  ali follow..  10  238.SLDSSLGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQEGSEKAAKAEKIINALDLTKLETANNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVINSSDFLTAEQKSQLINSVEKKLPQVDAPDFDQILSQLPTADQLPDIATIKSSLEDVKAQVAQVKAMPEATSKLYNGAKTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFAKAKAGSEQLVTGSSQVSGGLFKLLDGSKQVQS... 512
4 -12.100[S] COG5412 Phage-related protein  ali follow..  10  1MADYTLTAKLTADPSGFRAGFQKAQESLANLQSRVNQTGKRVQSIGKSISDLGSKLTRNITVPAVGA-DRLVGIDSARAKLKGLGHDAEAIDSIMDSALASVKGTAFGLDEAATTAANAKELTRYLSLTADTAAIAGTSLGEIGAILNKVTTSGRAYNSELQMLSDRGLPVYQWLAEEANTTADAIFDMASKEESFSAAIANIGADIARIGANFLDAGGKAGGFFSTVKPLLTEFRGFLAQVEEAADWGVAFGQAFNNVIDRVRELKSWFDGLSP... 320
5 -11.900[YU] KOG4460 Nuclear pore complex, Nup88/rNup84 component  ali follow..  11  493.PLLSTVHPASPPLLCTREDVEVAESSLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEECLQLLSRATQVFRE--QYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAER-----LADKYEEAK------------EKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQ---QKMEKVLSLPKPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVN....... 740
6 -11.700[S] COG5280 Phage-related minor tail protein  ali follow..  10  1.....MAKKISGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKLSKQVELTTKKLDGLKGAQADVDRQFKSGDIGEEQYRAFQREVVATEGRLDHYKQSLKDVESSSGEAGNATK--DVGEAVKGGVLMEAADHLSVVGDKLKEFSGSAQEAFSDVDEGMDKITTTTGKASDEFKTQFDNIEDVGSALGTLSAQFDMSGDTLEKNSKLALQYANINDDVKTSIESAKSAIEAYGLSNKDFSTVLDSVTATSQR...... 292
7 -11.700[S] KOG2216 Conserved coiled/coiled coil protein  ali follow..  5.EIEEGMVTADEFPTPEVTTIETIQPPREPGKSPLELLRESKTSVEEIVAKMLSMKKQGNHEIRELLTQMFLNFVNLRQANRAILTEEDKVKAETERAKAPVDFTTLQLHNLMYEKSHYVKAIKACRDFKSKYPDIDLVPEQDFFR------------HAPEAIKDQSLSSDSSHVLMPKRLNFELHQR----KELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHLGIQHTKKLKQHNLAELLPPPLYVLYSQLLAQKE... 264
8 -11.300[S] COG5281 Phage-related minor tail protein  ali follow..  10  1....................MATLRELIIKISANSQSFQSEIQRASRMGSEYYRTLQNGGRQAAAAARDQRRALAELNSQLTEIRGSAVGATGHLISLADEWSSVNARLKQASQSSDEFSSSQKVLMDISQRTG--AFSDNAALARSAASMREYGYSADDVLKVTEAISTGTAEAGSVITQFSQALAQGVLRGEEFNSVNESGDRIVRALAAGMGVARKDLKAMADDPETVSDGITKVENAFMAWVGGANEASGVTKTLSGVLNGVAGQIDNVATAV. 299
9 -11.000[R] KOG2220 Predicted signal transduction protein  ali follow..  427VRQKGGIENVQTMLKDLPELLNRNREILDETERLLDEERDSDNQLRAQFKDRRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKLMDDVE------TIKAERE---------IESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQN... 689
10 -11.000[S] KOG4360 Uncharacterized coiled coil protein  ali follow..  12  112....................IDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALR-------SKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPTAH... 359
11 -10.800[Z] KOG0980 Actin-binding protein SLA2/Huntingtin-interacting protein Hip1  ali follow..  12  679.................DVVGNELEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIREVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVHLIVAAQEIAASTA-------LFVSSRVK--ADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAESQVKMLELEQSLNQERAKLAALRKQHYHMAQLVANKS......................... 921
12 -10.700[U] KOG0993 Rab5 GTPase effector Rabaptin-5  ali follow..  10  556.QVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQALPDTTEALRELVLKYRE---KAEILFLKEQIQAEQC----------KENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQ... 837
