current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1801-2100), from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst SSYNRVNRSIDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMRLPPEGILHNVKLEPHASMESGLQDPVNTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSDLTCHGEFYRERFTTSGEEALIFQTFKYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQTVRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGTFSLQDKESVPSASPTGIPKHSLRKTTSTEEPRGTLast
1 -114.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1801-2100)  ali  100  1SSYNRVNRSIDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMRLPPEGILHNVKLEPHASMESGLQDPVNTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSDLTCHGEFYRERFTTSGEEALIFQTFKYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQTVRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGTFSLQDKESVPSASPTGIPKHSLRKTTSTEEPRGT 300
2 -87.400sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1501-1800)  ali follow..  18  22TIHDSTKQRLKVSFASLDLVLHLEALLSFMDFLSSAAPFSEPSSSEKESELKPLSIAVKAVSSNISQKDVFDLKITAELNAFNVFVCDQKCNIADIKIHGMDASISVKPKQTDVFARLKDIIVMNVDLQS-IHKKAVSILGDEVFRFQLTLYEGEAYADMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAMKDLAQKSFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHY.................................. 298
3 -67.800sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1051-1350)  ali follow..  19  3.........................................AKEVQISTEKQQKNSTLPKAIVSSRDSDIIDFRLFAKLNAFCVIVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPKT-VHKKAVSIMGNEVFRFNLDLYEGDLYTDMSKVDGVLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAQAAERAVKDLAQRSFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDED------------YLNPPVIDRMDVQLTKLTLYRTV 255
4 -62.200sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1051-1350)  ali follow..  16  45.NLDSTLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKDDLSPQPLMTDFERSFREQGTYQSTYEEIHRLNLLLLRTVGMANREKYGRKIATASIGGTKVNVSM-GSTFDMNGSLGCLQLMDLTQDNVKNQYVVSIGNSVGYENIISDIGYFEFVERSKQECFLNLKMASLHYNHSAKFLKELTLSMDELEENRGMLKSAATKVTTVLATKTAEYSEMVSL---FETP..................................................................... 296
5 -62.100sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1051-1350)  ali follow..  21  1.......................................................................TLQILAELSCLQIFIQDQKCNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITA-IYKKAVYITGKEVFSFKMVSYAGSAYTDMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAVKELAQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQ------------SSPPPVIDLITIKLSEMRLYRSR 223
6 -60.800sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 901-1200)  ali follow..  16  78STYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQSEEAPVSTTETEDKGDVIKKLALKLSTNEDIITLQILAELSCLQIFIQDQKCNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDI-TAIYKKAVYITGKEVFSFKMVSYMDAAYTDMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKE................................................................................... 299
7 -60.600sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 451-750)  ali follow..  13  5.......................................EEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLNHQKPELVDIVIEEFSTLIVQRPGAIKFETKIDSFHITGLPDN-SEKPRLLSSLDDAM---SLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDSPTSNLLLLDLGHLKVTSKSRSELPDVKQG----EANLKEIMDRAYDSFDIQLTSVQLLYSR 272
8 -57.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 451-750)  ali follow..  12  47.......................................DDLMTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTSVTINKNIPEILKIQIIGLGTQVSQRPGAQALKVEAKHWYITGLRQQ-DIVPSLVASIGDTTSSLLKIKF--ETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTHEKSDLLILDFGTFQLNSKDQGLQKTTNSSLE-------EIMDKAYDKFD............ 300
9 -53.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1651-1950)  ali follow..  100  151SSYNRVNRSIDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMRLPPEGILHNVKLEPHASMESGLQDPVNTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSDLTCHGEFYRERFTTSGEEALIFQTF...................................................................................................................................................... 300
10 -52.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 901-1200)  ali follow..  15  107TAFGKTEQTVKVAFSSLNLLLQTQALVASINYLTTIIPSDDQSISVAKEEKQQKNSTLPKAIVSSRDSDIIDFRLFAKLNAFCVIVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDP-KTVHKKAVSIMGNEVFRFNLDLYPDATETDMSKVDGVLSLNVGCIQIVYLHKFLMSL.................................................................................................................. 300
