current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1051-1350), from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst TLQILAELSCLQIFIQDQKCNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKEVFSFKMVSYMDATAGSAYTDMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPALast
1 -108.000sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1051-1350)  ali  100  1TLQILAELSCLQIFIQDQKCNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKEVFSFKMVSYMDATAGSAYTDMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPA 300
2 -92.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1051-1350)  ali follow..  44  33DFRLFAKLNAFCVIVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPKTVHKKAVSIMGNEVFRFNLDLYPDATEGDLYTDMSKVDGVLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAQAAERAATSVKDLAQRSFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDS................................ 300
3 -80.100sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1651-1950)  ali follow..  43  1.....................................................NVDLQSIHKKAVSILGDEVFRFQLTLYPDATEGEAYADMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAASSMKDLAQKSFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMNIELTQLKLSRTILQASLPQNDIEILKPVNMLLSIQRNLAAAWYVQIPGMEIKGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQ 247
4 -69.000sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1501-1800)  ali follow..  50  98DLKITAELNAFNVFVCDQKCNIADIKIHGMDASISVKPKQTDVFARLKDIIVMNVDLQSIHKKAVSILGDEVFRFQLTLYPDATEGEAYADMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAASSMKDLAQKSFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHYS.................................................................................................. 299
5 -63.000sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1201-1500)  ali follow..  41  1......................................................................................................................LNFLNNFQTAKESLSAATAQAAERAATSVKDLAQRSFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQEDLNLLFRILTENLCEGTEDLDKVK 182
6 -62.100sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1801-2100)  ali follow..  21  72NTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSDLTCHGFYRERFTTSGEEALIFQTFKY----GRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQT---VRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGASPTGIPKHSLRKTTSTEEPRGT............................................................................. 300
7 -61.500sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 451-750)  ali follow..  16  37ALKFFVHLKSMSIVLNHQKPELVDIVIEEFSTLIVQRPGAIKFETKIDSFHITGLPDNSEKPRLLSSLDDAMSLFQI-------TFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDSPTSNLLLLDLGHLKVTSKSRGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWRESTQHILVPMHFNLEL....................................................... 300
8 -58.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 601-900)  ali follow..  16  13......................................................................................ETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSLEQITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTHEKSDLLILDFGTFQLNSKDQGLQKTTNSMDKAYDKFDVEIKNVQLLFARAEETWKPSTMHILQPMDIHVELAKAMV-EKDIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSAQSPE 244
9 -57.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 601-900)  ali follow..  12  14......................................................................................ERNPAHSHFERRLNVSTRPLNIIYNPQAIKKVADFFYKELRVAEAARRQYNKLKMQTKAEIRQTLEESKRWTVRLDISAPQVIFPDDFKNPVLVVVDLGRMLLTNTQDNSRRKHLMSTKMYERYSLSFMDLQIMVGRVKDNWKHGPTHVVEKFNVHLQLERRLIYTSDPKYPGAVLSGNLPDLKIHINEDKISALKNCFA.............. 299
10 -56.000sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1201-1500)  ali follow..  100  1......................................................................................................................................................AQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPA 150