13 -10.500[DZ] KOG4302 Microtubule-associated protein essential for anaphase spindle elongation  ali follow..  11  11..FFRTNTTCNNLLRELQKIWVEIGETETEKDRMLMELERECLQIQRKVDEAANSKAKLHQSVASIEAEVASLMAALGVLNINSPIKLDKGSKSLKEKLAAVTPLVEELRQKEERMKQFSDIKAQIEKISGEISGYS-EQDLTLRNLNEYQTHLRTLQKEKSDRLNKVLGYVNEVHALCGVLGVDFSQTVSTLEGLEHMIQKLKTERKSRFQKLKDVVASLFELWNLMDTPQEDRTKFGKVTYVVRSSEANITEPGILSTETIEQVSTEVDSLSKL.. 319
14 -10.500[D] COG5185 Protein involved in chromosome segregation, interacts with SMC proteins  ali follow..  255.PEKELKATFNQQNQDLYNQTEALKSTNEELINQIKSAEELDSAIQVLEERYRTMQRDE-VKFQSAMSGMKSKMESRTNLMKQLQVNIEEKESQLQLLKEKRDSLKYQVENQDISISEFEKMVSEREQLDRNLNMIGSKISELRKEVFDTDLLIQASIDSLEKKVQKFNSLAYRIGIVPIAAIRSANNDFELEINPEGPNYINLDLKNKVRPFINEVR---RSITLEFHEEQNKSLKLQEHVDTVNDLIAELQDELRGIESRLTSVLSECNMLRE... 524
15 -10.500[D] KOG4438 Centromere-associated protein NUF2  ali follow..  191..QQSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLLVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALEKYHD--GIEKAAEDSYAKIDEKTAELKRKMFKMS.... 463
16 -10.100[R] COG3941 Mu-like prophage protein  ali follow..  5LRASLIVDLLGNISAKSRQWSQELGAFSRSGQAGLGGLGNAARRAGQETDVLGSRMQRTLAGVRGSIRHVTSDFDRLQGSITGTIGRISNLYGML-RPAAEMETYMIRLNSLYKDRAKTDDVRRWAIQNAKETTW-VMQEYTSSLGFGMSDREARNFVTMLQDQGAVGGWSLSDAQGASLQLKQMYARGSIQAADANILATYGINAYRVLADRLGVDQKVVRKLGEKGLLGPDSIRLLFQTLAE--QARGAQKDAMNSWSGLTAMMGDVWDQF..... 292
17 -10.000[R] KOG1899 LAR transmembrane tyrosine phosphatase-interacting protein liprin  ali follow..  10  92.SLSQVNHHSAASNETYQERLARLEGDKESLILQVSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELTSLETQKLDLMTEVSELKLKLVGMEKEQREQEEKQRKAEELLQELRHLKIKVEELENERN--QYEWKLKATK------------AEVAQLQEQVALKDAEIERLHSQLSRTAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRIEELTGLLNQYRKVKEIVMVTQGPSERTLSINEEEPEGGFSKWNATNKDPEEL..... 352
18 -10.000[R] KOG0804 Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein)  ali follow..  387.NASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVENLEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWK-------------------------------GQVEKLIESQKTARTEYEKKIEDLQSQVNDLLMHFET-QNKLKEQLDAGKITQEEITESQVELDSSSSSSRKLNRKKKK......................................... 590
19 -9.860[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  14.....LGGIIAALGDHLGSKVGKARLRLFKLRPRQTAVLLTVITGTLISASTLGILFTFSKSLREGVFQLDDILAQLRVAKTELEQASQAKEEIESELTAVREEQQLVQERSRELNRNYTKALQLLRRVSEQSR--NLRQEVANLSA----------RAQLNEQKDSLLAESSELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRFASLEAQRQQLQAEINQRDTKIDQLDQAIAAKDNDIQAREEKLQGLETELSFLQREVEELER... 272
20 -9.780[Z] KOG1003 Actin filament-coating protein tropomyosin  ali follow..  10  1......MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESV----KEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMASEEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKE... 265
21 -9.770[K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit  ali follow..  2........................................................................SQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLEDLKREIKKLQKHRDQIKTWLSKEDVKDKQS----------LMTNRRLIENGMERFKSVEKLMKTKQFSKEALTNPDIIKDPKELKKRDQVLFIHDCLDELQKQLEQYEAQENEEQTERHE-IANLENILKKLQNNEMDPEPVEEFQDDIKYYVENNDD... 197
