current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|15644643|ref|NP_206812.1| chaperonin GroEL (HP0010) [Helicobacter pylori 26695], from H.pylori

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .
# E-value Template Links and tools%idFirst MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAILTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVHLNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEGHFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEKAAPAMPDMGGMGGMGGMGGMMLast
1 0.000e+00JGI.Meta 7000833665 SRS017139_Baylor_scaffold_16433__gene_17939 chaperonin groL [Human Supragingival plaque microbiome from visit number 1 o  ali  59  1MAKQILFDEEARRALGRGVDALANAVKVTLGPKGRNVVLDKKYGAPTITNDGVTIARDIELEDPFENMGAQLVKEVATKTNDIAGDGTTTATLLAQAMIQEGMRNVVAGANPMIVKKGIETAVKTLVDEIKSKAKKVETKAKIAQVAAISS-GDAEVGDLIAEAMEKVGKDGVITVEESKSMDTNLSVVEGMQFDRGYISPYMVTDTEKMEAIMDDPYVLITDRKISSIADILPVLEQVVKQGKQIVIIAEDLDGEALATIVVNKLRGTFKALAVKAPGFGDRRKAMLEDIAILTGGTVISEEIGRKLDSVTLEDLGRARQVRSTKEETTIVDGAGNKAQITARVEQLKKQIADTTSDFDREKLQERLAKLSGGVAVVEIGAATEVEMKDKKYRVEDALNATRAAVEEGIVAGGGTTFIDILPALDKKAEGDVKVGIEIVKRAVEAPVRQIAENAGLEGSVVVDSVKKAGDGVGFNALENSYVDMIGAGIVDPAKVTRSALQNAASIAAMVLTTETLVTDKPEPE..................... 525
2 0.000e+00gi|497985500|ref|WP_010299656.1| molecular chaperone GroEL [Candidatus Odyssella thessalonicensis]  clstr ali  59  1MAKEVRFSADARERMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELSDKFENMGAQMLREVASKTSDLAGDGTTTATVLAQAIVREGVKAVAAGMNPMDLRRGIDIAVDAVVEDLKSRAKKVSTSEEIAQVGTISANGETEIGEMLAKAVEKVGKEGVITIEEAKSLHTELDVVEGMQFDRGYISPYFVTNPEKMICELDNPFILIHEKKLSGLQAMLPVLEAVVQSGRPLMIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKSMLEDIAVLTGGTVISEDVGIKLENVTMEMLGTARKVTISKDDTTLVDGAGHKDEIAARCNQIRAQIEESSSDYDREKLQERLAKLSGGVAVIRVGGVTELEVKERKDRVEDAMHATRAAVEEGIVPGGGVALLYALKKLEKVSNNDQEVGVKIVRQALSAPCRQIAFNAGKDGSIIVGKITDADDNYGYDAQNDNFGNMFEFGVIDPVKVVRTALQDAASVASLLITTEAMI............................ 522
3 0.000e+00gi|585382841|dbj|GAF22377.1| LOW QUALITY PROTEIN: heat shock protein 60 family chaperone GroEL [Bacillus sp. JCM 19047]  clstr ali  56  1MAKDIKFSEEARRSMLKGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELKMAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMGIRKGIEKATAAAVKELASISKPIESKESIAQVAAISS-ADEEVGQIIAEAMERVGTTALLPLKNQKVFSTELEVVEGMQFDRGYASPYMVSDSDKMEAVLDNPYILITDKKISNIQEVLPVLEQVVQQSRPILIIAEDVEGEALATLVVNKLRGTFNAVAVKALGFGDRRKAMLEDIAILTGGEVITEDLGLDLKSATIDSLGRANKVVVTKENTTIVEGAGNPEQIAARVGQLKGQVEETTSDFDKEKLQERLAKLSGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALINVIKAVQAEAAGDEATGVNIVLRALEEPVRQIAYNAGLEGSIIVEKLKSEAVGVGYNAATGEYVNMVETGILDPVKVTRSALQNAASVSAMFLTTEAVIADKPEENE.................... 526
4 0.000e+00gi|644971815|ref|WP_025392569.1| molecular chaperone GroEL [Desulfurella acetivorans]  clstr ali  61  3.AKQIEFGDIARSKILKGINQLADAVSATLGPQGRNVVIDRKFGSPLITKDGVTVAKEIELKDPYENMGAQLVREVASKTSDVAGDGTTTATVLARAIYREGLKHVTAGVSAIELKRGIDKAVEKVVEELKKISKPIEEKREIAEVGSISANNEREIGEIIAEAMDKVGKDGVITVEEAKSTQTELEVVEGMRFDRGYISPYFVTNTEKMIAELEDPFIVITDKKISSMQEFLPLVEKIAKAGKPFLVIAEEVEGEALATLVVNKIRGTISCVAVKAPGFGDRRKEMLKDIAILTGGTVISEETGMKLETTDLSMLGRAKKIVVDKENTTIIDGAGKKEDIQGRIKQIDAQIEQSTSEYDKEKLRERKAKLAGGVAVIKVGAATETELKEKKARVEDALNATKAAVEEGIVPGGGTALLKCAEALKKLENEDQNIGASIILKVLEEPIRAIAKNAGFEGSIIVNKIKESSKSYGFDARKGEFVDMLKAGIIDPTKVERIALQNAASVAGLMLTTEALITDMPEENK-PAAPMPGGMPDM....... 542
5 0.000e+00gi|738975921|ref|WP_036859331.1| molecular chaperone GroEL [Porticoccus hydrocarbonoclasticus]  clstr ali  60  4..KDVKFGDDARHPMLTGINILADAVKVTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEIQLKDKFQNMGAQMVKEVASRASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKAVIAAVAEIAKLAKPCTNNKEIAQVGTISANSDAHIGDVIAEAMDKVGKEGVITVEEGTGLENELDIVEGMQFDRGYLSPYFINNQESMSVEHDDAFILLVDKKISNIRELLPLLENVAKAGKPLIIIAEDVEGEALATLVVNNLRGIVKVATCKAPGFGDRRKAMLEDIAVLTGGTVISEEVGLDLESATLDHLGTAKRVAMTKENTTIVDGSGDHGAIQGRVNQIRAQIEDTSSDYDREKLQERVAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRALQAIEKGENHDQDAGISLARRAMESPLRQIVTNAGEEASVVVAKVKQGKGNYGYNAGTGEYGDMIAMGILDPAKVTRTALQAAGSIAGLMVTTEAMVAEAPQENNA................... 530
6 0.000e+00gi|500007673|ref|WP_011688391.1| molecular chaperone GroEL [Candidatus Solibacter usitatus]  clstr ali  61  1MAKQIVYSEASRQAILRGVNQLADAVKVTLGPKGRNVVLEKKFGGPTITKDGVTVAKEIELKDPLENMGAQMVREVASKTSDVAGDGTTTATILAQSIYREGVKAVAAGANPMALKRGIDKAVELATEEVKKLSKPVSG-DMIAQVGTISANSDKTIGNIIADAMKKVGKDGVITVEESKTMVTELDTVEGMQFDRGYLSPYFVSDAERMEAVLEDPYILIHEKKISNMKDLLPLLEQIARSGKPLLIIAEEVEGEALATLVVNKLRGTLNACAVKAPGFGDRRKAMLEDIGILTGGKPIMEDIGVKLEGVRLEDLGRAKRVTVDKDNTTIVDGAGNPKGIEGRIKQLRAQIDETTSDYDREKLQERLAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRAAKALATKVDGDEQIGVSIVKRACEEPLRQIVSNSGTEGAIVVDKVREANNNYGYNAATDTYEDLVAAGVIDPTKVTRSALQHAASIAGLMLTTEAMIAEIPEKKSAPAGGPGGHGPEMD...... 541
7 0.000e+00gi|953313974|ref|WP_057974274.1| molecular chaperone GroEL [Lactobacillus algidus]  clstr ali  57  1MSKELKFSEDARSAMLRGVDQLANTVKSTLGPKGRNVVLEESYGSPIITNDGVTIARAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVTEGMKNVTAGANPVGIRRGIEAATKAAVAELHELSHKVETKEDIAQIASVSSAND-EIGALIADAMEKVGNDGVITIEESKSIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEANLETPYILVTDKKISNIQEVLPLLQSIVEQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAIVTGATVITDELGLQLKDTTIEQLGSAGKVNITKENTVIVEGSGNKEKIIERVGLIKKQIDETTSEFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTAFVNVIGKVALEAVGDELTGIKIVQRALEEPVRQIAKNAGLEGSVIVEKLKSEKPGIGFNAATNEWQDMIAVGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPISAA.................. 528
8 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  59  1MSKEIKFGEEARKKMLDGVNTLANTVKVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDPYENIGARLVKEVATKTNDVAGDGTTTATVLAQAIIKEGVKNVAAGGDPMAIKRGIDKAVDSAVQGLKGISSEINGKEDIARVASISANN-QEIGELIADAMEKVSKDGVITIEESKTATTGLNVVEGMQFDKGYISPYFVTDTDKMEAVMENPYILITDKKISNIQEILPLLEALMQQSAKLVIIADDIEGEALSTLVLNKLRGVLNIVAVKAPGFGDRRKEMLEDIAILTGGEVITSDLGLELKDTTIKQLGRAKQVKIQKESTIIVDGAGDREAIAARVKQIRTGIEETKSEYDKEKLQERLAKIAGGVAVIEVGAATEVEMKEKKLRIEDALSATKAAVEEGIVAGGGTALVDVMPNVENKLNEDEKIGAKIVLKALEEPVRQIATNAGLEGAVILEKVKIAEKGVGFDSSKEEYVDMKKAGIVDPTKVTRSALQNAASIAGMFLTTESVVTDKKERENCNCGGNHNAMSGMEGM.... 546
9 0.000e+00JGI.Meta 7001911064 SRS022725_LANL_scaffold_13452__gene_34604 chaperonin groL [Human Supragingival plaque microbiome from visit number 1 of  ali  62  1MAKEIKFSEEARKSLERGVNKLADTVKVTLGPKGRNVILQKSFGAPLITNDGVTIAKEIELEDTYENMGSELVKEVATKTNDIAGDGTTTATVLTQAIVREGLKNVAAGSNPILLRRGINKAVEIAVATLKANSKNVENKESIAQVATIS-GGDEVIGRLIADAMEKVGKDGVITVEESKTMDTALKTVEGMQFDRGYVSAYMATDIEKMEAVLQDPYILITDRKISSIQDILPLLEQLVQQGRKLVIIAEDVDGEALSTLVVNKLRGTFEVVAVKAPGFGDRRKEMLQDIAILTGGQVISEELGFDIKETTIDQLGKASSVKVTKDNTTIVDGVGEQAEIEKRVEQIKAQIEETTSEFDKEKLQERLAKLSGGVAVIEVGAATETELKEKKLRIEDALNATRAAVEEGIVAGGGTALIEAMKAVEKEIDAEEKTGMQIVAKALQEPLKQIAINAGLEGAVIVENVKTSSANEGFDALNEKYVDMIKAGIIDPTKVTRSALQNAASIAAILLTTEAAVVDVKKDEPA................... 529
10 0.000e+00JGI.Meta 7028137236 C2876250__gene_243019 chaperonin groL [Human Stool microbiome from visit number 2 of subject 158256496]  ali  61  1MAKQFKYGEEARRSLQTGVDILADTVKITLGPKGRNVVLDKKYGSPLINNDGVTIAKEIELEDPFENMGAQLVKEVSVKTNDVAGDGTTTAAVLAQAIFREGAKNVAAGANPMVLRKGILSAVEVAVDELKKISKPIENKTAIAQVAAISA-SDNEIGSLIADAMEKVGKDGVITVEESKTMKTELGLVEGMQFDRGYASSYMVTDTDKMEAVLDNPLILITDKKISNIQEILPILEQIVQMGKKLLIIADDIESEPLATLVVNKLRGTFNVVAVKAPGFGDRRKAMLQDIAVLTGGQVISEELGLELKDATMDLLGTARLVKVDKENTTIIEGAGSKDDIAARVQSIKAQIAETTSDYDKEKLQERLAKLAGGVAVVQVGAATEVEMKEKKLRIEDALAATKAAVEEGIVPGGGVALLSVAPAVKETLTGDAKTGAAIVLRAIEEPMRQIAVNAGLEGSVIVAKVLENDANYGYDAANDEYCNMVEKGIIDPTKVSRTALTNAASVASTMLTTECLVADI......................... 524
11 0.000e+00gi|509519929|gb|EOY49242.1| chaperonin GroEL [Streptomyces lividans 1326]  clstr ali  59  38MAKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGANPMALKRGIEKAVEAVSAALLEQAKDVETKEQIASTASISA-ADTQIGELIAEAMDKVGKEGVITVEESQTFGLELELTEGMRFDKGYISAYFATDMERMEASLDDPYILIANSKIGNVKDLLPLLEKVMQSGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLGDIAILTGGEVISEEVGLKLENATLDLLGSARKVVITKDETTIVDGAGSADQVQGRVNQIRAEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLQASQVFEKELTGDEATGANAVKLALEAPLKQIAVNGGLEGGVVVEKVRNLTVGHGLNAATGEYVDMIAEGIIDPAKVTRSALQNAASIAALFLTTEAVIADKPEKAAPAGAPGGMPGGDMD...... 577
12 0.000e+00gi|504063357|ref|WP_014297351.1| molecular chaperone GroEL [Marinitoga piezophila]  clstr ali  60  1MAKVMLFSEEARRALERGVNKVADAVKITLGPKGRNVVLEKSWGSPTITNDGVSIAKEIELKDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIREGLKNVAAGANPMLMKNGIQKAAEKAVEEIKNMSKKLSSKEDIAHVASISANN-EQIGNLIADAMDKVGEDGVITVEDSKTMETFVDFTEGMQFDRGYISPYFVTDTEKMEAIMKEPYILITDKKISTVKPLIPVLEKVAQAGKPLVIIAEDVEGEALSTLVLNKLRGTLESVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLTLENVTLNDLGRADMVKVRKDDTIIVGGKGDEENIKERIKQIKAQIENTTSEYEKETLQERLAKMAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLRAKKAIEEELEGDEKIGAKVVYEALEAPIRQIAKNAGVDGAIIIDRVLAKEVAYGYDALNDEFVDMFDKGIIDPAKVTRSAVQNAASIASMLLTTEVLVVDEPKEEKAPEMPDMPAY.......... 539