11 -54.200sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1951-2250)  ali follow..  20  3....................................................................................GRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQT---VRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGTFSVPSASPTGIPKHSLRKTTSTEEPRGTHSQGQFTMPLAGMSLGSLKSEFVPSTSTKQQGPQPTLSVGQESSSPEDHVCLLDCVVVDLQDMDIFAAERH 221
12 -54.000sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 451-750)  ali follow..  16  79AHIMTLKLVSTSVTINKNIPEILKIQIIGLGTQVSQRPGAQALKVEAKHWYITGLRQQDIVPSLVASIGDTTSSLLKIKF------ETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTHEKSDLLILDFGTFQLNSKDQGLQKTTNSMDKAYDKFD......................................................................................... 300
13 -47.600sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 601-900)  ali follow..  17  1.....................................................................................................................IVEFFRPLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDSPTSNLLLLDLGHLKVTSKSRGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWRESTQHILVPMHFNLELSKAMVFM-DVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAP 204
14 -45.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1201-1500)  ali follow..  15  1...........................TKVNVSM---GSTFDMNGSLGCLQLMDLTQDNKNQYVVSIGNSVGYENIISDIGTEALSFTFVERSKQECFLNLKMASLHYNHSAKFLKELTLSMDELEEPRKTREPFILEENEIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGSPELLVGHLGQIFIQNFVAGDDES------RSDRLQVEIKDIKLYSLNCTQLHRGQAFHILNNTTIQFKLEK..................................................... 299
15 -44.200sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 451-750)  ali follow..  12  46FAKLNLQLQRGTVTLLHKEQAFMQLEFSDVKLLAESLPNSSLLSVRLGGLFLRDATEGTMFPLLVFPNPQKEVGRVSQSFGLQTTSERNPAHSHFERRLNVSTRPLNIIYNPQAIKKVADFFYKELRVAEAARRQYNKLKMQTKAEIRQTLDESKRWTVRLDISAPQVIFPDDFKFKNLVVVDLGRMLLTNTQDNSRR...................................................................................................... 300
16 -42.100sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 901-1200)  ali follow..  100  151TLQILAELSCLQIFIQDQKCNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKEVFSFKMVSYMDATAGSAYTDMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKEL...................................................................................................................................................... 300
17 -37.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1951-2250)  ali follow..  10  6........QESGVAFHNDSFQLGELRLHLMASSGKMKDGSMNVSVKLKTCTLDDLREGRATSRMIDRKNDQDNNSSMIDISYKQDKN--------GSQIDAVLDKLYVCASVEFLMTVADFFIK-PENVAKETQILPRQTATGKVKIEKDDSVRPNMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLE---------QMMEASVRDLKVLACPFLREKRGKNTTVLQPCSLFMEKCTWASGK-------QNINIMVKEFIIKISPIILNTVLTIMAALSPKTKEDGSKDT 281
18 -33.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1351-1650)  ali follow..  17  1....................................................................................................................................EPFILEENEIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGSPELLVGHLGQIFIQNFVAGDDESRS------DRLQVEIKDIKLYSLNCTQLHRGQAFHILNNTTIQFKLEKSLSPDDLGTSSIMKIEGKFNPVQVVLAKHVYEQVLQTLDNLVYSEDLNKYPAS 214
19 -33.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 901-1200)  ali follow..  44  183DFRLFAKLNAFCVIVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPKTVHKKAVSIMGNEVFRFNLDLYPDATEGDLYTDMSKVDGVLSLNVGCIQIVYLHKFLMSL...................................................................................................................................................................................... 300
20 -33.400sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2101-2400)  ali follow..  15  3...............................................................................................................................................................QGQFTMPLAGMSLGSLKSEFVPSTSTKQQGPQPTGQESSSPEDHVCLLDCVVVDLQDMDIFAAERHPRRQTGGSLLTEPCRLKLQVERNLDKEISHTVPDISIHGNLSSVHCSLDLYKYKLIRGLLENNLGEPIEEFMRPY 166
21 -32.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1051-1350)  ali follow..  13  122RLNLLLLRTVGMANREKYGRKIATASIGGTKVNVSM-GSTFDMNGSLGCLQLMDLTQDNKNQYVVSIGNSVGYENIISDIGTEALSFTFVERSKQECFLNLKMASLHYNHSAKFLKELTLSMDELEENF--RGMLKSAATKVTTVLATKTAEYSEMVSL---FETP...................................................................................................................................... 296