11 -49.300sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1951-2250)  ali follow..  86  1......................................................................................................................................................KYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQTVRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGTFSLQDKE------SVPSASPTGIPKHSLRKTTST 144
12 -49.000sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1201-1500)  ali follow..  17  8............................................................................................................GSTFDMNGSLGCLQLMDLTQDNVKNQYVVSIGNSVGYENIISDIGSFTFVERSKQECFLNLKMASLHYNHSAKFLKELTLSMDELEENFRGMLKSAAEIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGSPELLVGHLGQIFIQNFVAGDDES------------------RSDRLQVEIKDIKLYS.. 233
13 -48.100sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 451-750)  ali follow..  14  12.....................QEQWIPEEILG----------------TEEFFDPTADASCMNTYTKRDHVFAKLNLQLQRGTVTLLHKEQAFMQLEFSDVKLLAESLPNSSLLSVRLGGLFLRDLATEGTMFPLLVFPNPQKEVDGPVFEMLYERNPAHSHFERRLNVSTRPLNIIYNPQAIKKVADFFYKGKVHTSGFGYQSETLDRLLVGDFIEESKRWTVRLDISAPQVIFPDDFKFKNLVVVDLGRMLLTNTQDNSRR..................................... 300
14 -47.100sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1651-1950)  ali follow..  22  1............................................................................................................................NVDL-QSIHKKAVSILGDEVFRFQLTLYPDEAYADMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAMKDLAQKSFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEH------------YSLPPVIDKMNIELTQLKLSRTI 170
15 -39.700sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 601-900)  ali follow..  10  6...................................................................................................................................................SLLKIKFETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTHEKSDLLILDFGTFQLNSKDQGLQKTTNSSLE-------EIMDKAYDKFDVEIKNVQLLFAR 162
16 -34.800sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 601-900)  ali follow..  12  7...................................................................................................................................................PVFEMLYERNPAHSHFERRLNVSTRPLNIIYNPQAIKKVADFFYKGKVHTSGFGYQSETLDRLLVGDFIEESKRWTVRLDISAPQVIFPDDFKNPVLVVVDLGRMLLTNTQDNSRRKSRVEFSEEQLQAHLMSTKMYERYSLSFMDLQIMVGR 230
17 -32.600sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1351-1650)  ali follow..  172TIHDSTKQRLKVSFASLDLVLHLEALLSFMDFLSSAAPFSEPSSSEKESELKPLVGESRSIAVKISQKDVFDLKITAELNAFNVFVCDQKCNIADIKIHGMDASISVKPKQTDVFARLKDIIV................................................................................................................................................................................. 299
18 -31.600sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1201-1500)  ali follow..  27  1..........................................................................................................................................................................................LNFLNNFQTAKESLSAATAQAAATSVKDLAQRSFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDED------------YLNPPVIDRMDVQLTKLTLYRTV 105
19 -28.300sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1201-1500)  ali follow..  34  1.......................................................................................................................................................................................................................AQRSSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQ------------SSPPPVIDLITIKLSEMRLYRSR 73
20 -28.100sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 601-900)  ali follow..  16  1.........................................................................................................................................................................................IVEFFRPLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDSPTSNLLLLDLGHLKVTSKSRSELPDVKQG----EANLKEIMDRAYDSFDIQLTSVQLLYSR 122
21 -27.800sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1351-1650)  ali follow..  16  1.....................................................................................................................................................................................................EPFILEENEIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGSPELLVGHLGQIFIQNFVAGDDESRS------------------DRLQVEIKDIKLYS.. 83