13 0.000e+00gi|545422441|ref|WP_021661210.1| molecular chaperone GroEL [Clostridium sp. ATCC 29733]  clstr ali  58  1MAKEIKFGEEARQSLQAGIDQLADTVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAKEIELDDPFENMGAQLVKEVATKTNDAAGDGTTTATVLAQALVREGMKNVAAGANPMIIRKGMQKAVDAAVDFIVTNAKEVNGSQDIARVASVSA-GDEAVGKLIAETMEKVSADGVITIEESKTAETYSEVVEGMQFDRGYISPYMVTDTDKMEAVLDDPYILITDKKISSIQDLLPLLEQIVQAGKKLLIIAEDIEGEALTTILVNKLRGTFNCVAVKAPGFGDRRKEMLRDIAILTGGEVISSELGLELKDTTVLQLGNAKQVKVTKENTIIVDGAGAKEAIDERIAQIKNEIAASTSDFEKEHMEERLGKLSGGVAVIKVGAATEVEMKERKLRIEDALSATKAAVAEGIVAGGGTAYLNAVGAVAKVATGDEKTGANIVLKALEEPVRQIAANAGVEGSVVVDKIKRSKMGYGYDAYSDQYVEMLESGIVDPTKVTRSALQNAASVAAMVLTTESLVADQKEENPAAGMAQPP-------MGGMM 542
14 0.000e+00gi|524053285|emb|CCY37165.1| 60 kDa chaperonin [Alistipes sp. CAG:831]  clstr ali  61  1MAKEIKFNMEARSLMKEGVDALANAVKVTLGPKGRNVVIDKKFGAPQVTKDGVTVAKEVELEDRFQNMGAQMVREVASKTNDQAGDGTTTATVLAQEIISVGLKNVTAGANPMDLKRGIDKAVETVVADLKKQTQEVEDMAKVEQIATTSANNDAFIGKLIAEAMGKVKKEGVVTVEEAKGTQTEVKVVEGMQFDRGYISPYFMTNPDKMEAVLENPKILITDKKISSMKDLLPILEPIARNSESLLIIAEDVDGEALTTLVVNRLRGTLKVAAVKAPGFGDRRKEMLQDIATLTGAQVVSEERGFTLENTTPDMLGKADKVTIDKENTTIVNGKGDKEAIADRVAQIRKQIEKTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVEDALNATRAAVEEGIIPGGGVAFIRAIEALKKGENEDEQTGINIVAKAIEAPLRTIAENAGVEGSVVAQKVREGKGDFGYNARADRYENLLAAGVIDPTKVTRVALQNAASVAGMFLTTECVIADKPEPAPAAPAMNP-------GMGGMM 542
15 0.000e+00gi|523967969|emb|CCX52604.1| 60 kDa chaperonin [Alistipes sp. CAG:514]  clstr ali  63  1MAKEIKFDVDVRSKMKEGADALADAVKVTLGPKGRNVVIDKKFGAPQVTKDGVTVAKEIELADRYANMGAQMVKEVASKTNEQAGDGTTTATVLAQAIINVGLKNVTAGANPMDLKRGIDKAVAAVVAELKKNSKKVGTDSKVEQVGTISANNDAAIGKLIADAMSKVKGDGVITVEEAKGTETEVKVVEGMQFDRGYISPYFMTDSDKMEAVLDNAAILITDKKVSSMKDLMPILEPIARDGRALLIIAEDVDGEALTTLVVNKLRGTLKVAAVKAPGFGDRRKEMLQDIATLTGAIVVSEERGFTFENTTPDMLGKAEKVTITKENTTIVGGAGDKDAIADRVAQIRKQIENTTSDYDKEKLQERLGKLAGGVAVLYVGAGSEIEMKEKKDRVEDALNATRAAVEEGYLPGGGVSYIRAAEVLKKGENDDETTGIHIISRAIEEPLRQIAQNAGVDGSVIVQKIRENKGDFGYNARTEEYVNMLEAGVIDPTKVARVALENAASVAGMFLTTECGIVDIPEKEPAAPAMPAGGM.......... 539
16 0.000e+00gi|659837775|ref|WP_029890056.1| molecular chaperone GroEL [Polycyclovorans algicola]  clstr ali  62  3.AKEIKFGDDARARMVSGVNILANAVKVTLGPKGRNVVIDKSFGAPTVTKDGVSVAKEIELKDKFENMGAQLVKEVASKTSDAAGDGTTTATVLAQAILNEGQKSVTAGVDPMDIKRGIDKAVEAVTAEIKKLAVPCKDRKAIAQVGTVSANSDEAIGEIIATAMDKVGKEGVITVEDGSGLENELDVVEGMQFDRGYLSPYFINNQQSQQVELENPLILISEKKVSNIRELLPVLESVAKAGKPLLIIAEDVEGEALATLVVNNLRGILKVAAVKAPGFGDRRKEMLKDIAILTGGTVIAEDVGLSLEKVTIDDLGTAKKVQINKENTTVIDGAGESAAIEDRVNHIRRQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVEEGIVPGGGVALVRAAAALEKGANDDQTVGINILRRAIQEPLRMIVRNCGEESSVVLNKVREGKGNYGYNAGNNTYGDMLEAGIIDPAKVTRLALQNAASVAGLLLTTEAMIAEAPAKNDGPAMPA.............. 535
17 0.000e+00gi|553311056|ref|WP_023056037.1| molecular chaperone GroEL [Peptoniphilus sp. BV3C26]  clstr ali  60  1MAKEIKFAEDARNGLISGINKLADTVKVTLGPKGRNVILGKEFGSPLITNDGVSIAREIDLEDNFENMGAQLLKEVATKTNDVAGDGTTTATLLAQGIIREGMRNLAAGANPMILQKGIKDAVDATVETIKGFSKPIETKESIAQVASVSA-ADKNIGDLIAEAMEKVGRDGVITVEESKSMGTDLAVVEGMQFDRGYLSPYMVTDSEKMVAALDEPYILITDKKITNIQDLLPLLEQVLQSGKSLLVIADDIEGEALATLVLNKLRGTLNIVGVKAPGYGDRRKAMLEDIAVLTKGTVISSDLAMDLKDATIDMLGTASKVRVEKELTVIVNGAGDKKDIDERINQIKSQIESTDSEFDKEKLQERLAKLSGGVAVIHVGAATEVELKEKKLRIEDALSATRAAVEEGIVPGGGTVLIDCIETLEKLLEGDEKTGVNIILRALEEPLRQIAENAGLEGSVIVEKVKSLEKGFGYDALKGQYVDMIKAGIVDPTKVTRSALQNAASVSSMILTTEAAVGIIKEDTP.................... 528
18 0.000e+00gi|931541513|gb|KPL17137.1| molecular chaperone GroEL [Bacteroides sp. SM23_62]  clstr ali  62  1MAKQIKYDIEARDLLKKGVDALANAVKVTLGPKGRNVVIEKKFGAPQVTKDGVTVAKEIELKEGLENLGAQMVKEVASKTNDDAGDGTTTATVLAQAIVNVGLKNVTAGANPMDLKRGIDRAVSKVVDSLKGMSEDIEDNTRIEQVASVAANNDAEIGRLIAEAMEKVKKEGVITVEEAKVSETYVEVVEGMQFDRGYISPYFVTDTEKMEAVLENPYILLFDKKISVMKDLLPILESTAQTGRPLLIVAEDVDGEALATLVVNKLRGSLKVAAVKAPGFGDRRKEMLEDIAILTGGTVISEEKGLKLENATLDMLGQCEKISVDKDNTTVVNGAGDKDTIKARVNQIKVQIENTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKERKDRMNDALNATRAAVEEGIIPGGGVAYLRAVGALEEGENDDETTGIAIVRRSLEEPLRIIAENAGVEGSVAVQKVKEGKADFGFNARTDTYENLLKAGVIDPTKVARIALENAASIAGMLLTTECVLA........................... 522
19 0.000e+00gi|931432586|gb|KPK18212.1| molecular chaperone GroEL [Betaproteobacteria bacterium SG8_41]  clstr ali  59  3.AKEVRFHDAARHRIVAGANILADAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENMGAQMLKEVASKTSDVAGDGTTTATVLAQSIVQEGMKFVAAGMNPMDLKRGIDKAVDAVVEQLKKISKPCTTSKEIAQVGAISANADEQIGKIIADAMDKVGKEGVITVEDGKSLQNE--------------PPYFINNAEKQIAVLEDAYILFHDKKISNIRDLLPVLEQVAKAGKPLLIVAEDVEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDMAILTGGTVIADELGLKLENVTLKDLGQAKRIELQKENTTLIDGAGERSQIEDRIKSIRQQIEETTSDYDREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVAYIRARANVKKVDSHDQDAGVKIVMRALEEPLRWIAANGGIEASVVVNKVREGKGNFGYNAQTEEYGDLVEMGVIDPTKVTRVALQNAASVAGLILTTDAMVAEAPKEEKAQAGHAHGGMGEMD...... 528
20 0.000e+00gi|759936043|ref|WP_043621209.1| molecular chaperone GroEL [Chromobacterium piscinae]  clstr ali  61  3.AKEVRFHDNARERIVNGVNVLANAVKVTLGPKGRNVLLARSFGAPHITKDGVSVAKEIELKDPFENMGAQMVKEVASKTADVAGDGTTTATVLAQAIVQEGMKYVASGMNPMDLKRGIDKAVQAVVKELQTLSKPVTNSKETAQVAALSANSDEAIGKIIADAMEKVGKEGVITVEDGKSLDNELAVVEGMQFDRGYLSPYFITDPEKQTAVLEDPLVLLYDKKISNIRDLLPVLEQVAKAGKPLLIVAEDVEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGGTVIAEETGLTLEKAGLAELGSAKRVEIGKENTTIIDGAGDKAKIEARVQAIRAQIDAATSDYDREKLQERVAKLSGGVAVIRIGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALLRARAHMGKGDNADQDAGIQIVLRALEAPLRAIAANAGDEPSVIVNKVLEGKGSHGYNAASGQFGDLVEMGVIDPTKVTRTALQNAASIASLILTTDATVAEAAQDSKAKAPA............... 534
21 0.000e+00gi|517943634|ref|WP_019113842.1| molecular chaperone GroEL [Verrucomicrobia bacterium SCGC AAA164-O14]  clstr ali  63  1MAKQLQFDEAARQTLLRGVEKLARAVKATLGPSGRNVILDKKFGSPTVTKDGVSVAKEIELEDPYENMGAQLIKEVSSKTSDIAGDGTTTATVLAEAIYKEGLRNVTAGANPISLQRGILEASKAIVAQLAEISKEVSDSKEIAQVATVSANWDNEIGGIIADAMDKVGKDGTITVEEAKGIETTLDVVEGMQFDKGYLSPYFVTDPESMDCDLENAYILINEKKISNLKDLLPVLEKIAKTGKPLLIIAEDVEGEALAALVVNKLRGTLNIAAVKAPGFGDRRKAMLDDIAILTGGRCITEDLGIKLENIELEDLGEAKRVTIGKEETVIVEGAGGTEAVSGRVGQIRKQIGDTTSDYDREKLQERLAKLSSGVAVINVGAATESEMKEKKARVEDALHATRAAVEEGIVPGGGTALIRATAQIDLGLSGDEATGADIIVSAIEAPLRQLAANAGLEGALIVEKVKNASGNAGYNVATGDYEDLIEAGVVDPTKVTRSALQNAASISGLMLTTEALITDLPEPEPADA................. 530
22 0.000e+00 GL0159981 [Complete] locus=scaffold92529_1:74:1696:-  ali  63  1MAKEIKFDVDVRSKMKEGADALADAVKVTLGPKGRNVVIDKKFGAPQVTKDGVTVAKEIELADRYANMGAQMVKEVASKTNEQAGDGTTTATVLAQAIINVGLKNVTAGANPMDLKRGIDKAVAAVVAELKKNSKKVGTDSKVEQVGTISANNDAAIGKLIADAMSKVKGDGVITVEEAKGTETEVKVVEGMQFDRGYISPYFMTDSDKMEAVLDNASVLITDKKVSSMKDLMPILEPIARDGRALLIIAEDVDGEALTTLVVNKLRGTLKVAAVKAPGFGDRRKEMLQDIATLTGAIVVSEERGFTFENTTPDMLGKAEKITITKDNTTIVGGAGDKDAIADRVAQIRKQIENTTSDYDKEKLQERLGKLAGGVAVLYVGAGSEIEMKEKKDRVEDALNATRAAVEEGYLPGGGVSYIRAAEALKKGENDDETTGIHIIARAIEEPLRQIAQNAGVDGSVIIQKIRENKGDFGYNARTDEYVNMLEAGVIDPTKVARVALENAASVAGMFLTTECGIVDIPEKEPAAPAMPAGGM.......... 539
23 0.000e+00gi|503521093|ref|WP_013755426.1| molecular chaperone GroEL [Thermodesulfobium narugense]  clstr ali  60  3.AKMIAFDEEARRALEKGVNAVADAVKVTLGPKGRNVVLEKKWGSPTITNDGVTIAKEIELEDPYENMGAQLLKEVASKTNDIAGDGTTTATVLAQAMVQEGLKMVAAGASPLSIKRGIEKAVDVVIQEIKKMSLPVETKEAIAQVATISAN-DRFIGEKVAEAMDKVGKDGVITVEESKGIETSVDIVEGMEFDKGYVSPYLVTDPERMEAELDEPYILITDKKISALKDILPILEEIARNGKPMLIIAEDLEGEALATIVVNKLRKTLNVVAVKAPGFGDRRKAMLQDIAILTGGDVISEDVGLKLENTKIENLGRAEKVKVTKEKTTIINGKGSVEAIKGRIAQIKKEIEQTDSNYDREKLQERLAKLSGGVAVIKVGAATETELKEKKHRMEDALSATRAAVEEGIVPGGGATLIHALKALDLQFEGEEKVGLDIVKKALQVPCKQIASNAGFEGSVVVARLKEEKPGIGFDASNGTYVDMVKSGIVDPAKVTRSAVQNAASIAGMILTTNTLVADKPKKESAPAAP............... 532
24 0.000e+00gi|512723894|ref|WP_016481918.1| molecular chaperone GroEL [Chthonomonas calidirosea]  clstr ali  56  3.AKMLLYDEEARRALERGAEAVANAVKVTLGPKGRNVVLDKKWGSPTITKDGVTVAKEIELEDPYENMGAQLVKEVASKTNDVAGDGTTTATVLAQAILKEGLRYVAAGGNPLQVKHGIERAVERAVEELKKLAVEVGDKAKVASVAAI-AGNDAEIGQLVADAIERVGQDGVITVEESRSLQTYTEFVDGMQFDKGYISPYFVTDTERMEAVLENPYILIYEKKISSATDLIPLLEKIAQQRRPIVIIAEDVDGDALATLVLNRIRGTLSCAAVKAPGFGDRRKAMLEDIAILTGGKFISEDLGVQLKNVDFSYLGTAEKVIIGKEETTIINGGGTEAAIMGRINQIKRQIEETESSYDKEKLQERLAKLAGGVAVIKVGAATETELKEKKHRFEDALSATRAAVEEGIVPGGGVTLLNVQSALDKADTQDEQHGINIVRRALEEPLRQIAENAGFEGSVVVEKVKTLPKGHGFNAATEEYGDMIAAGVIDPVKVTRFALQNAASIASLVLTTEALVVEKPEKKPANGANPPGGMD......... 540
25 0.000e+00gi|652001157|ref|WP_026702933.1| molecular chaperone GroEL [Bacillus aidingensis]  clstr ali  59  1MAKDIKFREDARRSMLNGVDELANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDNFENMGAQLVSEVASKTNDLAGDGTTTATVLAQAMIKEGLKNVTSGANPMVIRKGIEDATKVAIEELRKISKPIEGSEAISQVASVSASSD-EVGQIISEAMGRVGNDGVITVEESRGLETELEVVEGMQFDRGYASPYMVTDSDKMTAELDDPYILITDKKITNIQEVLPLLEQVVQQNKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIALLTGGEVITEDIGLDLKSATVEQLGRAGKVVINKDDTTIVEGSGNPADITNRVNQLKAQIEETTSDFDREKLQERLAKLAGGVAVVKVGAASETEMKERKLRIEDALNSTRAAVEEGIVSGGGTALMNAVSKLEDETEGDEATGVSIVLRALEEPLRQIAHNSGQEGSVVVERMKSEKVGYGFNALSGEWVNMIDDGIVDPTKVVRSALQNASSVSAMFLTTEAVIADKP........................ 524