22 -31.800sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1801-2100)  ali follow..  30  2............................................................................................................................................................................................................PVIDKMNIELTQLKLSRTILQASLPQNDIEILKPVNMLLSIQRNLAAAWYVQIPGMEIKGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQ 97
23 -30.100sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 751-1050)  ali follow..  10  17.................................................................................................................................................................EYKTPLATPPNTPPPESSSS-KTPPFSGVEFSEEQLQAHLMSTKMYERYSLSFMDLQIMVGRVKDNWKHGPTHVVEKFNVHLQLERRLIYTSDPKYPGAVLSGNLPDLKIHINEDKISALKNCFALLTTPEMKTSDTQI 163
24 -30.100sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1351-1650)  ali follow..  12  43TLNISFKTDDLTMVLYSPGPKLAEFKLENIISTLKMTDGSTFSSFSLKNCILDDKRPHKATPRMIGLTVGFDKKDMM---------DIKYRKVRDGCVTDAVFQEMYICASVEFLQTVANVFLEAYTTGTAVETSVQTWTAKEEVPT----QESVKWEINVIIKNPEIVFVADMTKNDALVITTQCEICYKGNLEN-----------STMTAAIKDLQVRACPFLPVKRKGKTTVLQPCDLFYQTTQKGTDP-------QVIDMSVKSLT.............................. 300
25 -28.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2251-2550)  ali follow..  34CMCFLIDMVNVSLELKEGAGSLARFDFKKCKLLYESSNQTKSINLVSHSMMAFDTRYANVFSCIFQPAKNSSTTQGSIQIELHFRSTKD------SSCFTVVLNNLRVFLIFDWLLLVHDFLHT-NSSSESAIVPKTVKSGVVTKRSSLPVSNERHLEVKVNVTGTEFVVIEDVSCFDAIILKGTTVLTYKPRFVD-----------RPFSGSLFGIEVFSCRLGNE-HDTALSIVDPVQIQMELVGN.................................................... 295
26 -27.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1351-1650)  ali follow..  74NMLLNFEIKEVVVTLMKKGRPLHELNVLQLGMEAKVKTYDMTAKAYLKKISMQCFDSKGEPLHIINSSNVTDEPLLKMLLTKADSDEFKTIHDSTKQRLKVSFASLDLVLHLEALLSFMDFLSSAAPFSEPSSSEKESELKPLVGESRSIAVKAVDLKITAELNAFNVFVCDQKCNIADIKIHGMDASISVKPKQT------------DVFARLKDIIVM................................................................................ 300
27 -25.400sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 901-1200)  ali follow..  11  55.LLAEFKVNCMQLGVESNGRYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTTYGADFDLLMASLTKEQESLIKLEYQFVSSECPSMNLDSTLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKDDLSPQPLMTDFERSFREQGTYQSTNTEVAVEIHRLNLLLLRTVGNREKYGRKIATASIG.............................................................................................................. 299
28 -22.900sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 751-1050)  ali follow..  16  130TFKIRFEVPKVLIEFYDCELSVVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCLDENKKPVYLVTTLDNTMEDLLTLEYVKAEKNDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQSEEKSAPVSTTETEDKGDVIKKLALKLSTNEDI........................................................................................................................................... 299
29 -22.600sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 751-1050)  ali follow..  14  1...................................................................................................................................................................................................................VEIKNVQLLFARAEETWKKSTMHILQPMDIHVELAKAMVEK-DIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSAQSPE 94
30 -21.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2401-2700)  ali follow..  1............................................................................................................FLIFDWLLLVHDFLHHRNSSSESAIVPKTVKSGVVTKRSSLPVSNERHLEVKVNVTGTEFVVIEDVSCTNAIILKGTTVLTYKPRFVD-----------RPFSGSLFGIEVFSCRLGNE-HDTALSIVDPVQIQMELVGNLMDAFNSEDFPPVLEIQLQALDIRLSYNDVQLFLAIAKSIPEQANAAVPDSV 205
31 -21.400sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1501-1800)  ali follow..  11  2......................................................................................................FQEMYICASVEFLQTVANVFLEAYTTGTAVETSVQTWTAKEEVP----TQESVKWEINVIIKNPEIVFVADMTKNDALVITTQCEICYKGNLENST-----------MTAAIKDLQVRACPFLPVKRKGKTTVLQPCDLFYQTTQK-------GTDPQVIDMSVKSLTLKVSPVIINTMITITSALYTTKETIPEETA 180
