current user: public




Query: TM0014 TM0014 281895 Purified-2001-01-30, from JCSG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKILast
1 -41.800[NT] COG0840 Methyl-accepting chemotaxis protein  ali follow..  22  387...NYSIDQLRELVETINQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMADQVSANASESSAVAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAVISMEQ-ARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTMNVIQEITSQTSAGTTATARSIGNLAKMASEMRNSV. 670
2 -14.200[S] COG1511 Predicted membrane protein  ali follow..  10  243......LGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQEGSEKAAKAEKIINALLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVINSSDFLTAEINSVEKKLPQVDAPDFDQILSQLPTADQLPDIAKSSLEDVKAQVAQVKAMPEATSKLYNGAKTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFAKAKAGSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLAD... 519
3 -12.800[S] COG5280 Phage-related minor tail protein  ali follow..  11  6...SGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKQQLLSKQVTKKLDGLKGAQADVDRQFKSGDIGEEQYRAFQREVVATEGRLDHYKQSLKDVESSSGEAGNATKGLGGKFDVEDVGEAVKGGVLMEAADHLSVVGDKLKEFSGSAQEAFSDVDEGMDKITTTTGKASDEFKTQFDNIEDVGSALGTLSAQFDMSGDTLEKNSKLATDVKTSIESAKSAIEAYGLSNKDFSTVLDSVTATSQRTGVAVDSLFD... 302
4 -11.800[S] KOG4360 Uncharacterized coiled coil protein  ali follow..  14  112....................IDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENM--ALRSKACH------------IKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRS... 352
5 -11.700[S] COG5412 Phage-related protein  ali follow..  10  1MADYTLTAKLTADPSGFRAGFQKAQESLANLQSRVNQTGKRVQSIGKSISDLGSKLTALTSITLVKGFDRLVGIDSARAKLKGLGHDAEAIDSIMDSALASVKGTAFGLDEAATTAANAKELTRYLSLTADTAAIAGTSLGEIGAILNKVTTSGRAYNSELQMLSDRGLPVYQWLAEEANTTADAIFDMASKGEISTDMLLNAIEKNIGGAAKIMGEESFSAAIANIGADIARIGANFLDAGGKAGGFFSTVKPLLTEFRGFLAQVEEQAADW..... 293
6 -11.500[S] KOG2216 Conserved coiled/coiled coil protein  ali follow..  10  7...EEGMVTADEFPTPEVTTIETIQPPREPGKSPLELLRESKTSVEEIVAKMLSMKKQHKSEIRELLTQMFLNFVNLRQANRAILTEEDKVKAETERAKAPVDFTTLQLHNLMYEKSHYVKAIKACRDFKSKYPDIDLVPEQDFFRH---------APEAIKDQSLSSDSSHVLMPKRLNFELHQRKELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHLGIQHTKKLKQHNLAELLPPPLYVLYSQLLAQKEAFEESIELEV 274
7 -10.700[S] COG5281 Phage-related minor tail protein  ali follow..  1.........................................MATLRELIIKISANSQSFQSEIQRASRMGSEYYRTLQNGGRQAAAAARDQRRALAELNSQLTEIRGSAVGMAGAFAGAFATGHLI-SLADEWS--SVNARLKQASQSSD---FSSSQKVLMDISQRTGTAFSDNAALFARSAASMREYGYSADDVLKVTEAISTGLKISGASTAEAGSVITQFSQALAQGVLRGEEFNSVNESGDRIVRALAAGMGVARKDLKAMADDGQ....... 225
8 -10.700[Z] KOG1003 Actin filament-coating protein tropomyosin  ali follow..  10  3.AIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDE--LQEMQLKEAKH----------AEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMASEEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQ... 272
9 -10.700[D] COG5185 Protein involved in chromosome segregation, interacts with SMC proteins  ali follow..  11  302...EERYRTMQRDEVKFQSAMSGMKSKMESRTNLMKQLQVNIEEKESQLQLLKEKRDSLKYQVESEFEKMVSEREQLDRNLNMIGSKISELRKEVFDTDLLIQASIDSLEKKVQKFNSLAYRIGIVPIAAIRSANNDFELEINPEGPNYI----NKVRPFINEVRRSITLEFHEEQNKSLKLQEHVDTVNDLIAELQDELRGIESRLTSVLSECNMLRETASEEKNAFDAESDKLEELQQLKLSSHNSMLQLDQRIQSINIEADQIAHACMEYKN... 581