26 0.000e+00gi|493757843|ref|WP_006706640.1| molecular chaperone GroEL [Candidatus Regiella insecticola]  clstr ali  60  3.AKDVKFGDNARKKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAKEIELEDKFENMGAQMVKEVASKSNDAAGDGTTTATVLAQAITTGGLKAVAAGMNPMDLKRGIDKAVTAAVEELKKLSKPCTDSKAITQVGTISANSDETIGELIAEAMEKVGKEGVITVEDGSGLCNELDVVEGMQFDRGYLSPYFCNKQDTMTAELDNPCILLVDKKISNIRELLPVLEAVAKAGKSLLVIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTKGTVIAEEIGLELEKTNLEDLGQAKRVIITKDNTTIIDGAGDPAAIADCVCSIKKQIEDVTSDYDREKLQERVAKLAGGVAVIKVGAATEIEMKEKKARVEDALQATRAAVEEGVVAGGGVALIRAAALIGKGDNEDQNVGIKVALRAMEAPLRQIVINAGEEASVIANNVKSGKGNYGYNAQTEEYGDMVEMGILDPTKVTRSALQYAASIAGLMITTDCMIGDLPAEKN.................... 529
27 0.000e+00gi|943601763|ref|WP_055432130.1| molecular chaperone GroEL [Candidatus Symbiothrix dinenymphae]  clstr ali  63  1MAKDIKFDIDARDLLKKGVDELANAVKVTLGPKGRNVIIDKKFGAPQITKDGVTVAKEIELDCPIQNMGAQLVKEVASKTNDDAGDGTTTATVLAQSIVTVGVKNVASGANPMDLKRGIDKAVVKVVESLKAQSQEINNDVKIENVAKISANGDETIGALIAEAMKKVKTEGVITIEESKGIETYVDVVEGMQFDRGYISAYFVTNTEKMEADLDNPYILIYDKKISALKDILPILEQTIQSGRPMLIIAEDIDSEALSTLVVNRLRGSLKICAVKAPGFGDRRKEMLEDIAILTGGTVISEERGLKLEGATVDMLGTAEKVNISKDNSTIVNGAGDKKDIAARVAQIKAQIETTTSDYDREKLQERLAKLAGGVAVLYVGAPSEIEMKEKKDRVADALSATRAAVAEGTVPGGGVAYIRAAAALEKGANDDETTGVEIVKRAIEEPLRQIVANAGKEGAVVVQKVKEGKGDFGYNARTDTYENLCKVGVIDPTKVTRVALENAASIAGMFLTTECVITDKKEE...................... 527
28 0.000e+00gi|746344265|ref|WP_039389246.1| molecular chaperone GroEL [Novosphingobium sp. MBES04]  clstr ali  61  3.AKDVKFSRDARERILAGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELKDKFENMGAQMIREVASKANDAAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGIDLAVGKVVENLKSRSRDVTGHSEVAQVGVISANGDKEVGEKIAEAMEKVGKEGVITVEEAKGLDFELDVVEGMQFDRGYLSPYFVTNPEKMTVELDNPYILIHEKKLSNLQSILPILEAVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLGDIATLTAGEMVSEDLGIKLENVTLAMLGEAKTVTIDKDNTTIVDGAGSAEEIKARVEQIRSQIEITTSDYDREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYATKALEKGENDDQTRGVDIVRQSIMAPARQIATNAGFDGAVVTGNLREDDETQGFNAATDVYENLVAAGVIDPTKVVRTALQDAASVAGLLITTEAAICDAPEDKAA................... 531
29 0.000e+00gi|491919021|ref|WP_005671977.1| molecular chaperone GroEL [Lautropia mirabilis]  clstr ali  60  3.AKQVNFGDEARAKLVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEVELKDKQANMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVAALIEQLKKQSKPTTTSKEIAQVGTISANSDEEIGQIIADAMEKVGKEGVITVEDGKSLSNELDVVEGMQFDRGYLSPYFINNPDRQVAVLESPFILLCDKKISNIRDLLPVLEQVAKASRPLLIVAEDIEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDMAILTGGVVISEETGMSLEKATIEELGSAARVEVAKENTTIIDGSGDAKAIENRVKAIRAQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALLRAKAAAKEGSNPDQEAGIKIVLRAVEEPLRQIVTNAGEEASVIVAKVAEGKGNFGYNAANGEYGDLVEMGVVDPTKVTRTALQNAASIAGLLLTTDALISEAPEDKPASP................. 531
30 0.000e+00JGI.Meta 7018932695 SRS022609_Baylor_scaffold_87863__gene_159437 chaperonin groL [Human Stool microbiome from visit number 2 of subject 1584  ali  61  3.AKDIMFATDARAKMLKGVETLAKTVKVTLGPKGRNVILDKSYGAPKITKDGVSVAKEVELSDKFENMGAQLVKEVAQKTADKAGDGTTTATVLAEAIIREGCKAVAAGMNPMDLKRGIDMAVEAVVEDIKSRSKEIKTSEEIAQVGTISANGDRSIGEYLARAMEKVGNEGVITVEDAKGLETELDVVEGMQFDRGYLSPYFVTNPEKMTCEYENPYILLYDQKISNLQPLIPVLEAIVQSGRALLIVAEDIEGEALATLVVNRIRGGLKVCAVKAPGFGDRRKAMLQDIAILTGGQVISEELGMKIENVTLDMLGTAKKVEINKDDTTIIDGNGEKDLIAARAAQIRKEIEETTSDYDREKLQERLAKISGGVAVLRVGGASEVEVKEKKDRIDDALNATRAAVKEGVVAGGGVALLYSIKALDKPANQDQKVGIDIIRKAAEAPIRQIAENAGVDGAVVAGKLLESDSNYGYNAQTGEYTDMVKAGIIDPTKVVRTALQDAASVGGLLITTEAMVTEAPQKE..................... 529
31 0.000e+00JGI.Meta 7059232681 SRS024075_LANL_scaffold_5546__gene_16912 chaperonin groL [Human Stool microbiome from visit number 2 of subject 15951076  ali  60  1MAKEIKFGVEARSALEAGVNKLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEVELEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMINEGMKNLAAGANPIILRKGMKKATETAVDSIRSMSSKLSGKEQIAKVAAISA-GDEQVGEMVADAMEKVTGDGVITIEESKTMKTELDMVEGMQFDRGYLSAYMATNMDKMEAELDNPYILITDKKISNIQEILPLLEQVVQASARLLIIAEDVEGEALSTLVINKLRGTFNVVAVKAPGYGDRRKEMLKDIAILTGGQVISEELGLDLKETTMDQLGRAKSVKVQKENTIIVDGEGDKAEIEARIAQIKNQIEETTSDFDREKLQERLAKLAGGVAVVRVGAATETEMQEAKLRMEDALAATRAAVEEGIIAGGGSAYIHASKEVAKSLEGDEKTGANIILKALEAPLRRIAENAGLEGSVIIDKVRSEKPGFGFNALTEEYVNMVDNGILDPAKVTRSALQNATSVASTLLTTESVVANIKED...................... 526
32 0.000e+00gi|406883184|gb|EKD30829.1| hypothetical protein ACD_77C00474G0001 [uncultured bacterium]  clstr ali  64  1MSKDIKFNLEARNLMKEGVDALANAVKVTLGPKGRNVIIDKKYGSPQITKDGVTVAKEIELEDRFANIGAQMVKDVASKTADQAGDGTTTATVLAQSIITVGLKNVTAGANPMDLKRGIDKAVAAVVESLKKQSQSVGDDTKIEQVATISANNDITIGKLIAEAMSKVKKEGVITVEEAKGTDTEVKVVEGMQFDRGYISPYFMTNPEKMEAVLENPYILITDKKISTMKDLLPVLEPVAQSGRSLVIIAEDVDGEALATLVVNRLRGTLKIAAVKAPGFGDRRKEMLEDIAILTGGTVISEEKGLRLDAATLEMLGKAEKITIDKENTTVVNGAGEKVLIDKRVAQIRMQMEATTSDYDREKLQERLAKLAGGVAVLYVGAASEMEMKEKKDRVDDALSATRAAVEEGIVPGGGVAYIRAIESLKKGANEDENTGISIIARAIEEPLRMIVENSGVEASIVVQRIKEGKDDFGYNARTDKFENLYAAGVIDPTKVTRIALENAASIAGMFLTTECVLAEKKEENPA................... 530
33 0.000e+00gi|501003213|ref|WP_012056293.1| molecular chaperone GroEL [Thermosipho melanesiensis]  clstr ali  60  1MAKMLRFSEEARRALERGVDAVADAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGIKNVTAGANPILVKRGIDKAVAAAVEKIKDISKKLSNSDDIAHVASISANS-EEIGKLIAEAMEKVGEDGVITVEDSKSIDTFVEFTEGMQFDRGYISPYFVTDPEKMEVVYNEPFILITDRKLSNIKPLIPILEKVAQTGKPLVIIAEDVEGEALTTLVLNKLKGTLNTVAVKAPGFGDRRKAMLQDIAILTGGIVASEEVGINLEDLTLNDLGRADVVRVKKDETIIVGGHGDQEEIKKRIAQIKAQIEQTTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGITLLRARKPVEKELDGDEKIGAKIVYEALSAPINQIAKNAGYDGAIIIHKVLEQDPAYGFDALKGEYCDMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEPKNNNPMPEMP............ 537
34 0.000e+00gi|654468689|ref|WP_027939069.1| molecular chaperone GroEL [Anaerobiospirillum succiniciproducens]  clstr ali  59  3.AKDVFFGNEARAQMLEGVNTLANAVKVTLGPKGRNVVLDKAYGAPLITKDGVTVAKEIELDGKFQNMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVAAAVAELKTLSTECKDSKSIAQVGTISANSDTTVGNLISEAMEKVGRDGVITVEDGQGLEDQLDLVEGMQFDRGYLSPYFINKADTGSVELENPYILLCDKKIANIRDILPILEGVAKAGKSLLLIAEDVESEALATLVVNNMRGIVKVAAVKSPGFGDRRKAMLQDIAILTGGTVISSDLGMELEKATLDDLGVAKRVVITKDNTTIIDGAGEAQDIADRVDQIRKQIEESTSEYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAMHATRAAVEEGVVPGGGVALVRVASKIIDGDNEDQKVGIKVALRAMEAPLRQIVANAGEEPSVVANNVRTGEGNYGYNAATDTYGDMIEMGILDPAKVTRSALQFAASIAGLMITTECMIADAPKKDEPAMAP............... 535
35 0.000e+00gi|501353090|ref|WP_012384725.1| molecular chaperone GroEL [Beijerinckia indica]  clstr ali  62  3.AKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGIDHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAVVQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTLISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDYDREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALLRAIKALENTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESEYAFGYNAQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAPLPP................ 534
36 0.000e+00JGI.Meta 7038115439 C3373902__gene_299190 chaperonin groL [Human Stool microbiome from visit number 1 of subject 763860675]  ali  59  1MAKELHYGEDARRKLQSGVDKLADTVKITLGPKGRNVLIDKKFGSPLITNDGVTIAREIELEDAVENMGAQVVKEVASKTNDVAGDGTTTATLLAQIIIKEGFKNVAAGANPMVLKRGIQGAVDVAVDEIKRLAQIVDNKESIAQVASVSA-ADENIGALIAEAMEKVGKDGVITVEESKTMGTTLEVVEGMQFDRGYFSPYMVTDTEKMEAVLENPYILITDKKITNIQEILPVLEQVVQQGRKLLIICDDLEGEALATIIVNKLKGTFDCVAVKAPGFGDRRKAMLDDIAILTGGTVISEELGYELKEATVDMLGSAATVKVDKENTVIVDGAGDADEIQARVAQIKTQIENTTSEFDKEKTQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTKAAVEEGIVSGGGVALVNAIPAVAKSLDGDAKTGGAIIVRALEEPVRQIAENAGFEGSVVVAQVKESKEGVGFNAATEEYIGMIDAGIVDPAKVTRSALQNAASASAMLLTTEAGITDIPSEEPA................... 529
37 0.000e+00gi|502777088|ref|WP_013012064.1| molecular chaperone GroEL [Denitrovibrio acetiphilus]  clstr ali  62  1MAKQITFSEDARQAILRGVDQLANAVKVTLGPKGRNVVIEKKFGSPLITKDGVTVAKEIELEDALENIGAQMVKEVASKTNDVAGDGTTTATVLAQAIYREGIKNVVAGAKPMEIKRGIDKAVEAVVARLATMSQPIQDKKEISQVGAISANNDQEIGDIIADAMDKVGKDGVITIEENKSTETVLDVVEGMQFDRGYLSPYFVTNPDSMEAVLENPYILMLESKVSNMKDILPVLEQLAKENAPFIIIAEDIEGEALATLVVNKLRGTLNCCAVKAPGFGDRRKEMLKDLAVLTGGTVVSEETGMNINTVTLADLGRAKKIVVDKENTTIVEGAGNVEDIQARVNMIKKQAEDTASDYDREKLQERLAKLSGGVAVIKVGATTETEMKEKKARVEDALSATKAAVEEGIVPGGGVALVRALSALADKLSEDQQIGVELVKKALTYPLRQIVSNAGFEASIVVNEIKADKDTFGFNAYSEEYVDMLEAGIIDPTKVTRSALQNAASVASLMITTEAIITDVKDEK..................... 527