32 -21.300sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 301-600)  ali follow..  12  187ALKFFVHLKSMSIVLRENKPELVDIVIEEFSTLIVQRPQAIKFETKIDSFHITGLPDNSEKPRLLSSLDDAMSLFQIT-------FEINPLDETVSQRCIIEAEPLEIIYDARTVNS....................................................................................................................................................................................... 300
33 -21.200sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1651-1950)  ali follow..  10  222NTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSDLTCHGFYRERFTTSGEEALIFQT............................................................................................................................................................................................................................... 299
34 -14.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 2101-2400)  ali follow..  13  2...........................................................................................................................................................NMTLKAMITDPEVVFVASLTKADAPAL----ASFQCNLSLSTSKLE------QMMEASVRDLKVLACPFLREKRGKNTTVLQPCSLFMEKCTWASGK-------QNINIMVKEFIIKISPIILNTVLTIMAALSPKTKEDGSKDT 131
35 -14.300sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1501-1800)  ali follow..  2..........................................................................................................................................................................................................................................IERESELTFSLSPDDL----GTSSIMKIEGKFVNVQVVLAKHVYEQVLQTLDNLVYSEDLNKYPAS 64
36 -14.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 301-600)  ali follow..  197.AKLNLQLQRGTVTLLHKEQGFMQLEFSDVKLLAESLPNSSLLSVRLGGLFLRDATEGTMFPLLVFPNPQKEVGRVSQSFGL----QTTSADRSDH............................................................................................................................................................................................................ 298
37 -13.200sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 2551-2850)  ali follow..  50NVPVRLTPTGHNMKILQPHIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKY-FKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQVS-FHISPIKLHL-------SVSLSSGREEAKDSKQNGGLIPVHSLNLLLKSIGATLTDVQ.................................................................................. 269
38 -13.100sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 601-900)  ali follow..  36....................................................................................................IPTRHTSVTLLKCTC-TISMAEFNLLDHLLPVIMGEKNSSNFMNTTNFQSLRPLPSIRILVDKINLEHSVPMYAEQ-----------LVHVVSSLTQPSDNLLHYCYVHCYLKIFGFQAGLTSLDCSGSCLPVPVIPSFSTALYGKLLKLPTKRSQIAITEGIFELPNLTIQATRAQTLLLQAIYQS............. 214
39 -12.500sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 1051-1350)  ali follow..  15  1............................................................................................................................................ERMKEFIGIVWNAVKHLTLQLEVQSCCVFIPNDSSMPGTLVLCLPQIKIISAGHKYMEPLQEIPFVIPRWTISLHNFSIYTLL----GKQVTLCLVEPMGCTSTLAVTSQKLLATGPDTVCLHVDLESLEIKCSNPQVQLFYELTD.............. 181
40 -12.100sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 301-600)  ali follow..  21  230.HIMTLKLVSTSVTIRENIPEILKIQIIGLGTQVSQRPQALKVEAKLEHWYITGLRQQDIVPSLVAS......................................................................................................................................................................................................................................... 299
41 -11.500sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 3751-4050)  ali follow..  75ELEVLVRLEGIGLSLINKVEELVFASLTGINVHYTQLATSHMLELSIQDVQVDNQLIGTTQPFMLLSNENEVIETGPAVQVNAVKFPSKSALTNIYKHLMITAQRFTVQIEEKLLLKLLSFFG-----YDQAESEVEKYDENLHEKTAEQGGTPIRYYFEN--------------------LKISIPQIKLSVFTSNKLPLDLKALKSTLGFPLIRFE.................................................................................. 273