22 -27.800sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 901-1200)  ali follow..  18  195.NLDSTLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKDDLSPQPLMTDFERSFREQGTYQS--TYEQNTEVAVEIHRLNLLLLRTGRKIATASIGG........................................................................................................................................................................................................ 300
23 -22.100sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 301-600)  ali follow..  10  155.......................................EEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENKPELVDIVIEEFSTLIVQRPQAIKFETKIDSFHI-TGLPDNSEKPRLLSSLDDAM---SLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNS................................................................................................................... 300
24 -21.000sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 751-1050)  ali follow..  16.........IYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVPTGVKSIRTRKLQKQDCSVNMTTFKIRFEVPKVLIEFYHCELSVVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLDE-PVYLVTTLDNTMEDLLTLEYVKAEKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLH---NILPQSEEKSAPVSTTETEDKGDVIKKLALKLSTNEDII................................................................... 300
25 -19.800sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1351-1650)  ali follow..  10  9.....................................TSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKLAEFKLENIISTLKMYTDSTFSSFSLKNCILDDKRPHVKATPRMIGLTVGFDKKDMMDIKYRKVRD-----GCVTDAVFQEMYICASVEFLQTVANVFLE-AYTTGTAVETSVQTWTAKEEVPTQESVKWEINVIIKNPEIVFVADMTDAPALVITT................................................... 231
26 -19.800sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1951-2250)  ali follow..  6...............................................................................QESGVAFHNDSFQLGELRLHLMASSGKMFKDSMNVSVKLKTCTLDDLREGIEATSRMIDRKNDQDNNSSMIDISYKQDKN----GSQIDAVLDKLYVCASVEFLMTVADFFIK-VAKETQILPRQTATGKVKIEKDDSVRPNMTLKAMITDPEVVFVASLTKADAPALTAS.................................................. 181
27 -19.400sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 301-600)  ali follow..  13  163......................................EQWIPEEILGTEEFFDPTADASCMNTYTKRDHVFAKLNLQLQRGTVTLLHKEQGFMQLEFSDVKLLAESLPNSSLLSVRLGGLFLRDLATEGTMFPLLVFPNPQKEVGRVSQSFGLQTTSADRSDH........................................................................................................................................ 298
28 -19.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 751-1050)  ali follow..  14  56.........VSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSAQSPERQVSSMKGSELKKAAEVPNEELINLLLKFEIKEVILEFTKEEDTILVFNVTQLGTEATMRTFDLTVVSYLKKISLDYHEIEGSKPLHLISSSDKPGLDLLKVEYIKADKTAFGKTEQTVKVAFSSLNLLLQTQALVASINYLTTIIPSDDQ..................................................................................................... 298
29 -18.700sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1801-2100)  ali follow..  59.........IKGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQSVQETVRVRKVDTDSKLSMNQIVSLQFDFHFESLSIILYNNDINLGELRLHLMASSGKMFKDSMNVSVKLKTCTLDDLREGIEATSRMIDRKNDQDNNSSMIDISYKQDKN----GSQIDAVLDKLYVCASVEFLMTVADFFIKAVPQSPENVAKETQILPRQTATGKVKIEK............................................................................... 295
30 -18.600sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 751-1050)  ali follow..  11  125.........LSGNLPDLKIHINEDKISALKNCFALLTTPEMKTSDTQIKEKIFPQEEQLEQHTREVLVESQLLLAEFKVNCMQLGVESNGRYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDMQTYGADFDLLMASHKNLSFDIPTGSLRDSRAQ.............................................................................................................................................. 291
31 -18.100sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2251-2550)  ali follow..  10  2.......................................ENNLGEPIEEFMRPYDLQDPRIHTVLSGEVYTCMCFLIDMVNVSLELKEGAGSLARFDFKKCKLLYESFSNTKSINLVSHSMMAFDTRYAGNVFSCIFQPAKNSSTTQGSIQIELHFRSTKD--SSCFTVVLNNLRVFLIFDWLLLVHDFLHT-SESAIVPKTVKSGVVTKRSSLPVSNERHLEVKVNVTGTEFVVIEDVSDTNAIILKG-TTVLTYKPRFVDRPFSGSLFGIEVFSHDTALSIVDPVQIQME........ 291
32 -12.900sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1501-1800)  ali follow..  11  31..............NPVQVVLAKHVYEQVLQTLDNLVYSEDLNKYPASATSSSLSNTSQKSLSVKEVKSFTQIQATFCISELQVQLSGDAQGLVSLKFQDFEVEFSKDHPTLSIQIALHSLLMEDLKNPDSKYKNLMVSRGAPKPSSLAQKEYLSQS------------SVSNVEYPDMPRSLPSHMEEAPNVFQLYQRPTSASRKKQKEVQGKSKFDDSLVHINIFLKHP..................................................................... 297