38 0.000e+00gi|738614327|ref|WP_036524623.1| molecular chaperone GroEL [Nitrincola sp. A-D6]  clstr ali  61  3.AKDVRFGNDARQRMLDGVNVLADAVKTTLGPKGRNVVLERSFGSPVITKDGVSVAKEIELKDKFENMGAQMVKEVASKANDVAGDGTTTATVLAQAIVSEGLKSVAAGMNPMDLKRGIDKAAAAVVAELAKMSVPCTDYKAIAQVGTISANSDSEIGRIIAEAMEKVGQEGVITVEEGSGFDNELDVVEGMQFDRGYLSPYFINNQENMSAELEDPYILLVDKKISNIRELLPVLEQVAKSSRPLLIVSEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQVISEEVGLSLEQAGLEHLGQAKRINITKENTTIVDGAGAQADIEARVQQVRVQIEDTSSDYDREKLQERVAKLAGGVAVIKVGGGTEVEMKEKKARVDDALHATRAAVEEGVVPGGGVALIRALDNVGKGDNHDQNIGIELAFRALEAPLRQIVANAGGEGSVVVSKIREGKGSFGFNASNDQYGDMMEMGIIDPAKVTRAALQAAASIAGMMITTEAMVAELPEDKPAMP................. 532
39 0.000e+00gi|738859510|ref|WP_036748475.1| molecular chaperone GroEL [Peptococcaceae bacterium SCADC1_2_3]  clstr ali  60  1MAKEIVFGEDARRALERGVNALANTVRVTLGPKGRNVVLEKKFGSPMIINDGVTIAREIELTDPLENMGAQLIKEVATKTNDIAGDGTTTAALLAQAIVREGMKNVAAGANPMIIKHGIEKAVEKAIEAMKKASKNIESKEAISQVASISAN-DPSIGALVGDAMEKVGKDGVITVEESKGIGTTLEVVEGMNFDRGYISPYMITDTEKMEANLNEPYILITDKKIGAVSDLLPLLEKVVQSGKPLLIIAEDVEGEALATLVLNKLRGTLSCVSVKAPGFGDRRKSMLEDIAILTNGTVITEELGLKLDKATVDMLGKAKSIRVKKEETIIVGGAGEQDKISARVSQIKRQIDDTTSEFDREKLQERLAKLAGGVAVIQVGAATETEMKEKKLRLEDALNATRAAVEEGIVSGGGVAYVDAAKALDVIENGDEKTGVEIIRRALEEPVRQIANNAGVEGSVVLEKVKTSPSGIGFNALSGEYVNMIEAGIVDPTKVTRTALQNAASIAAMILTTETLVAEKPEKE..................... 527
40 0.000e+00gi|376317109|emb|CCG00482.1| chaperonin GroEL [uncultured Flavobacteriia bacterium]  clstr ali  64  1MAKKIEFDIEARDGIKRGVDALANAVKVTLGPKGRNVIIGKSFGAPQVTKDGVTVAKEIELNDNLENMGAQMVKEVASKTNDLAGDGTTTATILAQSIVTEGLKNVAAGANPMDLKRGIDKAVSSVVKGLAKQSVEIGSSEKILQVASISANNDDTIGKLITEAFEKVGKEGVITVEEAKGTETYVDVVEGMQFDRGYISPYFVTDSEKMEADLDTPQILITDKKISVMKDLLPILEPVAQSGKPLLIIAEDIDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENTTIDMLGTAEKVTIDKDNTTIVNGSGNKSDIKSRVSQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAPSEVEMKEKKDRVDDALHATRAAIEEGIVAGGGVALLNSKSDLEKASNSDEITGIQIVNKAIETPLRTIVENSGGEGSVVVSKVLEGNKNFGYNAKEGKYVDMLKEGIIDPKKVTRVALENAASVAGMILTTECALIDIKEDN..................... 528
41 0.000e+00gi|928954873|ref|WP_053979552.1| molecular chaperone GroEL [Marinagarivorans algicola]  clstr ali  59  3.AKDVIFGDSARQRMLKGVNVLADAVKATLGPKGRNVILEKSFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASQASDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVIAAVAHIKEIAKPCEDTKSIAQVGTISANSDTAVGDIIAEAMEKVGKEGVITVEEGSGLENELDLVEGMQFDRGYLSPYFINNQESMSVEHETPFLLLVDKKISNIRELLPVLEAVAKAGKPLVIIAEDVEGEALATLVVNNMRGIVKVSACKAPGFGDRRKAMLQDIATLTGATVISEEVGLDLETTTLEHLGQAKRVTMSKENTTIVDGAGDTDEIKGRVAQIRAQIEDTSSDYDREKLQERVAKLAGGVAVVKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGTALLRAVASIVKGDNEDQNAGIAIARRAMEAPLRQIVANAGEEGSVVCDKVKSQDNSYGYNAGTGEYGDMIAMGILDPAKVTRTALQAAASIAGLMVTTEAMVADSPEDK..................... 529
42 0.000e+00gi|524000815|emb|CCX81198.1| 60 kDa chaperonin [Ruminococcus sp. CAG:108]  clstr ali  59  1MAKQIAYGEDARKALMKGIDQLADTVKITLGPKGRNVVLDKKFGAPLITNDGVTIAKEIELEDPFENMGAQLVKEVSIKTNDIAGDGTTTATLLAQALIREGMKNVTAGANPMVLKKGIADAVNVAVEAVKKNSKQVSGTDDIARVATVSSQ-DEFIGKLIAEAMEKVTTDGVITVEESKTAETYSEVVEGMMFDRGYIAPYMVTDTDKMVAELDNPLILITDKKISTTQEILPLLEQIVQMGKKLLIIAEDVEGEALTTLVLNKLRGTFTCVAVKAPGFGDRRKEMLQDIATLTGGTVITSDLGLELKDTTVDQLGTARQVKIEKENTIIVDGSGDKEAIKGRVAQIRQQIETTTSDFDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKLRIEDALAATKAAVEEGIVAGGGIACMNAIPAVADTLEGDAKTGAKIVLKALEEPLRQIVANAGLEGSVICDNVKKAKVGYGFNALTEEYTDMVSAGIVDPTKVTRSALQNASSVAAMVLTTESLVTDIKEXXXXXXX-XXXDMGGM....... 541
43 0.000e+00gi|754783136|ref|WP_042146950.1| MULTISPECIES: molecular chaperone GroEL [Pseudoalteromonas]  clstr ali  61  3.AKDVIFSGDARAKMLAGVNILANAVKVTLGPKGRNVVLDKSFGAPVITKDGVSVAKEIELADKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKAVAAAVIELKEISQPCSDTKAIAQVGTISANSDTEIGDIIANAMEKVGNSGVITVEDGQTLENELDVVEGMQFDRGYLSPYFINNAEKGVVELDSPFILLVDKKVSSIRELLPTLEGVAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISEEIGLELEKAQMEDLGTAKRVVISKDDTTIIDGAGEQDGISGRVSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEIEMKEKKDRVEDALHATRAAVEEGVVAGGGVALVRAASKLVKGDNEDQNHGIKVALRAMEEPLRQIVSNAGDEASVVVNNVKTGEGSYGYNAASGEYNDMIEMGILDPTKVTRSAIQYAASIAGLMITTEAMIADVPQEAAAPAAMP.............. 536
44 0.000e+00 GL0002627 [Complete] locus=scaffold2323_1:1868:3502:-  ali  58  4MAKEIKYGAEARNALQNGVNQLADTVRVTLGPKGRNVVLDKQYGAPLITNDGVTIAKEIELADGFENMGAQLIKEVAAKTNDVAGDGTTTATVLAQAMVNEGMKNLAAGANPIVLRKGMKKATDKAVQILAEMSQPVAGKEQIAKVAAVSSGS-EEVGQMVADAMEKVSKDGVITIEESKTMQNELELVEGMQFDRGYISSYMCTDMEKMEAVLDNPYILITDKKLSNIQEVLPLLEQIVQSGARLLIIAEDVEGEALQTLVINKLRGTFNVVAVKAPGYGDRRKAMLEDIAILTGGQVISEEVGLELKDATLEMLGRAKSVKVQKENTVIVDGAGAKDAIAARIGQIRSQIEETTSEFDKEKLQERLAKMAGGVAVIRVGAATETEMKEEKLRMEDALNATRAAVEEGIIAGGGSAYIHVTTQLAESLDGDEKIGARIVQKALEAPLFHIVTNAGLEGAVVINKVKESKVGVGFDAYNEEYVDMIQAGILDPVKVTRSALQNATSVSATLLTTESVVSTIKEPAPAMPAGADGGMGMM....... 544
45 0.000e+00JGI.Meta 7067529415 SRS024435_LANL_scaffold_31614__gene_78392 chaperonin groL [Human Stool microbiome from visit number 2 of subject 1595714  ali  59  1MAKQIIYGEDARKALLSGINQLADTVKITLGPKGRNVVLDKKFGAPLITNDGVTIAKEIELDDPFENMGAQLVKEVSIKTNDVAGDGTTTATLLAQALIREGMKNVTAGANPMVLKKGIQTAVNTAVEAVKANSKVVSGTNDIASVAAI-SAADDFTGKLIAEAMEKVSKDGVITVEESKTAETYSEVVEGMMFDRGYIAPYMVTDTDKMIADLDNPYILITDKKISNIQEILPILEQIVQAGRKLLIIAEDIEGDALTNLVLNKLRGVFTCVGVKAPGFGDRRKEMLRDIAILTGGQVISSEIGLELKDTTLDQLGQARQVKVDKENTIIVDGAGNADEIKGRVAQIRAQIETTTSDFDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKLRIEDALAATKAAVEEGIVAGGGIALMNAIPAVEKSATGDEKTGMQIVLKALEEPVRQIAENAGLEGSVIVANVKAAKVGYGFNAFTEEYVDMIDAGIIDPTKVTRSALQNAASVASMVLTTESLVADIKEEKAAAPAMDPSAMGGM....... 542
46 0.000e+00gi|959202384|emb|CUT17522.1| chaperonin GroEL [bacterium 2013Arg42i]  clstr ali  58  3.AKQVGFGQDCRSKMVEGINVLANAVKVTLGPKGRNVVIERSFGAPTVTKDGVSVAKEIELKDRFMNMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVHEGMKYVIAGMNPMDLKRGIDKAVAAAVEELKKGSKNCSTSKEIAQVGSISANSDEAVGAIIAEAMDKVGQEGVISVEDGKSLENELDIVEGMQFDRGYLSPYFVNNADKQMAILENPYILLYDKKISAIRDLLPILEQVAKSSRPLLIITEDMDGDALATLVVNNLRGSLKTCAVKAPGFGDRRKAMLEDIAVLTGGVVISADAGMSLDKATLDSLGQAKRVEVAKENTTIIDGYGQASDIQNRVKIICAQIEESTSDYDREKLQERKAKLAGGVALIRVGAATELAMKEKKARVEDALHATRAAVEEGVVAGGGVALLRAKQAIESGANSDQNAGIRIVLRAMEEPLRQIVYNSGEEPSVIIANVLEGKGNFGYNASSGDYGDMVSMGVLDPTKVTRTALQNAASIAGLMLTTECMVAELPDEKASAAA................ 533
47 0.000e+00gi|674967617|dbj|GAK76327.1| heat shock protein 60 family chaperone GroEL [Nonlabens ulvanivorans]  clstr ali  67  12MAKEIKFDLEARDGIKRGVDALANAVKVTLGPKGRNVIIGKSFGAPVVTKDGVSVAKEIELVDELENMGAQMVKEVASRTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVEAITADLDKQSKKVGDSSEIKQVASISANNDDVVGDLIAKAFGKVGKEGVITVEEAKGTETYVDVVEGMQFDRGYLSPYFVTNSEKMTTELDNPYILLFDKKISTMKELMPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENTTLEMLGTAEKVDINKDNTTVVNGSGKAADIKSRVGQIKSQIENTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKAVLTKANNSDEETGISIVARAIEAPLRTIVENAGGEGSVVISKILESKGSQGYDAKNDTYVDMLKAGIIDPKKVTRVALENAASVSGMILTTECALVEIKEEN..................... 539
48 0.000e+00gi|949059482|gb|KRO57836.1| molecular chaperone GroEL [Cryomorphaceae bacterium BACL7 MAG-120910-bin2]  clstr ali  63  3.AKDIKFNVSARDGLRAGVDALANAVKVTLGPKGRNVIIERSFGPPIVTKDGVTVAKEIQLEDRIQNLGAQMVKEVASKTADVAGDGTTTATVLAQAIVNHGHRNVAAGANPMDLKRGIDKAVTAIVSELKAMAHEVGDNNQIEQVASISANNDPAIGALIAEAMEKVKKEGVITVEEAKGTETYVDVVEGMQFDRGYLSAYFVTNTEKMVADVEHPFILIYDKKISTMKELLPILEPVAQTGKPLVIIAEDVDGEALGTLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFKLENATLDMLGTAEKVSIDKDNTVIVNGAGSAEAIAARVGQIKSQIETTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVEDALAATRAAIEEGIVPGGGVALVRASHVLEEGANIDETTGIKIIARAIEEPLRQIVENAGLEGSVIVAKVKEGKDDFGFNAKTDEYCSMYEAGIIDPTKVTRVALENAASVASLLLTTEVTIVEIPKKDSSA.................. 532
49 0.000e+00gi|547375891|ref|WP_022064196.1| molecular chaperone GroEL [Alistipes inops]  clstr ali  63  1MAKEIKYNAEARELLKEGVDALADAVKVTLGPKGRNVIIDRKFGTPHITKDGVTVAKEVELEEPFANMGAQIVKEVASKTNDDAGDGTTTATVLAQSIIGVGIKNVTAGANPMDLKRGIDKAVAAVVENLRKQSQKVGDHEKIEQVATISANNDNTIGSLIAEAMSKVNKEGVITVEEAKGTETTVEVVEGMQFDRGYISAYFVTDTEKMEAQLDKPLILITDKKISTMKEIMGVLEPVAQNGRALVIIAEDVDGEALSSLVVNKLRGTLKIAAVKAPGFGDRRKEMLEDIATLTGGTYITEDKGYRLEDVKLEMLGTADKVTINKENTTIVDGAGRKDAIKARVNQIRKQIETTTSDYDREKLQERLAKLAGGVAVLYVGAATEVEMKEKKDRVEDALAATRAAVEEGIIPGGGVAYIRAISALDKGENDDETTGIAIVKRAIEEPLRQIVANAGGEGSVVVNKVREGKGAFGYNARSDRYEDMLEAGILDPTKVARVALENAASIASMFLTTECVLAEKKEPVPPMP................. 532
50 0.000e+00gi|524261509|emb|CDA25191.1| 60 kDa chaperonin [Roseburia sp. CAG:197]  clstr ali  60  1MAKEIKYGSEARAALGAGVDKLANTVRVTIGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLTQAMVQEGMKNLEAGANPIVLRRGMKKATDAAVAALKEMSQKVKGKEQIAKVAAISA-GDEAVGNLVADAMEKVTNDGVITIEESKTMETELDLVEGMQFDRGYLSAYMCTDMDKMEAVLDDPYILITDKKISNIQEILPLLEQIVQSGARLLIIAEDIEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKAMLEDIAILTGGQVISSDLGLDLKDTTMDMLGRAKSVKVQKENTVIVDGAGDKDAIQGRINQIRGQIDETTSEFDKEKLQERLAKMAGGVAVIRVGAATETEMKEAKLRMEDALNATRAAVEEGIIAGGGSAYIHASKKVAETLEGDEKTGAKVILKALEAPLFFIAANAGLEGAVIINKVKESKPGIGFNAATEEYVDMVESGILDPVKVTRSALQNATSVASTLLTTESAVANIKED...................... 526