42 -11.100sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 1-300)  ali follow..  20....NLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIH------------------------------------PWTKLGSEPVVITINTMECILKLSNSTNRSTAESTKSSIKPRRMQQAAPTDPDLPPGYVQSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISATDLVLRKV-INFSDCTVCLDKRNASGKIEFYQLLYKCSFRTRLHFTYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQ.............. 279
43 -11.000sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 1051-1350)  ali follow..  12  3......................................................................................HLDPHKNVKEFLVTLRLHKATLRHYMSWHSQLLEFL------------------DVLDDPVLGYLPPTVITILHTHLFSCSVDYPLYLPVRVLIT--AETFTLSSNIIMDTSTFL--------LRFILDDSALYLSDKCEVLRRDYVCVLDVDLLELVIKWKGSTEGKLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYVMSTGDLHPPPRP 199
44 -10.900sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 1-300)  ali follow..  11  29.FQEHLSLDQLSLDLYKGSVALRDIHLEIWSVNEVLESMESPLELVVGSIEVA------------------------------------PWAALLTDHCTVRVSGLQLTLQPRRGPAPGA--ADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLRIKVTFLDTVVRVEHSPGDGEAVEVRVQRLEYCDEAVRDPSQAPHQPPAFLHKLLQLAGVRLHYEELPAQEEPPE-SCSGYMELMVKLKQN----EAFPGPKLEVAGQLGSLHLLLTPRQLQQLQEL................ 300
45 -10.500sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 3301-3600)  ali follow..  84IVTFKMFITQLSLAVFDDLAELLRLTLDNIFLCVAALFELYCVEICCGDLQLDNQKSNFHFAVLVCQGEKAEPIQCSKMQSLLISNKELEEYKEKCNEFSFELKPARLYVEDTFVYYIKTLFDTYLPNSRLAGHSTHLSGGKQMQVTQHARALVNPVKLRLVIQPVNLLV.................................................................................................................................. 297
46 -10.400sp|Q14667|K0100_HUMAN(removed signalp:1-31) UPF0378 protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 (Range: 1801-2100)  ali follow..  75VRRTEFYFAQARWRLTEEDGQIAELELQRFLYSVNKSDDTAEHLLELGWFTMNNLLPNAVYKVVLRPQSSCQSGRQLALRLFSKVRPPVGGISVKE-HFEVNVVPLTIQLTHQFFHRMMGFFFPGRSVEDDEVGDEEDKSKLVTTGIPVVKPRQLI................................................................................................................................................ 232
47 -10.400sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2701-3000)  ali follow..  3.............................................................................................................................................................GVEIKAESVCICFIDDCMDCDVPLAE---LTFSRLNFLQRVRTSPEGYAHFTLSGDYYNRALSG------------PFIEPWPCSVSWQQQAASRLHPPRLKLEAKAK-PRLDINITSVLIDQYVSTKES............. 118
48 -10.300sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 (Range: 3001-3300)  ali follow..  20......................FELPNHRLRFTSKVSATDMSTIPPSASLNLPPVTMSGKY-----IMEEHDSYSDQVWSIDELPSKQGYYLQGNYLRCVAEVGSFEHNLTTDLLNHLVVFMKEVNEVIQKVSGGEQPIPLWNEHDGTADGDKPKILLYSLNLQFKGIQVTATTPSMRAVRFETGLIELELSNRLQTKASPGSSSYLKLFGKCQVDLNLALGQIVKEEAGSDFHQVAYFKTRIGLRNALREEISGSSDREAVLITLNRPIVYAQPVAFDRAVLFWLN............. 287
49 -10.300sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 (Range: 3151-3450)  ali follow..  5.YSLNLQFKGIQVTATTPSMRAVRFETGLIELELSNRLQTKASPGSSSYLKLFGKCQVDLNLALGQIVKHQVYEEAKTRIGLRNALREEISGSSDREAVLITLNRPIVYAQPVAFDRAVLFWLNYKAAYDNWNEQRMALHKDIHMATKEVVDM-GTLFLQLTVNDLGICLPGDLDTGSALVLTIESTLIT-----CSSESLVSKGHFKNFCIRFAD.................................................................................... 246
50 -10.300sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 151-450)  ali follow..  10  11.............................................................................................................................KKPFKGLDRSKDKPKEAKKDTFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKSFGVTLGELSLLTANEHWTPCILNEADKIIYKLIRLDSLSAYEILTSGNIPPNYQYIFQPISASAKLYMNPYAESELKTPKLDCNIEIQNIAIELTKPQYLSMIDLLES............. 197
51 -10.200sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5 (Range: 1201-1500)  ali follow..  12  10................................................................................................................SWHEQILYFL------------------NIADEPVLGYNPPTSFTTFHVHLWSCALDYPLYLPIRSLLT--VETFSVSSSVALDKSSST--------LRIILDEAALHLSDKCNTLSRDYVRVMDMGLLELTITVKSDSDGEQTEPRFELHCSSDVVHIRTCSDSCAALMNLIQYIASYGDLQTPNKA 175