10 -10.600[D] KOG4438 Centromere-associated protein NUF2  ali follow..  10  192.................QSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLLVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLA-----ILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLTALEKYHDGIEKAAEDSYA... 446
11 -10.500[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  16.....................GIIAALGDHLGSKVGKARLRLFKLRPRQTAVLLTVITGTLISASTLGILFTFSKSLREGVFQLDDILAQLRVAKTELEQASQAKEEIESELTAVREEQQLVQERSRELNRNYTKALQLLRRVSEQSRNLRQEVANLSAERAQLNEQKDSLLAELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRFASLEAQRQQLQAEINQRDTKIDQLDQAIAAKDNDIQAREEKLQGLETELSFLQREVEELER... 272
12 -10.400[YU] KOG4460 Nuclear pore complex, Nup88/rNup84 component  ali follow..  480.........MICITSTYECLIWPLLSTVHPASPPLLCTREDVEVAESSLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEECLQLLSRATQVFRE--QYILKQDLAKEEIQRRVKLLCDQKKKEDLSYCREERKSLRAERLADKYEEAKEKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAY---QRKCIQSILKEEGEHIREMVKQINDIRNHVN....... 740
13 -10.400[U] KOG0993 Rab5 GTPase effector Rabaptin-5  ali follow..  10  519...QKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAE------LPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETA... 788
14 -10.300[Z] KOG0980 Actin-binding protein SLA2/Huntingtin-interacting protein Hip1  ali follow..  13  680.........................VVGNELEQEMRRMDDAIRRAVQEIEAIQRRAREVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVHLIVAAQEIAASTA--------FVSSRVK--ADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAESQVKMLELEQSLNQERAKLAALRKQHYHMAQLVAN........................... 919
15 -9.990[Q] COG1463 ABC-type transport system involved in resistance to organic solvents, periplasmic component  ali follow..  11  62.......................................SKITYNGVKIGRVADISETVRNGRPVAEFTLDVYPRYLSLIPANVNADIKATTVFGGKYVSLTTPEHPSQKRLTPQTTEINTLFQTITLIAEKVDPIKLNLTLSAAAQSLAGLG------------ERFGQSIVNGNSVLDDVNSQLPQARHDIQQLASLGDTYANSASDFFDFLNNSIVTSRTINQQQKDLDQVLLAAVGFGNTGADIFSRSGPYLARGAADLVPTAQLLDTYS.... 292
16 -9.950[D] COG4477 Negative regulator of septation ring formation  ali follow..  257.............................NIKERMDDLHDHLVESSSLLEQFEDRVEAELGLIQEKVEELYAIFEREYSARRNVEKRSSVLKEYIEHIRANNKNLLLEIDHVTQAYILSGNEKGYVRGYQEHLESLDSDVDEILGNIQAKTMPYSILSRRVNSVVNALEDIEKNISDTLTGLRDEERAAQEIAERFDSELRTIKRYVENLPGLPKDYLDLFFTTGDRVQNLFKELGRVRINIDTINHLVDVSTEDMHVLKEATTNLTDHAVLAEQLI. 510
17 -9.880[Z] KOG1853 LIS1-interacting protein NUDE  ali follow..  12  2..........................................................................EDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYAELETQLQQIETRNR--DLLSENNRLR------------MELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKP... 189
18 -9.660[D] KOG0995 Centromere-associated protein HEC1  ali follow..  276...KEEISRIRDDIRKAKDYLEQNLHVKQHMEKELAMVKSEQEEKISENEKVQKMVDDLKNKIELQKQIHGLTGKEVRQMNLD-NNKDKEVVLEIQSELDRLSKETWKLKDEDFFKEQKSKFIHLAEQIMKILSGLNIQMNLEPLRAPTNER--PEISRQLHQRKLELETEQSRFSNKAVTAEERIQIQSETLCEAKKNEAREERIRRNERDSWKDA---RKHIEQRYEQLLNEKEVLLKQMKLDGSLEKEIEDETARMSATGEEHIQKRSQLEA... 555
19 -9.020[S] COG5283 Phage-related tail protein  ali follow..  1MADISVTTGIDLNETKAVEAINRLKSAVKDSTREWQINEAQAKSAGDAVSASKYRYEGLSEAMEKQKAYI----ANLSEGMKTINRNTDAGEKAYQKYNAQLTTAERSLASMTGQLNRAKSAY------------------------------------------EYQQTGIEDLNKSLSANDKLMQSQIDLYEKTRNKMGAAKAEVSGLSTSYAKQTEIYRAQVTELKRLEAAEGTSSETLVKQKTRVNEAASSLMNYRNKLLEANLAVTKMQ.... 231

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.