51 0.000e+00gi|498306394|ref|WP_010620550.1| molecular chaperone GroEL [Lactobacillus malefermentans]  clstr ali  56  1MAKEIKFSEDARSAMLRGVDQLANTVKTTIGPKGRNVVLEQSYGNPTITNDGVTIAKAVELKDHFENLGAKLVAEVASKTNDIAGDGTTTATVLTQAIVTEGMKNVTAGANPVGIRRGIEKATVEAVAALHKMSHKVTTKDDIAQIASISSSN-EEVGKLIADAMDKVGNDGVITIEESRGVDTSLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIGNIQDILPLLQSVVEQSRSLLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKAQLQDIAVLTGGTVITDDLGLNLKDATLDQLGQANKVNVTKDTTTVVEGAGDKATISERVTEIKQQIDQTTSDFDRDKLKERLAKLSGGVAVIRVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALINVIDDVASEATGDEATGVDIVRRALEEPVRQIAENAGIEGSIIVEHLKSLEPGTGYNAATGEYVDMVKAGIVDPTKVTRSALQNAASVSALLLTTEAVVADEPKDDSAAPAAPA-----QPGMGGMM 541
52 0.000e+00gi|504859184|ref|WP_015046286.1| molecular chaperone GroEL [Simiduia agarivorans]  clstr ali  60  3.AKAILFSKDARERMLTGVNILADAVKATLGPKGRNVILDKSYGAPRVTKDGVSVAKEITLADKFENMGAQMVKEVASKTADIAGDGTTTATVLAQALVREGHKAIASGINPMDLKRGIDAAVAAAIEHLKPVSKPCNDTKSIRQVATVSANWNEDIGEILAQAMDKVGRDGVITVEEGKSLQNELDVVEGMQFDRGYLSPYFITNQDKMQVELDNPYLLLVDKKVSNIRELLPVLEAVAKAGRPLFLIAEDVEGEALATLVVNNLRGILKVAAVKAPGFGDRRKEMLQDIATLTGATVIAEEVGLSLEKTELAQLGSAKRVVISKDNTTVVDGAGDKQAIEARVNQIKSEIDVTSSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKDLVDDALHATRAAVEEGIVPGGGVALVRAAEAVRKGANEDQQLGINIALRAMEEPFRQIVSNAGVEPSVVLEKVRNQDATYGYNAQTEAYGDMLEMGIIDPAKVTRTALTNAGSIAGLMLTTEVMVTDKPSDTKAAQAPMP............. 539
53 0.000e+00gi|759619531|ref|WP_043337600.1| molecular chaperone GroEL [Belnapia moabensis]  clstr ali  62  3.AKDVKFGANARDRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVASVVAELEAKTKKISTSAEVAQVGSISANGETEIGEMIAQAMEKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNAEKMIVEMENPYLLIFEKKLSQLQPMLPLLEAVVQSGRPLIIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGEVISEDLGIKLENVTLAQLGRAKMVRIEKENTTIVDGAGEKSAITGRVEQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVQEGIVPGGGVALLRASTNLGKGLNNDEQVGIEIVRRAIQAPAKQIAENAGKDGAVVAGEVLRTDTYYGYDAQKDEYKDLVAAGIIDPTKVVRTALQDAASVASLLITTEAMVAERPERK..................... 529
54 0.000e+00gi|501422263|ref|WP_012446933.1| molecular chaperone GroEL [Natranaerobius thermophilus]  clstr ali  56  1MAKDIKFREDARARLEQGVNKLADTLKVTLGPKGRNVVLDKKFGSPQITNDGVTIARDIDLEDNYENMGAQLVKEVATQTNDVAGDGTTTATILAQAMVNEGIKNVTAGANPMIIRKGIQKAVDRAVEELQKNAVSVEDKESISQVASISAN-DEEVGKLIAEAMEKVGKDGVITVEESKSFKTDLNVVEGMQFDRGYVSPYMVTDNEKMEAHLEEPYILITDKKIGNIQEILPVLEKIVEQGKEVLLIAEDIEGEALATLVVNKLRGTFTCVGVKAPGFGDRRKAMLEDIAVLTGGQVISEDVGLELKNADISMLGRARQVTITKDDTTIVDGYGNEEDIQKRITQLRTQIEETTSDFDREKLEERLAKLAGGVAVVEVGAATETEMKEKKLRIEDALNSTRAAVEEGIVAGGGTALIDVLPSLEEQADGDESTGVSIVRRALEEPVRQLAHNSGAEGSIVAEQVKQKGTNIGFNALENDYTNMLDAGVVDPKKVTRSALENAGSIAAMFLTTEAVVADLPDEDD.................... 526
55 0.000e+00gi|516541328|ref|WP_017928953.1| molecular chaperone GroEL [Loktanella hongkongensis]  clstr ali  60  1MAKDVKFDTDARNRMLKGVNTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKDGLKSVAAGMNPMDLKRGIDLATAKVVEAIKAAARPVNDSDEVAQVGTISANGEASIGRQIADAMQKVGNEGVITVEENKGLETETEVVEGMQFDRGYLSPYFATNHDKMVAELEDCMILLHEKKLSSLQSMVPLLEQVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQVISEDLGMKLENVTMDMLGTAKKVTITKDATTIVDGAGDKAEIEARVAQIRTQIEDTSSDYDKEKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALVQAGKSLDVGENSDQNAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESTDTFGFNAQTEEYGDMFKFGVIDPAKVTRTALEDAASVAGLLITTEAMIADKPKK...................... 528
56 0.000e+00gi|406878344|gb|EKD27272.1| hypothetical protein ACD_79C00776G0006 [uncultured bacterium]  clstr ali  62  1MAKQLKYNEEASRAILAGVEKLARAVKVTLGPKGRNVVLDKKFGSPTITKDGVSVAKEIELEDPFENMGAQMVKEVASKTSDIAGDGTTTATILAEAIYKEGLKNVTAGINPMSLKRGIDKATEEVVKKLAELAQTVKDQKEIMQVATISANGDSEIGIRISNAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYLSPYFMTNADTKEAILEDAFILINEKKISSLKDLVPVLEKVAQSGRPLLIIAEDLEGEALATLVVNKIRGTLKVAAVKAPGFGDRRKAMLEDIAILTNGKCITEDLGIKLENIEIEDLGVAKKIVINKDNTTIVEGSGSKEEIQARIKQIRDEIQSSTSDYDKEKLQERLAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGIIVGGGVALIRCLSVLDKLKVEEEQIGVEIVKRAISVPLRMIASNAGLDGSLVVEKVKNEKGNFGLNAQTGEYCDLMKAGIIDPKKVTRCALQNAVSIAGLLLTTECMVTDIPEKE..................... 527
57 0.000e+00gi|497161069|ref|WP_009491988.1| molecular chaperone GroEL [Catellicoccus marimammalium]  clstr ali  58  1MAKEIKYNNDARSKLVEGVNKLANTVKVTLGPKGRNVVLEKSFGTPLITNDGVSIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVLEGIKNVTAGANPVGIRRGIEKATKSAVDALHTMSKEVSSKEEIAQVAAISS-GHEEVGELIATAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNEKMEAELDKPYILITDKKVSNIQDLMPVLQEIIKANRPLLIIADDVDGEALTTLLVNKLRGTLNVCAVKAPGFGDRRKEMLRDIAILTGGQVISEDLGRELASTTLADLGQANKVIVDKDSTVIVEGAGNKEEIKERIELIRSQIGETNSEFDRDKLKERLAKLSGGVAVIKVGAATETVLKELKLRIEDALNATRAAVEEGIVSGGGVALIQATKEVAKETEGDERTGVEIVLRALEEPIRQIAMNAGLEGAVIVEKLKHVDEGIGFNAATGEWVNMIESGIVDPTKVTRSALQNAASVAALILTTEAVVADLPKTDN--------GMTNDPNMGGMM 540
58 0.000e+00gi|973100042|gb|KUK58463.1| 60 kDa chaperonin [Bacteroidetes bacterium 38_7]  clstr ali  63  3.AKEIVYGFEAREALKRGVNALADAVKVTLGPKGRNVVLEKSFGAPVITKDGVTVAKEIELPDKVENMGAQMVKEVASKTNENAGDGTTTATLLAQAIYVNGLKNVTAGSNPMDIKRGIDKAVAEVIKSLQRQTRQIGDSEKIEQVAAVSANNDLSIGKLIAEAMSKVGKEGVITIEEAKGIETTVKVVEGMQFDRGYISPYFVTNTEKMEVDYENPWILIYDKKISAMKDFLPILEKVIQTGRPLLVIAEDLEGEALATLVVNRLRGTLKVVAVKAPGFGDRRKEMLEDIAILTGGTVISEEKGYKLEDADLSYLGQAARISIDKDNTTIVSGAGEKKQIEARINQIKAQIKTTTSDYDKEKLQERLAKLAGGVAVIQVGAASEVEMKERKDRFDDALHATRAAIEEGIVSGGGVAFIRAIEDIRKGENEDENVGIKIIIRALEEPLRQIIENAGLEGSVVVQKVRDGKNDFGYNVRTEQYENLMETGVIDPTKVARIALQNAASIAGMLLTTESVVSEIKEEKPA................... 531
59 0.000e+00JGI.Meta 7058189509 SRS049959_WUGC_scaffold_21293__gene_40460 chaperonin groL [Human Stool microbiome from visit number 1 of subject 7657016  ali  58  3.AKKVLFGNDATTKMVRGINILADAVKVTLGPKGRNVVLERSFGGPLITKDGVTVAKEIELKDKFENMGAQMVREVASKTNDNAGDGTTTATVLAQAIVGEGMKYVASGMNPMDLKRGIDKAVDAAIVELKKISKPVTTTKEVAQVGTISANADKEIGDIIAKAMEKVGKEGVITIEDGKSLNNELEIVEGMQFDRGFLSPYFINTPERQTAVLDKPFILLHDKKISNIRELLPVLELVAKAGRPLLIIAEDVDGEALATLVVNSLRGILKVVAVKAPGFGDRRKAMLEDIAVLTGATVISSDLGLSLDKTTLEQLGSAKRVEVTKENTTVIDGAGNKDAIADRVKSIRQQIETTTSDYDREKLQERVAKLAGGVALVKVGAATEVEMKEKKMRVEDALHATRAAVEEGVVAGGGTALIRTKQAIAKGDNDEQNAGIKIVLRAMEEPMRQIVANAGEEPSVIVNAVSQEKGNYGYNAQTGAFGDMIEMGVLDPAKVTRTALQNAASVAGLILTTDCMVGEIPEDK..................... 528
60 0.000e+00JGI.Meta 7001409248 SRS053214_LANL_scaffold_26371__gene_70494 hypothetical protein [Human Stool microbiome from visit number 2 of subject 15  ali  58  1MAKQIKYGQDARHALESGINQLANTVKITLGPKGRNVVLDKKFGAPLITNDGVTIAKEIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQALVREGLKNVAAGANPMIVRKGIQKAVDAAVEKLLSTAKKVQGKEDIARVASVSAAN-EEIGQLIAEAMEKVTADGVITVEESKTAETYSEIVEGMQFDRGYITPYMVTDTEKMEAVLDDPYILITDKKISNIQEILPLLEQVMQAGRKMVIIAEDVEGEALSTLIVNKLRGTFVCVPVKAPGFGDRRKEMLQDIAILTGGQVISEELGFDLKDTQISQLGTAKQIKIQKELTIIVDGAGDKNAIADRVAQIRRELEASTSEFDKEKLQERLAKLAGGVAVIKVGAATETEMKEMKLRIEDALAATKAAVEEGIVAGGGTSYIDVIPALLEKTEGDEKTGVQIVLKALEEPAWQIAKNAGLEGSVIVDKVKSCETGKGFNALVEEYVDMISAGIVDPVKVTRSALQNAASVASMVLTTESLVTDLPEPAAPAAPMD-PGMGM........ 539
61 0.000e+00JGI.Meta 7022255409 SRS023829_Baylor_scaffold_16345__gene_24606 hypothetical protein [Human Stool microbiome from visit number 2 of subject  ali  61  1MAKQIKYGVDARKALEAGVNQLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELADPFENMGAQLIKEVASKTNDVAGDGTTTATVLAQAMVNEGMKNLAAGANPIILRKGMKKATDAAVEAIKAMSKPVGGKAQIARVAAISA-SDDEVGTMVADAMEKVSKDGVITIEESKTMKTELDLVEGMQFDRGYLSAYMCTDMDKMEANLDDPYVLITDKKISNIQDLLPLLEQIVKMGARLLIIAEDVEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKEMLQDIAILTGGTVISEEVGLDLKDATLDQLGRAKSVKVQKENTIIVDGEGDKEAIAARVAQIRKQIGETTSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRMEDALNATRAAVEEGIIAGGGSAYAHAVQKVVDGLEGDEKTGAKIILKALEAPLFHIVSNAGLEGAVVVNKVKESEVGCGFDAYNEKFVDMIEAGILDPVKVTRSALQNATSVASTLLTTESVVAAIKE--PAPAAPAAPDMGGM....... 539
62 0.000e+00gi|655969657|ref|WP_029012249.1| molecular chaperone GroEL [Niveispirillum irakense]  clstr ali  62  3.AKEVKFGSDARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVKEVAQKTADLAGDGTTTATVLAQAIVREGAKAIAAGMNPMDVKRGVDLAVATVVADIQARSRKVTTNDEIAQVGTISANGEAFIGAKIAEAMARVGNEGVITVEESKSLETELDVVEGMQFDRGYLSPYFVTNADKMVADLESPYILLFEKKLSGLQAMLPVLEAVVQSSRPLVIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDMAILTGGQVISEDLGIKLENVTLDMLGRAKKVTISKDNTTIVDGEGAKADIEARIAQIKAQIEETTSDYDREKLQERLAKLAGGVAVLRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVAGGGAALLYATKALEKAADADQKFGIDIVRKALQAPVRQIAQNAGFDGSVIVGKLLEADTNHGFNAQTGEYGDMFKFGVIDPTKVVRAALQDAASIAGLLITTEAMIGEKPQ....................... 527
63 0.000e+00gi|515408953|ref|WP_016897998.1| molecular chaperone GroEL [Aerococcus viridans]  clstr ali  57  1MAKDIKFSEDARQSMVRGIDILADTVKVTLGPKGRNVVLDQSYGSPLITNDGVTIAKEIELEDKFEDMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVTEGMKNVTAGANPVGVRRGIDKAIRVASDRLSEISVPVDSKGAIANVASISS-GDSEVGDLIAEAMEKVGQDGVITIEESQSIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILLTDKKISNIQDILPVLEQVVQEGRALLLVADDIDGEALPTLVLNKIRGTFNVVGVKAPAFGDRRKAMLEDLSILTGGQVITEDLGLELKDTTIDQLGSANRVVITKDETTIVEGAGDKEQLAQRVAQIRSQIEETTSEYDREKLLERLAKLAGGVAVVKVGAATESELKERKLRIEDALNATRAAVDQGIVAGGGTAFINAKKAVAELAEGDEQTGAQIVLRALEAPVRQIAENAGLEGSVIVEKLKEQTEGVGFNAATSEWVNMIEEGIVDPTKVSRSALQNAGSVAGLILSTEAAVASQPQPEPQPAMDPSAGM.......... 539