52 -10.200sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 151-450)  ali follow..  12  1................................................................................................................................................EGLEMFAQTIETVRIKVTFLDTVVRVPGDGERGVAVEVRVQRLEYCDEAVRDPSQAPPVDPAFLHKLLQLAGVRLHYEELPAQEEPPEPPLIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQELLSA............. 153
53 -10.000sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 151-450)  ali follow..  1..............................................................................................................................................................VNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISATDLVLRKV-INFSDCTVCLDKRNASGKIEFYQLLYKCSFRTRLHFTYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIA.......... 133
54 -9.840sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 3151-3450)  ali follow..  7DNNFEVNFDKDPMEMRLPISPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQVDNQLPGAMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSK-FMVLIQEMALKIDQGFLGAIIALFTPTTDPEAERRRTKLIQQDIDALNAELMETSMTDMSILSFFEHFHI----SPVKLHLSLSLGSGGEESDKEKQEMFAVHSVNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLSVVRHYSEQFLKQMYVLVLGLDVLGNIRGLSEGVEALFYEPFQGAVQ.............. 300
55 -9.770sp|Q14667|K0100_HUMAN(removed signalp:1-31) UPF0378 protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 (Range: 451-750)  ali follow..  90LWKVDLKVEDMNLFTLSALVGASEVRLDTLTILGSAETSTVGIQG-LVLALVKSVTEKMQPCCKAPDIPTPVLSLSMLSITYHSSIRSLEVQCGAGLTLLWSPP-MYLYQHVLATLQCRDLLRATVFPETVPSLALETSGTTSELEGRAPEPLPPKRLLNLTLEVSTAKLTAFVAEDKFITLAAESVSLSRHGGSLQAYCPELAAGFD............................................................................................ 297
56 -9.510sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5 (Range: 1501-1800)  ali follow..  10  100..............KGRNHDFLMEIQLSKVKFQHEVYPPCSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKEMPRKAHSNMLTVKALHESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEVKKSPGADVTCSLPRHLSTSKE-PNLVISFSGPKQPSQNDSANSVEVVNGMEE............................................................................................................. 291
57 -9.510sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 151-450)  ali follow..  12  1..............................................................................................................................................................LQVKISSIHIRYEDDITNRDSFGISLQNLSMQTTDQYWVPCLHDETEKLVRKLIRLDNLFAYGIVNENIVPEGYDFVFRPISANAKLVMNRRSDFDFSAPKINLEIELHNIAIEFNKPQYFSIMELLES............. 154
58 -9.470sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 3001-3300)  ali follow..  10  159NFEVNFDKDPMEMRLPIR-SPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQVDNQLPGAMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSK-FMVLIQEMALKIDQGFLGAIIALFTPTTDPEAERRRT..................................................................................................................................................................... 297
59 -9.420sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 451-750)  ali follow..  5.......................................SSSVVVRLADFNIYQVSTAEQCRSSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPI-SQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYK---------LNDNSKSDEHVDVRVDGLMLKFVIPSEVKSPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFK......................................................................................... 181
60 -9.240sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 451-750)  ali follow..  13.......................................SSCMVVRVDDLDIHQVSTAGQPSKKLLSCSRKLHNLPTQVSAIHIEFTEYYFPDNQELNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYK---------LEDSSQKDEHLDIRLDAFWLKVSFPLEKREPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFA......................................................................................... 189
61 -9.010sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 1351-1650)  ali follow..  13  124..............SGRQHHVLMEIQLSKVSFQHEVYPAESRQVFIVQELEVRDRLASSQINKFLYLHTSERMPRRAHSNMLTIKALHTTNLGGPECCLRVSLMPLRLNVDQDALFFLKDFFTSLVAGINPVVPGETSAEARPE............................................................................................................................................................ 273

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;