33 -12.600sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2101-2400)  ali follow..  10  128.........IHGNLSSVHCSLDLYKYKLIRGLL------ENNLGEPIEEFMRPYDLQDPRIHTVLSGEVYTCMCFLIDMVNVSLELKDPKRKLARFDFKKCKLLYESFSNTKSINLVSHSMMAFDTRYAGQKTSPGMTNVFSCIFQPAKNSSTTQGSIQSTKDSSCFTVVLNNLRV............................................................................................................................ 300
34 -12.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 301-600)  ali follow..  11  197.......................................DDLMTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTSVTIRENIPEILKIQIIGLGTQVSQRPQALKVEAKLEHWYITGLR-QQDIVPSLVA.................................................................................................................................................................. 298
35 -11.200sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1501-1800)  ali follow..  2.............FQEMYICASVEFLQTVANVFLEAYTTGTAVETSVQTWTAKEEVPTQESV---------KWEINVIIKNPEIVFVADMTK-ALVITTQCEICYKGNLENSTMTAAIKDLQV---------RACPFLPVKRKGKITTVLQ----QTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSALYTTKETIPEETASSTAHLWEKKDTKTLKMMIKMNIDSIFIVLEAGIGHRTVPMLLA................................................... 247
36 -11.100sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 (Range: 3301-3600)  ali follow..  29..............DAIDINSQGTQVVFLTGFGYVYVDVVHQCGTVFITVAPEGKAGPILTNTNRAPEK--IVTFKMFITQLSLAVFDDLAELLRLTLDNIFLCVAALFELYCVEICCGDLQLDNYNKSNFHFAVLVELEEYKEKCFIKLCITLNEGKSILCDINEFSFELKPARLYVEDTFVYYIKTLFDTYAGHSTHLSGGKQVLPMQVTQHARALVNPVKLRLVIQPVNLLV................................................................. 297
37 -10.800sp|Q14667|K0100_HUMAN(removed signalp:1-31) UPF0378 protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 (Range: 451-750)  ali follow..  10  33SSTQSDTLFLDCTIRGLQVEASDTCAQCLSRILSLMGPQSGKSAVSRHSSFGESVS--------------LLWKVDLKVEDMNLFTLSALVGASEVRLDTLTIL----GSAETSTVGIQGLVLALVKSVTEKMQPCCKAPDIPTPVLSLSMLSITYHSSIRSLEVQCG---AGLTLLWSPPDHMYLYQHVLATLQCRDLLRATVFPETVPSLALETSLPPKRLLNLTLEVSTAKLTAFVAEDKFITLAAESVSLSRH........................................... 281
38 -10.800sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 2551-2850)  ali follow..  10  20.........................................SVKHTEKLEREFKEYTESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQI-QNQIHGAVFPFVFTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTEN------------------TEVELFHKDIEAFKEEYKTASLVDQSQVSLYEY-KLHLSVSLSSGREEAKDSKQNGGLIPVHSLNLLLKSIGATLTDVQ..... 269
39 -10.300sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 3751-4050)  ali follow..  10  23..............GMLSIRVIPDGPTRALQITDF---CHRKSSRSYEVDELPVTEQELQKLKNPDTEQELEVLVRLEGGIGLSLINKVPEELVFASLTGINVHYTQLATSHMLELSIQDVQV-DNQLIGTTQPFMLNEVIETGPAVQVNAVKFPSKSALTNIYKHLMITAQRFTVQIEEKLLLKLLSFFGYDQAESEVEKYDENLHEKTAEQGGTPIRYYFENIPQIKLSVFTSNKLPLDLKALKSTLG-FPLIR............................................ 271
40 -10.300sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 3001-3300)  ali follow..  10  78EEMEQADYEITLSLHSLGLSLVNNESKQEVSYIGITSSGVKPFSQKQIILLEQSYQKHQISRDHGWIKLDNNFEVNFDKDPMEMRLPIR-SPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQV-DNQLPGAMFPVVFALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKIDQGFLGAIIALFTPTTDPEAERRRT................................................................................................. 297
41 -9.550sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 451-750)  ali follow..  10  13..............................................................................................................SSCMVVRVDDLDIHQVSTAGQPSKKPSTLTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYK------LEDSSQKDEHLDIRLDAFWLKVSFPLEKREPQALVFSASGMIATN............................................ 169
42 -9.480sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 451-750)  ali follow..  10  5..............................................................................................................SSSVVVRLADFNIYQVSTAEQCRSSPKSMQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYK------LNDNSKSDEHVDVRVDGLMLKFVIPSEVKSPRAISIQSSEMIATN............................................ 161
43 -9.020sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 3151-3450)  ali follow..  10  6......................................................................LDNNFEVNFDKDPMEMRLPISPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQV-DNQLPGAMFPVVFALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKIDQGFLGAIIALFTPTTDPEAE----------------RRRTKLIQQDIDALNAELMETSMTDMSILSHFHISPVKLHLSLSLGSGGEESDKEKQEMFAVHSVNLLLKSIGATLTDVD..... 226

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;