64 0.000e+00gi|921144297|dbj|BAS27383.1| molecular chaperone GroEL [Limnochorda pilosa]  clstr ali  59  3.AKQLAFDVDARKALERGVNVVANAVKVTLGPKGRNVVLEKKYGSPTITKDGVTVAKEIELKDPYENMGAQLCKEVASKTNDVAGDGTTTATVLAQAIVLEGLKNVAAGANPMIVRKGIEKAVHTAAEEIKKLAIPVEGKQDIAHVAAI-AGNDDEIGDLIAEAMDKVGKDGVITVEEAKGTTTTVEVVEGMEFDKGYISPYFVTNSETMEAELEDPFLLIHEKKISNVHDLLPVLEKVVQAGKPLVIIAEDVEGEALATLVVNKIRGTLNVAAVKAPGFGDRRKAMLQDIAILTGGTFISEDLGHKLENVTLDMLGQARRVRITKDKTTIVEGKGDTSAVKGRIEQIKREIEETDSDYDREKLEERLAKLAGGVAVIQVGAATEVELKEKKHRIEDAVHATRAAVEEGVVAGGGTSYVNILPALEKQLEGDEQVGVNIVKRALTEPLRQIANNAGVEGSVIVEQVRREKPGMGFNAVTEKIEEMVKAGIVDPAKVTRTALENAASIAGMVLTTEAVISEIPEKEKTPPMPAGGG--DMD...... 539
65 0.000e+00gi|503963828|ref|WP_014197822.1| molecular chaperone GroEL [Azospirillum brasilense]  clstr ali  59  3.AKDVRFSTDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRISKDGVTVAKEIELADRFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGVKAVAAGINPMDLKRGIDVAVNTAIDDVRRRSRKIATSDEIAQVGTISANGDREIGEMIARAMEKVGNEGVITVEEAKSLDTELDVVEGMQFDRGYTSPYFITNAEKMIVEFEDLYILIYEKKLASLQPLLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIATVTGGQLISEDLGIKLENITLDVLGRARRVRVDRESTTIVDGAGRKEEIQARVQQIRTQIEETTSDYDREKLQERLAKLAGGVAVIRVGGVTEVEVKERRDRVDDAMHATKAAVEEGIVAGGGVALLYATRVLDKPENDEQRMGLDIVRRALQAPVRQIAENAGTDGSIVIGKLLDQKPNFGYDAQAGKYCDLVKAGIIDPTKVVRSALQDAASVAGLLITAEAMVAERPEKKE.................... 530
66 0.000e+00gi|515479631|ref|WP_016912899.1| molecular chaperone GroEL [Staphylococcus vitulinus]  clstr ali  57  1MAKELKFSEDARRSMLAGVDKLANAVKVTLGPKGRNVVLDKKFTSPLITNDGVTIAKEIELEDAYENMGAKLVAEVANQTNDVAGDGTTTATVLAQAMIQEGLKNVTSGANPVGIREGIDKAVKVALEELQRISQPVEKKEEIAQVGSISA-ADEEIGKFISEAMEKVGNDGVITIEESKGFSTELEVVEGMQFDRGYTSPYMVTDSDKMTAELENPYILITDKKISSFQDILPILEKILQTNRPILIVADDVDGDALTNLVLNRLRGTFTAVAVKAPGFGDRRKAMLDDLAILTGGQVITDDLGLDLKEASLDMLGEAGKVQVTKDDTTIVEGQGDSVNIDARVGQIKVQIEETTSEFDRTKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNKVAEDAKGDVQTGVNIVLKALEAPLRQIVENAGLEGSIIVEKLKSAEEGIGFNAATDEWVNMLDAGIVDPTKVTRSALQNAASVAAMFLTTEAVVAEIPQDEPAAP................. 529
67 0.000e+00gi|1002743907|gb|AMN47821.1| molecular chaperone GroEL [Steroidobacter denitrificans]  clstr ali  61  3.AKEVRFSDDARARMLKGVNVLANAVKTTLGPKGRNAVLEKSFGAPTITKDGVSVAKEIELKDKFENMGAQMVKEVASNTSDEAGDGTTTATVLAQAIVREGLKAVAAGANPMDLKRGIDTAVATAVEELKRLSKPCKDQKAIAQVGTISANSDESIGQTIADAMEKVGKEGVITVEEGSGLQNELDVVEGMQFDRGYLSPYFINNQQNQTAELDNPFILLYEKKVSNVREMLPLLEGIAKAGRPLLVIAEDVEGEALATLVVNTIRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGVVISDEVGLSLEKATLNDLGEAKKIVVEKENTTLIDGKGKNADIKARVEQIRKQAEEATSDYDKEKLQERVAKLSGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRAQKAIEKLENEDQQFGIRILTRSVEEPLRQIVTNAGEDAAVVLAKVKEGKGTFGYNAATGGYGDMLDLGILDPTKVTRLALQNAASVAGLLLTTEVMIAEAPKEDDHA.................. 531
68 0.000e+00gi|931368214|gb|KPJ59555.1| molecular chaperone GroEL [Latescibacteria bacterium DG_63]  clstr ali  62  1MAKILEFDTDARALLRNGVNKLANVVKVTLGPKGRNVVLDKKFGMPAVTNDGVTIAKEIELEDPFENMGAQLLREVATKTHDDAGDGTTTATVLAQSIMREGFKNVAAGANPMSLKRGIDKGVEAVVKSLGKLSKSVGQRDEVEQVASISANNDREIGKLIADAMEKVGKDGVITVEEAKSIETTLDLVEGLQFDRGYISPYFMTDAERMEVAFEDPAILLCEKKISSIRELIPVLEKVAQLGKPLLIIAEDVEGEALATLVVNKLRGTLSSVAVKAPGYGDRRKEMLEDIAILSGGRVISEEAGLKLENATTGDLGTAKRITVDKENTTIVGGSGRTSDVEGRIAQIKALIETSTSEYDKEKLQERLAKLSGGVAVIAVGAATEVELKEKKARVEDALAATRSALEEGIVPGGGVAFLRAVEAVKLKLEGEEEIGAHVVARALEAPARQIASNAGQEGSIVVEKIKALEGGYGFNADTGEFEDLVKSGIVDPAKVARVALQNAASIGGLLLTTEALVAESPEEEKEPPVPPGAGMPGM....... 541
69 0.000e+00gi|653225862|ref|WP_027438377.1| molecular chaperone GroEL [Lachnospira multipara]  clstr ali  61  1MAKEIKYGIEARKALEEGVNKLANTVKVTIGPKGRNVVLDKSYGAPLITNDGVTIAKEIELEDSFENMGAQLVKEVASKTNDVAGDGTTTATVLAQAMINEGMKNLAAGANPIVLRKGMRKATDTAVEAIAKMSQKVTGKDQIAKVASISA-ADEEVGQMVADAMEKVSNDGVITIEESKTMQTELDLVEGMQFDRGYVSAYMCTDMDKMEANLDDPYILITDKKISNIQDILPILEQIVQSGSRLLIIAEDIEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKEMLKDIAILTGGQVVSEELGLELKDTTMEMLGRAKSVKVAKENTVIVDGEGNKEEIDARVAQIRAQLEETTSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRMEDALNATRAAVEEGVVSGGGSAYIHASKEVAKTLSGDEKIGAQIILKALEAPLFQIAYNAGLEGAVIINKVRESEVGTGFDAYKEEYVNMIDAGILDPTKVERSALQNACSVASTLLTTESAVANIKEE...................... 526
70 0.000e+00gi|1011118654|ref|WP_062040515.1| molecular chaperone GroEL [Bacteroidales bacterium TBC1]  clstr ali  62  1MAKQIIFNIEAREELKKGVDALANAVKVTLGPKGRNVIIDKAYGAPVVTKDGVTVAKEVELKDGIQNMGAQMVKEVASKTADVAGDGTTTATVLAQSIVTTGMKNVTAGANPMDLKRGVDKAVVKVVEFLKTQSIRIEGSEKITQVATISANNDSFIGEKIAEAMNKVKKEGVITIEEAKGIETTVKVVEGMQFDRGYISPYFITDTEKMEAVYENPFILIYDKKISVMKDFLPILEKTVQTGRPLLIIAEDVDGEALATLVVNKIRGSLKIAAVKAPGFGDRRKEMLEDIAVLTGGTVISEEKGYRLEDADLSYLGQADKITVDKENTTIVSGRGDVDNIKARVAMIKAQIETTTSDYDREKLQERLAKLAGGVAVIYVGAASEVEMKEKKDRFDDALHATRAAIEEGIIPGGGVAYIRAIPMLDKGENEDEEIGIAIVKRALEEPLRQIVENAGLEGSVIVQKVREGKDDYGFNARTEVYEKLFQAGVIDPTKVARVALENAASIAGMLLTTECVLADIKEEKEPAMPNP.............. 535
71 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  61  6MAKEIKFGADARVALEAGVNQLANTVKVTLGPKGRNVVLDKSYGAPLITNDGVTIAKEVELEDAFENMGAQLVREVATKTNDVAGDGTTTATVLAQAMINAGMKNLAAGANPIILRKGMQKATDEAVKAISEMSSKVTGKEQIAKVAAISA-GDEEVGEMVADAMEKVSNDGVITIEESKTMKTELDLVEGMQFDRGYISAYMATDMEKMEANLDNPYILITDKKISNIQEILPILEQIVQSGSKLLIIAEDVEGEALTTLIVNKLRGTFNVVAVKTPGYGDRRKEMLKDIAILTGGQVISEELGLSLAETKIEDLGRAKSVKVQKENTIIVDGEGNSEEIQGRIAQIKAQLAETTSDFDREKLQERLAKMAGGVAVIRVGAATEPEMQEKKLRMEDALNATRAAVEEGIISGGGSAYIHASKKVAKTLEGDEKTGGQIILKALEAPLFTIAQNAGLEGSVIVNKVRESEPGNGFDAYNEKYVQMVDAGILDPAKVTRSALQNATSVASTLLTTESVVANIKED--APAMPANPGMGMM....... 544
72 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  60  1MSKLIKSGEEARKALEAGVNVLADTVKVTLGPKGRNVVLDKKFGAPLITNDGVTIAKEIELDDPFENMGAQLVREVSTKTNDVAGDGTTTATLLAQAMVREGLKNLAAGANPVVMKKGMAKAVETAVSAIKANSQKVNGTDDIARVGTVSS-GDEFIGKLIAEAMEKVSADGVITIEESKTAETYSEVVEGMMFDRGYITPYMVTDTEKMEAVIDDAYLLITDKKISVISDILPILEQLVQSGKKLVIIAEDVEGEALSTLIVNRLRGTLNVVCVKAPGFGDRRKEMLQDIAILTGGQVISEELGYELKSATIDMLGRARQIKVTKENTTIVDGAGDKQAIADRVAQIRAQIGVTTSEYDKEKLQERLAKLAGGVAVIKVGAATETEMKEKKLRIEDALNATRAAVEEGIVAGGGTAYVNAVPAVEKEVEGDEKTGVQIIVKALQEPIRQIAANAGIDGSVVLEKIKSGKVGYGFDAYKEVYCDMISAGIVDPAKVTRSALENAASVSSMVLTTEALVADKPEXXXXXXXXXX--MGDMGGM.... 543
73 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  62  1MAKEIKFNIKAREELKAGVDALADAVKVTLGPKGRNVIIEKKFGAPHITKDGVTVAREIELENPFENMGAQLVKEVASKTGDQAGDGTTTATVLAQAIVREGLRNVAAGANPMDLKRGIDKAVSKVVEGIKAQAEEVGDDDKIENVARVSANNDEEIGRLIAEAMKKVKKEGVITVEEAKGTDTTVDVVEGMQFDRGYISPYFVTNTEKMECEMDNPYILLYDKKVSNLKDILPILESTAQSGRGLLIIAEDVDNEALATLVVNRLRGSLKICAVKAPGFGDRRKEMLEDIAVLTGGNVISEVKGMRLDQATIADLGTAEKVTVDKDNTTIINGAGDKQAIADRVAQIKVQIENTTSTYDKEKLTERLAKLAGGVAVLYIGAPSEVEMKEKKDRVDDALSATRAAVEEGIVPGGGTAYIRCLPELAKGDNADEATGIAIIRRAIEEPLRQIVENAGVEGAVVVQRVKEGSGDFGYNARTESYENFFATGVIDPAKVTRVALENAASIAGMFLTTECVIADKKEEN..................... 528
74 0.000e+00gi|780104271|ref|WP_045474258.1| molecular chaperone GroEL [Thioploca ingrica]  clstr ali  60  3.AKEVRFSDEARQQMMRGVNILANAVKITLGPKGRNVVLEKSFGSPTVTKDGVSVAKEIELENKFENMGAQMVKEVASRTSDTAGDGTTTATVLAQSILTEGMKSVAAGMNPMDLKRGIDKAVIVAVEELKKLSKPCTDDKAIAQVGTISANADEVIGDIIAKAMNKVGKEGVITVEEGSGLDNELDVVEGMQFDRGYLSPYFVNNQQTMTAELENPLILLHDKKISNIREMLPILEGAAKAGRSLLIVAEDVEGEALATLVVNTIRGVVKVAAVKAPGFGDRRKAMLQDIAILSGGTVISEEVGLSLEKAGLDDLGHAKRITISKENTTIIDGAGKTSEIEARVKQIRAQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALKAIQKGVNRDQDTGIKIALRAMEEPLRQIVANSGQEPSVILNKVAEGQGNFGYNAATEEFGDMVAMGILDPTKVTRSALQNAASIAGLMITTEAMVAELPKREEHSHGPAGGGMDMM....... 542
75 0.000e+00gi|980263124|emb|CUU37036.1| chaperonin GroEL [Armatimonadetes bacterium DC]  clstr ali  56  3.AKMLKFNEEARRALERGVNKVADAVKVTLGPRGRNVVLDRKWGNPIITKDGVTVAKEIELSDPWENMGAQLCREVASKTNDVAGDGTTTATVLAQALVREGMRYVAAGGNPIALKRGIDLAVQKAVEAIKAHAVPISDQSQVEYVATI-AGNDPEIGKIIAEAMDKVGKDGVITIEESKGTQTTLEVVEGMQFDRGYISPYFITDPERMEAVLENPLILIHEKKISSAQDLLPVLERVAQARRALLIIAEDVDGDALATLVVNKLRGVLQVAAVKAPGFGERRKAMLEDIAILTGGRFISEDLGIKLENVTLDMLGQAKKVVVTKEDTTIIEGAGSQEAVLGRINQIKRLIETTESSYDREKLQERLAKLSGGVAVIKVGAATETELKEKKHRFEDALSATRAAVEEGIVPGGGKIFLLAQAALDLGNDEDERTGVKIVQRALEEPLRQIAENAGLEGSVIVEKVKSLGKEEGLDARTGEFVNLMQAGIIDPAKVSRAALENAASIAGLVLTTEAMVAEKPEKKPETTPGGGNDFDD........ 539
76 0.000e+00gi|931485169|gb|KPK65911.1| molecular chaperone GroEL [Gemmatimonas sp. SG8_38_2]  clstr ali  62  4.AKELHFDIDARARLKRGVDQLADAVKVTLGPKGRNVVLDKKFGSPTITKDGVTVAKEIELPDAVENMAAQMVKEVATKTSDVAGDGTTTATILAQAIFREGLKSVTAGVNPMAIKRGIDKAVEGVVADLKKQSVPTVGKKEIAQVGAISANTDQEIGDLIADAMDKVGKDGVITVEEAKGLATELETVDGMQFDRGYLSPYFVTDPEKMETVLEDGYVLIHDKKISVMKDLLPILEKVAQAGKPLLLIAEDIDGEALATLVVNRLRGTLNVCGVKAPGFGDRRKAMLEDVATLTGGKVVSEEVGFKLEKTELSDLGRCKRIVVDKDNTTLIDGAGKGADIQGRIRELKAAIEKSTSDYDTEKLQERMAKLAGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRAQAALNKLEDPDEQVGVGIVRRALEEPIRIIAANAGAEGSIVVEKVRSSKEAFGYNAQTDKYEDLVAAGVIDPTKVARTALQNAASVAGLLLTTECVVVEEKENGASSAMP............... 536