22 -9.630[UD] KOG2218 ER to golgi transport protein/RAD50-interacting protein 1  ali follow..  68..GSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFSAINSHLLTAQPWMDDLGTMISQIEEIERHLAYLKWISQIEELSDIQQYLMTNNVPEAASTLVSMAELDIKLQESCTHLLGFMRATVKFWHKILKDKLTSFEEILAQLHWPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLKLQTSDELLTEPKQ............................ 318
23 -9.530[D] COG4477 Negative regulator of septation ring formation  ali follow..  144.KIQESLDLYDNLRSDIADNADLYGTVITELEKHLANIETEFSQFVTLNST--IEAAEVLETAEEHTIALRAITEQIPSFIKTIEKDVPKRLEELQEASDKFVAEEYILPDNVNIKERMDDLHDHLVESSSLLEQFELDRVEAELGLIQE-------VEELYAIFEREYSARRNVEKRSSVLKEYIEHIRANNKNLLLEIDHVTQAVRGYQEHLESLDSDVDEILGNIQAKTMPYSILSRRVNSVVNALEDIEKNQIKISDTLTGLRDEERAAQE... 422
24 -9.360[L] COG0419 ATPase involved in DNA repair  ali follow..  33.GSTFYEKAIEICVDQHACQLCQRSLDKEEEKLFVEHCHSMIDVIPSKSAEVYSHLETLTKTFKNEAKPIFDEIELLDKRLSETKTELSDLQGDLQGLDIRKDEIQSELDTLYLRRANLEKLQLLVKDISNEEEIRTIDRETEVLRIELPSSIAHHNLDEIYAEREKLLEKRGYLRKQIERTKLEETSFKKKIDDAVLANNEQKLKLTKLNFQVNELEQLEKDINKSSEDCDLQKKKLLEVSSKQGSQAPFLNELESEYEKLEADIQEMAQKSRT... 309
25 -9.240[D] COG4942 Membrane-bound metallopeptidase  ali follow..  11  38...............................FSAHADERDQLKSIQADIAAKERAVRQKQQQRASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQLDAAFRQGEHTGIQLI---LSGEESQRGQR-----QAYFGYLNQARQETIAQLKQTREEVAMQRAELEEKQSEQQTLLYEQRAQQAKLTQALNERKKTLAGLESSIQQGQQQLSELRANESRLRNSIARAEAAAKARAEREAREAQAVRD...... 271
26 -9.240[S] KOG3442 Uncharacterized conserved protein  ali follow..  17....................PAQYTAEESAAAVSAPDLRDKLATLVDRTKKVKMAYHQLQSQIAFGLVEAGEVFDSLAIPLMKLVGLKTSEMESEGRHSAFIFNTERYHHMDTARSGDLNIQIRSSKEENYAA------AETAGKEILHKHKG---LVHMLKHIETQVNSHREDILQMVDDRRTFFQEFIQKSLYYLSSVHSQNHDTFPVTVKLLR--VLFNNINEVLGSVDTGVNDFMQALAK-HPMTKYVGNLAAEIKHGPVQLMNVVNEMER... 268
27 -9.160[D] COG5244 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B  ali follow..  11  409.QLLEENALLSHKVLKLTEEIQDLETLNQLNTEIEARQSEKLNEVQEETQRLSQLLIS-SQPALTEVKHLKLCLSDSQEELLQLNAKLEKANIVIDELNSAKLKLSKQVEEESSMKDDLTEMNQRL-----KEQIESYENEVNSEITSRT-------LKEFETLKTQYEKNLCNLREQLKTARMKLADKYPQGDNTSENIDWLKHSLRDSNTE-NSIPSPLTFACKEIRKLVADIKPVSVEKQLALNWKKDIERPSFHHNQQLFNYCQLTDILSK... 668
28 -9.160[T] COG3920 Signal transduction histidine kinase  ali follow..  347.PVDTKIKEANQVAIALSNASFDRSQSEERLQLLLHELVHRSKNILTLVQAMIRQLGRENKSIPEFQKEVDHRLRGLGMSIRALAEVQWQGLPIRKLIETHLDVFGTVVERFRLEGDDFMLSPEAAQNFGLVVHELTTNSIKYGALSVPPGKGTTVIKRHAEGAFGGNVTTEYR........................................................................................................ 555
29 -9.140[U] KOG0412 Golgi transport complex COD1 protein  ali follow..  1....................MSVLEQLGALDIGTNEQVDETLQRIADEEAKVNEKLESLLAK-QCQIEAKMSGIGRSLSLLHTVDSDSNKLNDQIVNTAQLAESVSAKVRRLDLARCRASECQQRVHDLID------LHLCSQGVVKAIGEEDYEKSATHIARFLAMDQQLLRRTADDVQGSITSVSDAVKTLEDATEKTRVLKRFDEAVKADDLASVERFFKIFPLVGCHRTGIEKFSLYIKELRNAQDIAKAESRLQLAYADRLTAILENFARVV. 261
30 -9.040[Q] COG1463 ABC-type transport system involved in resistance to organic solvents, periplasmic component  ali follow..  12  61......................................GSKITYNGVKIGRVADISETVRNGRPVAEFTLDVYPRYLSLIPANVNADIKATTVFGGKYVSLTTPEHPSQKRLTPQTVEINTLFQTITLIAEKVDPIKLNLTLSAAAQSLAGLG-----ERFGQSIVNGNSVLDDVNSQLPQARHDIQQLASLGDTYANSASDFFDFLNNSIVTSRTINQQQKDLDQVLLAAVGFGNTGADIFSRSG---PYLARGAADLVPTAQLLDTYSPAIFCTL. 299

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.