77 0.000e+00gi|551206355|ref|WP_022834405.1| molecular chaperone GroEL [Salisaeta longa]  clstr ali  64  1MAKQIVFDAEARNALKEGVDKLARAVKVTLGPKGRNVILEKSFGAPTVTKDGVSVAKEIELNNKLQNVGAQMVKEVASKTSDVAGDGTTTATVLAQAIINQGLKSVTAGANPMDIKRGIDHAVEAIVADLHNQSNNVEGKKEIAQVATISANNDDEIGDLIADAFDRVGKDGVITVEEARGIETHLDVVEGMQFDRGYLSPYFVTDSDNMEAVLEDAYVLIYDDKISNMKDLLPVLEKVSQSGQPLLIIAENIEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKAMLEDIAVLTGGTVISEEKGYRLENATLXXLGXANRVXIDXDTTTVVDGAGXXEQINARVNQIRQQIESSTSDYDREKLEERVAKLAGGVAVLKVGAATEPEMKEKKARVEDALHATRAAVAEGVLPGGGVAYLRALHTLDDLENEDQEIGISIIRRALEEPLRQIASNAGLEGSIVVQKVKDGEGDFGFNARTETYGALLEEGVLDPTKVTRSALENAGSVASLLLTTESVIAD.......................... 522
78 0.000e+00gi|505825178|ref|WP_015710555.1| molecular chaperone GroEL [Treponema azotonutricium]  clstr ali  62  1MAKQLLFNEEGRRKLLAGVEQISRAVKVTLGPKGRNVLLDKKFGAPTVTKDGVSVAKEVELADPYENMGAQLLKEVATKTNDVAGDGTTTATVLAYSLVKEGLKSVAAGMTPIELKRGIDKAVEIAVAEIKKNAKEIKDKEEISHVASVSANNDAEIGNTIAEAMDKVGKDGVITVEESKTMDTTIEFVEGMQFDRGYISAYFVTDRDTMSTVYEDVYILIHDKKVSSMKDMLPLLEKVAQSGKPLLIIAEDVDGEALSTLVLNSLRGTLKTVAVKAPGFGDRRKAMLEDIAILTGGEVVTEELGIKLENTDISQLGKAKTVKIDKDNTTIINGAGKAKDIQDRIAQIKAQIEDTSSDYDREKLQERLAKLAGGVAVINVGAATEVELKEKKHRVEDALSATRAAIDEGIVPGGELALIQAAIALDKGLTDDEKVGFKIVKRALEEPIRQIAENAGVDGAVIAERAKTEKKGIGFDAAKMEWVDMVKAGIIDPAKVTRSALQNAASIASLLLTTECAITDIPEKKEAP.................. 532
79 0.000e+00gi|516741721|ref|WP_018076760.1| molecular chaperone GroEL [Thiobacillus denitrificans]  clstr ali  61  3.AKDVRFGDSARHRMVAGVNILADAVKVTLGPKGRNVVLDRSYGAPTVTKDGVSVAKEIELKDKLENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVNEGMKFVAAGMNPMDLKRGIDKAVTAITAELKKISVPCTSSKEIAQVGSISANSDSSIGDIIAAAMDKVGKEGVITVEDSSGLENELEVVEGMQFDRGYLSPYFINNPDKQMAIMEDPFILLYDKKISNIRDLLPILEQVAKAGKQLMIVAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDLAILTGGTVIAEEVGLSLEKAALEDLGRAKRIEIGKENTTLIDGAGNADAIKNRITQINKQIDEVSSDYDKEKLQERKAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGXXXXXXXXXXXXGDNHDQDAGVKIVLRAIEEPLRQIVKNCGEESSVVVNKVLEGKGNFGYNAGNGEYGDLVAMGVLDPTKVTRTALQNAASIAGLMLTTDCMVSDLPDDKSQIGGADMG............ 537
80 0.000e+00gi|654355343|ref|WP_027847803.1| molecular chaperone GroEL [Marinospirillum minutulum]  clstr ali  59  3.AKDVRFGDDARKRMVTGVNILADAVKTTLGPKGRNVVLDKSYGSPTVTKDGVSVAREIELKDKFENMGAQMVKEVASKASDEAGDGTTTATVLAQAIVNEGFKVVTAGMNPMDLKRGIDKAVTVAVEEIKKLAKPCSDTKSIAQVGTISANGDTRIGEIIANAMERVGKEGVITVDEGRGFEDELEVVEGMQFDRGYISPYFVNNQDNMSAEMEDPYILLVDKKISNIRELLPVLEATAKSGKPLLIIAEDIEGEAMATLVVNNMRGIVKVAAAKAPGFGDRRKAMLQDIAILTNATVISEEVGLNLEEATIEHLGTAKRAVLTKESTTIIDGAGSQDDIESRVKQIRAQMEDTTSDYDREKLQERLAKLAGGVAVIRIGAASEMEMKEKKARVEDALHSTRAAVEEGVVPGGGTALIRILEAVKKGDNEDQNHGIAIALRAMEAPLRQIVTNAGEEASVVVAKVKEGTGNFGYNAQTGIYGDLVEMGVLDPAKVTRTALQSAASVGGLMITTQCMVADHPEENPAA.................. 531
81 0.000e+00gi|494896797|ref|WP_007622842.1| molecular chaperone GroEL [Paraglaciecola arctica]  clstr ali  63  3.AKEVRFSDDARSKMLAGVNVLANAVKVTLGPKGRHVVLDKSFGAPTITKDGVSVAKEIELADKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAIIVAVKELKALSVPCADNKAIAQVGTISANSDSEVGDLIAEAMDKVGKEGVITVEEGQSLQNELDVVEGMQFDRGYLSPYFMNNQENGTVELDSPYMLLVDKKITNIRELLPTLEAVAKASKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGLELEKVTLEDLGTAKRVVINKDNTTIVDGAGEEDAIKGRVAQIRAQIEESSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALVRAASKIVKGDNEDQTHGIKLALRAMEAPLRQIAANAGAEASVVTNAVKNGEGNFGYNAANDTYGDMIEMGILDPTKVVRSALQFAASIASLMITTEAMI............................ 521
82 0.000e+00gi|517424862|ref|WP_018596078.1| molecular chaperone GroEL [Blautia producta]  clstr ali  59  1MAKEIKYGAEARAALESGVNQLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELADGFENQGAQLIKEVASKTNDVAGDGTTTATVLAQAMVNEGMKNLAAGANPIILRKGMKKATEVAVDAIQKMSGKIERKDQIARVAAISA-GDDEVGEMVADAMDKVSNDGVITIEESKTMKTELDLVEGMQFDRGYISAYMATDMDKMEAVLDDPYILITDKKISNIQDLLPILEQIVKSGAKLLIIAEDIEGEALTTLIVNKLRGTFSVAAVKAPGYGDRRKEMLQDIAILTNGTVISDELGLELKDVTMDQLGRAKSVKVQKESTVIVDGEGNKEDIDARIAQIKHQITETTSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRMEDALNATRAAVEEGIIAGGGSAYIHASKEVEKELDGDEKTGARVVLKALESPLYHIAANAGLEGSVIINKVKESDMGVGFDALNEKYVDMVKEGILDPTKVTRSALQNATSVAGTLLTTEAVVSNIKEETPAMPAGGAPGMGMM....... 541
83 0.000e+00gi|505216528|ref|WP_015403630.1| molecular chaperone GroEL [Desulfocapsa sulfexigens]  clstr ali  61  1MAKDIKYGVKARESILAGVNTLANAVKVTLGPKGRNVLIEKSFGAPTITKDGVTVAKEVEVKDKIENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGAKLVAAGGNPMEIKRGIDKSVDVVVAELKKIAKPTKEQSEIAQVGTISANSDATIGAIIAEAMDKVGKEGVITVEEAKSMDTTLDVVEGMQFDRGYLSPYFVTDADRMEVNMEDPYFLLVEKKVSNMKDLLPVLEAVAKMGRGLFIIAEDVDGEALATLVVNKLRGTLNIAAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGIKLENVTINDLGTAKRVVVDKDNTTIIDGAGDTAQLEARVKQIRTQIDASTSDYDSEKLQERLAKLIGGVAVINVGAATEIEMKEKKARVEDALNSTRAAVEEGVVPGGGIAYIRCLGALALKLEGEQDLGKKILLRALEEPVRQIASNAGCEGSVVVEHVKGLKGSNGFNAATEEYEDLIVAGVIDPAKVTRTALQNAASVSGMLLTTECVIAEHPDED..................... 527
84 0.000e+00gi|557369046|ref|WP_023391189.1| molecular chaperone GroEL [Abiotrophia defectiva]  clstr ali  58  1MAKELKFSEDARAALLRGVDILANTVKTTLGPKGRNVVLDKTFGSPLITNDGVTIAREIELEDRFENMGAQLVLEVASKTNDVAGDGTTTATVLTQAIANEGMKNVTAGANPVGIRRGIDKATKAAVEALQALSQPVLSKEAIAQVAAVSS-GDPAIGDLIADAMERVGNDGVITIEESKSIETELSVVEGMQFDRGYLSQYMVTDNEKMVAELENPVIFVTDRKITNIQDVLPLLEGIMQSGRPLLIIAEDVDGEALPTLVLNKLRGTLNVVAVKAPGFGDRRKAMLEDIAVLTGATVVSEELGFELKDANVEHLGHAGKVTVTKDSTTIVEGAGNKQAIADRIAVIRAQAEESTSSFDKEKLQERLAKLSGGVAVIKVGAATETEQKERKLRIEDALNATRAAVEEGIVPGGGTALVNVQEIVAAEAEGDEATGVKIVARALEEPVRQIAANAGKEGSVIVDTLRRSEKGVGYNAATDVFENMIEAGIVDPTKVTRSALQNAASVAALLLTTEAVVADIPKESP.................... 526
85 0.000e+00gi|504818174|ref|WP_015005276.1| MULTISPECIES: molecular chaperone GroEL [Cycloclasticus]  clstr ali  60  1MAKQVKFGDDARSLMVEGVNTLAKAVKVTLGPKGRNVVLDKGFGGPTITKDGVSVAKEIELKDKFQNMGAQMVKDVAAKTSDVAGDGTTTATVLAQAILTEGLKSVAAGMNPMDLKRGIDKAVVAAVNAIKDLSVPCADTKAIAQVGTISANSDESVGKIIAEAMDKVGKEGVITVEEGSGLENELDVVEGMEFDRGYLSPYFINNQESMSVDMEDPFILLHDKKISNIRDLLPTLEAVAKAGRPLLIIAEDIEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLEDIAILTGGTVIAEEVGLTLEKATLEDLGSAKRVTITKDSTVVVDGAGQAADIEARVAQIRSQAEEASSDYDKEKLQERMAKLAGGVAVIKVGATTEVEMKEKKARVEDALHSTRAAVEEGVVPGGGTALIRVLEAASKGLNHDQDIGIKIALRAMEAPLRQIVTNAGEEASVVLQAVKQGTGNEGYNAATGEYGDMIEMGILDPAKVTRTALQNAASIAGLMITTEAMITDEPEEAGAGAGAMP............. 535
86 0.000e+00gi|500031276|ref|WP_011711994.1| molecular chaperone GroEL [Magnetococcus marinus]  clstr ali  60  3.AKEVKFGEAARAKMLNGVNILANAVKVTLGPKGRNVVLDKSWGAPRMTKDGVSVAKEIELEDKFENMGAQMVREVSSKTADVAGDGTTTATVLAQAIIREGMKAVAAGMNPMDLKRGIDLAVEAVVVGLKGISREVANSQEIAQVGAISANSDKVVGDMIAEAMDKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTNADKMLVQMENPLILLVEKKISNLQQILQILEGAVQSSRPLMIIAEDVEGEALATLVVNKLRGGLKVCAVKAPGFGDRRKAMMEDIATLTGGVLVSEDVGVKLENVTMDMLGMAKSIVVTKEDTTIIDGAGDHEAIKARVNQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALLRAREASLQGANHDQQVGINIVTRALEEPLRIIASNAGAEGSVVVNRVVETKENFGFNAATGVYEDLVASGVIDPAKVVRHALQAAASVAGLMITTEAMVAELPKDEPAMP................. 534
87 0.000e+00gi|517815663|ref|WP_018985871.1| molecular chaperone GroEL [Methylophilus methylotrophus]  clstr ali  62  3.AKDVKFHDHARTKIVKGVNILADAVKVTLGPKGRNVVLERSFGAPVITKDGVSVAKEIELQDKLENMGAQMVKQVASKTADVAGDGTTTATVLAQAIVQEGMKSVASGMNPTDLKRGIDKAVTALVDELKSMSKAITTHKEIAQVGAISANSDHAIGQIIADAMEKVGKEGVITVEEGKSLQNELEVVEGMQFDRGYISPYFINNPDKQVAALDEPMILLYDKKISNIRDLLPTLENVAKANKPLLIIAEDVEGEALATLVVNSMRGILKVVAVKAPGFGDRRKAMLEDIAVLTGATVVSEETGMQLEKVTLEHLGHAKRVEVQKENTIIIDGAGDAAKIKARVQSIRTQIEEATSDYDKEKLQERVAKLGGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRARSRMSKGDNDDQEAGIRIVLRAIEEPLRAIVKNAGEEPSVVIAKVLEATGNTGYNAATGEYVDMVETGVVDPTKVTRTALQNAASIAGLILTTDATVAELPEEKKAPAMPEM............. 537
88 0.000e+00gi|653183930|ref|WP_027420399.1| molecular chaperone GroEL [Crocinitomix catalasitica]  clstr ali  62  1MAKEIIFNIDARDRLKKGVDALANAVKITLGPKGRNVIIDKKFGAPHITKDGVTVAKEIELSDSVENMGAQMVREVASKTADIAGDGTTTATVLAQAIITAGLKNVAAGANPMDLKRGIDKAVEKIVADLKKQSQEVSDNDKIKQIATISANNEESIGALIAQAMKVVGNSGVITVEEAKGTETEVKIVEGMQFDRGYLSPYFVTNAEKMIVEAENPYILIYDKKISNVQELLPVLEPVAQSGKSLVIIAEDIDGTALSTLVINRLKGGLKISAVKAPGFGDRRKEMLEDIAVLTGGTVISEERGFKLENATIEHLGTAEKVDIDKDSTTIVNGQGKKAQITTRINQIKSQIKATTSDYDKEKLQERLAKLSGGVAVLYVGAATEVEMKEKKDRVDDALSATRAAVEEGIVPGGGVALLRAIKALDKGANDDENTGIAIVKRAVEEPLRQIVQNAGLEGAVIVQRVLEGKDDFGYNARTNVYENLLKAGVIDPTKVTRIAIENAASISSMLLTTECVIADIPEAEPA................... 530
89 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  60  11MAKEIKFGAEARAALETGVNKLADTVRVTIGPKGRNVVLDKQFGAPLITNDGVTIAKEIELEDRFENMGAQLIKEVASKTNDVAGDGTTTATVLAQAMVHEGMKNLAAGANPIILRKGMRKATDAAVEAIKEMSQKISGKAQIANVASISA-SDEEVGQLVADAMEKVSNDGVITVEESKTMHTELDLVEGMQFDRGYISAYMSTDMEKMEANLEDPYILITDKKISNIQEVLPLLEQVVQAGAKLLIIAEDVEGEALTTLIVNKLRGTFQVVAVKAPGYGDRRKEMLQDIAILTGGQVISEELGLDLKETTMAQLGRAKSVKVAKENTVIVDGLGDKKEIADRVAQIRKQIAETKSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRLEDALAATRAAVEEGIIAGGGSAYIHASKKVAETLEGDEKTGANVILKALEAPLFHISANAGLEGSVIINKVRESEPGVGFDALNEKYVDMVGAGILDPVKVTRSALQNATSVASTLLTTESVVATIKEDAPAMPA-GAPGMGG........ 549
90 0.000e+00JGI.Meta 7018902083 SRS022609_Baylor_scaffold_76041__gene_128825 chaperonin groL [Human Stool microbiome from visit number 2 of subject 1584  ali  58  9MAKDIIYGEEARKALQAGIDTLADTVKITLGPKGRNVVLSKKYGSPLITNDGVTIAKEIELEDAFQNMGAALVKEVATKTNDAAGDGTTTATLLAQALVREGMKNIAAGANPMVVKKGMQKAVDAAVEQIKKNSQAVNGSKDIERVATVSA-GDESVGKLIAEAMEKVTADGVITLEEGKTAETYSEVVEGMQFDRGYISPYMVTDTDKMEAVIDDPYILITDKKISSIQDVLPLLEQIVQAGKKLVIIAEDVEGDALTNIILNKLRGVFVCVAVKAPGFGDRRKEMLKDIAILTGGEVITEELGLDIKETQINQLGRAKQVKVNKENTIIVDGCGDKDAIKDRVHEIKNAIENTTSEFDKEKLQERLAKLSGGVGVIKVGAATEVEMKEKKLRIEDALAATKAAVEEGIVAGGGTALINAMPAVKDTLEGDEKTGAKIVLRALEEPVRQIALNAGLEGSVIIDTIREGKVGYGFDAYTETYGDMISAGIVDPAKVTRSALQNAASVAAMVLTTESLVADKPEETPAAPAMPAGGMGGM....... 550
91 0.000e+00gi|668728439|gb|AIH07642.1| chaperonin GroL [Alteromonadaceae bacterium Bs02]  clstr ali  58  3.AKDVRFGTDARGRMLVGVNILADAVKTTLGPKGRNVVLEKSFGSPTVTKDGVSVAKEIELEDRFENMGAQMVKEVASRASDDAGDGTTTATVLAQSIVNEGLKSVAAGMNPMDLKRGIDKAVIAAVEYIKSAAQPCADSKSIAQVGTISANSDTNIGDIIAEAMEKVGKEGVITVEEGNSLENQLEVVEGMQFDRGYLSPYFITNQENMSVEHETPFILLVDKKISNIRELLPVLEAVAKSGKPLIIIAEDVEGEALATLVVNNMRGIVKVAACKAPGFGDRRKAMLQDIAILTGGTVISEEIGLDLESATLEHLGQAKRFTMTKEVSVIVDGAGVADDIKARVNQIRAQIEETNSEYDAEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRAVSAIADGDNEDQNAGIAIARRAMESPLRQIVENAGEEGSVVADKVRQGTGNFGYNAGNGTYGDMLAMGILDPAKVTRTALQAAGSIAGLMITTEAMIADKPADSGGAP................. 532
92 0.000e+00gi|495476963|ref|WP_008201650.1| molecular chaperone GroEL [Algoriphagus machipongonensis]  clstr ali  63  1MSKELFFDTDARDRLKKGVDALADAVKVTLGPKGRNVILDKKFGAPTITKDGVSVAKEIELEEPIENMGAQLVKEVASKTADNAGDGTTTATVLAQSIFNVGIKNVAAGANPMDLKRGIDKAVTAVVASLRANSKEISTSKEIAQVATVSANNDEEIGTMISNAMDKVGKDGVITVEEAKGTETEVKTVEGMQFDRGYLSPYFVTNTEKMEAELEQPYILIYDKKISSMKELLPVLEPVAQSGKPLVIISEDVDGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFKLENATTDMLGRAEKINIDKDNTTIVNGSGDATAIKGRVSEIKAQIDKTTSDYDREKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVQEGVVVGGGVALVRASEALVKGLNEDEDTGINIIRQAIESPLRTIVLNAGGEPSVVINKIRENKGNYGYNARTDKYEDLFKVGVIDPTKVTRLALENAASIAALLLTTECVVADVKEDAPA................... 529
93 0.000e+00gi|499740712|ref|WP_011421446.1| molecular chaperone GroEL [Anaeromyxobacter dehalogenans]  clstr ali  61  3.AKEIAFHQPAREAILRGVQTLAEAVAVTLGPKGRNVVIEKSYGAPTITKDGVTVAKEIELESKFENMGAQMVKEVASQTSDKAGDGTTTATVLARSIYEEGLKLVAAGHNPMDLKRGIDRAVEVVVAHLKSLSTPTKGKDDIAQVGTISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYSSPYFVTNPDRMEAALEDPYVLVTEKKITAMADLVPVLEQVARSGKPLLIIAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIATLTGGTVVAEELGIKLEQLGLKDLGRAKRITVDKDNTTIVDGEGKKADIEARIKVIRGQIEESTSEYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRSLADLQKLDQGDQRFGVQIVVKALEWPARRIAENAGWDGPVVVNKILEGKGAFGFNAATDTFEDLTKAGVIDPTKVSRTALQNAASVASLLLTTEAMVADKPKKK..................... 528
94 0.000e+00gi|500139123|ref|WP_011815126.1| molecular chaperone GroEL [Halorhodospira halophila]  clstr ali  60  3.AKEIRFSDDARQRMMSGVNQLANAVKVTLGPRGRNAVLEKSFGAPTVTKDGVSVAKEIELEDHFENMGAQMLKEVSSQTSDVAGDGTTTATVLAQAILREGMKSLAAGMSPMELKKGIEKATEAASNYLSELSKPCEDDNSIAQVGTISANSDEAVGRIIADAMGKVGKEGVITVEEGSGLDNELDVVEGMQFDRGYLSPYFVTDQQTMKAELEDAAILLHDKKISNIRDLLPLLEGVAKQNRPLLIIAEEVEGEALATLVVNNLRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISDEVGMTLENATVDDLGTAKKVQISKEETTIVGGAGRHDDIMARVEQIRAQMEESTSDYDKEKLQERVAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGTALIRALAALESGANEEQTQGIALVRRAMEEPLRQLVLNAGEDASVVVNKVREGTGNHGYNVATGEYGDLVQAGVLDPTKVTRSALQNAASVAALMLTTEAMVADLPKKDD.................... 530
95 0.000e+00gi|494957834|ref|WP_007683861.1| molecular chaperone GroEL [Sphingobium indicum]  clstr ali  59  3.AKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELKDKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGTKAVSAGMNPMDLKRGIDLAVGAVVKDLEAHARKVSANSEIAQVATISANGDEEVGRILAEAMEKVGNEGVITVEEAKSLATELETVEGMQFDRGYLSPYFVTNAEKLKVELDDPYILIHEKKLSNLQAMIPLLEQVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGNVVSEELGTKLDNVTIGMLGRAKKVIIDKDNTTVVDGAGARSDIDARVAQIRAQIETTTSDYDREKLQERVAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGILPGGGIPLLRALKALGKAANDDQQSGIDIVRRALRAPARQIADNAGEDGAFIVGKLLESEDNWGFNAATGQYEDLVGSGVIDPAKVVRTALQDAASVASLLITTEALVAEAPKDDKGAKAA----MPEM....... 539
96 0.000e+00gi|655391016|ref|WP_028794837.1| molecular chaperone GroEL [Thalassobaculum salexigens]  clstr ali  59  3.AKDVKFDVDARDRLLKGVDTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDIELKDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVREGVRAVAAGLNPMDLKRGIDMAVTAVIKDVEANSKKIKSSSEVAQVGTISANGDADVGKLLAEAMDKVGQEGVITVEEAKSLHTELDVVEGMQFDRGYLSPYFVTNADKMICELENPLILIHEKKLSSLQPMLPLLEQVARSSRPFLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTGGTVVSEDVGINLETVDIKMLGTAKSVTLTKDETTVVDGAGKKKDIQARVSQIKAQVEETTSDYDKEKLQERLAKLVGGVAVLRVGGATEIEVKERKDRVDDAMHATRAAVQEGIVAGGGTALLYGTRALDKLANDDQRMGIDIVRRALQAPCRQIAENAGADGSVVVGKLLEQKVTFGYNAATDTYEDLIKAGVIDPTKVVRTALQDAASIAGLLITTEAMVAEKPE....................... 527
97 0.000e+00gi|554674226|ref|WP_023175525.1| molecular chaperone GroEL [Gloeobacter kilaueensis]  clstr ali  57  1MAKQVVFDEAARRSLERGIDALANAVRVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELENKLENAGAQLIKEVASKTNDVAGDGTTTACVLAQSLVKEGLKNVAAGSNPMTLKRGIEKTVRYLVGELEKVAKPVEGSQAIAQVAAVSAGNDEEIGQMIASAMEKVGKEGVITVEESKSLTTELEVTEGMQFDRGYVSPYLVTDQERMEAVFDEPFLLITDKKISIITDLVPILEKVARAGRPLVIIAEDIEKEALATLVVNKLRGVLNVAAVKAPGFGDRRKALLQDIAILTDGEVISEDTGLKLENVAIDQLGKARKLTITKDNTTIVA-EGNEAAVKARIGQIRQQIDETDSEYDREKLQERLAKLAGGVAVIKVGAATETELKDRKLRIEDAVNATKAAIEEGIVPGGGTALLHLAGKLDSTLSGEEKIGARIIQKALEGPLRQIAENAGLEGSVIAEKVRNLEFNFGFNAITNEYEDLVAAGIIDPVKVTRSALQNAASIAAMVLTTECIVVDKPEEDKATAGGPGGGMPDFD...... 542
98 0.000e+00gi|1000269865|gb|KXK32263.1| 60 kDa chaperonin 1 [Omnitrophica bacterium OLB16]  clstr ali  62  3.AKIITYNEDARQKVLKGVQKLAAAVKVTLGPKGRNVVLDKKWGSPTVTKDGVTVAKEIELEDRFENMGAQMVREVASKTSDVAGDGTTTATILAEAIFMNGLKYVTSGANPISLQRGVLKGVETVVDELSKMSRKVKDRTEIAQVATVSANGDSRIGDLIADAMEKVGKDGTITVEEAKTIDTTLEVVEGMQFDKGYLSPYFATDAQSMEAVLEDAYILINEKKISSMKDMLPLLEKIAQTGRPLLIICEDVEGEALATLVVNKIRGTLKVCAVKAPGFGDRRKAMLQDIAILTGGKFISEDLGIKLEGVQVSDLGRVKRVVIDKENTVLVEGGGKPADIKGRIQQIRNEIETTTSDYDREKLQERLAKLAGGVAVINVGAATETEVKEKKARVEDALHATRAAVEEGIVPGGGTALIRAQSALDKLDSEDEQLGIQILKKALEAPLRQLAANAGLEGSIVVEHVKKEKKEVGFNVATGEYTDLVKDGVIDPTKVSRSALQNAASIAGLLLTTEALVTEKPEEK..................... 528
99 0.000e+00gi|502758480|ref|WP_012993464.1| molecular chaperone GroEL [Mageeibacillus indolicus]  clstr ali  58  1MAKEIKYNEEARKKLEAGVNKLADTVKITLGPKGRNVVLDKKFGSPTITNDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIVREGLRNIAAGANPMVIRRGMSKAVDCAVESIKEISVPVKTTKDIARVASVSAD-DTLVGDLVAEAMEKVTADGVITVEESKTMHTELEVVEGMQFDRGYVSAYMSTDMDKMEAVLDDPLILITDRKISAIQDLLPLLEKVVQTGKKLLIIAEDVEGEALSTLIVNKLRGTLTCVAVKAPGFGDRRKEMLKDIAILTGGQVITEELGLELKDTDVSQLGTARQVKVQKENTIIVDGAGDAKDIQARVNSIKAQIEDTTSDFDREKLQERLAKLAGGVAVIKVGAATETEIKEKKLRIEDALAATRAGVEEGMVAGGGTAYLNILPKLLKDATGDQKTGINIIIRALEEPVRQIAINAGLDGSVICEGVKHQPVGVGYDVMSESYVNMIEHGIVDPAKVTRSALQNAASIAATLLTTEAVVAELPSKE..................... 527
100 0.000e+00gi|494141770|ref|WP_007081520.1| molecular chaperone GroEL [Rhodanobacter fulvus]  clstr ali  60  3.AKEVRFGEDARARMLKGVNTLANAVKVTLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKYENLGAQIVKEAASKTSDVAGDGTTTATVLAQAFIQEGLKAVAAGMNPMDLKRGIDKAVSAAVGELKKLSNPTANDKEIAQVGTISANSDTNIGDIIATAMKKVGKEGVITVEEGSGLDNELDVVEGMQFDRGYLSPYFINNQASQQVELDDPYILIHDKKVSNVRDLLPVLEAVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVAAVKAPGFGDRRKAILEDIAILTNGQVVSEEVGLSLEKTTVADLGRAKRIVITKENTTIIDGAGEAEKIQSRIGQIKAQIEETSSDYDREKLQERVAKLAGGVAVIKVGAGTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRALKAVEKGDNTDQDLGIAITRRALEAPLRAIVANAGEESSVVLNKVKEGKGNFGYNAATGEYGDMIEFGILDPTKVTRSALQHAASVAGLAITTEAIVAEAPKKDE.................... 529
101 0.000e+00gi|931391078|gb|KPJ80623.1| molecular chaperone GroEL [Gemmatimonas sp. SG8_23]  clstr ali  63  3.AKELGFDVEARARLKVGVDKLARAVKVTLGPKGRNVVLDRKFGSPTVTKDGVSVAKEIELDDPVENMGAQMVKEVATKTSDVAGDGTTTATVLAQAIFGEGLKNVTAGTNPMGIRRGIDKGVEVVVEELQKLSVETKDKKHIAQVGAISANNNTEIGELISDAMEKVGKDGVITVEEARGLETTLDTVDGMQFDRGYLSPYFVTDPERMEAVLEDPMILIHDKKVGSMKDLLPILEKVAQTGKPLLIVAEDVEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKAMLQDIAILTGGQVISEEVGFKLENTVASDLGQAKRIVIDKDNTTIIDGAGDADKIKGRIEEIRVAIDKSTSDYDREKLQERLAKLAGGVAVINVGAATETEMKEKKALVEDALHATRAAVEEGIVPGGGVALLRAQARLAELDREDEQIGVQILHRALEHPIRQIAANAGVEGSIVVSKVREGKGGFGYNAQTDEYEDLVKAGVIDPTKVVRSALQNASSIAGLLLTT................................ 517
102 0.000e+00gi|763327996|ref|WP_044186442.1| molecular chaperone GroEL [Hyalangium minutum]  clstr ali  62  3.AKEIFFHQSAREAILRGVRILSDAVAVTLGPKGRNVVIEKSFGSPTVTKDGVTVAKEIDLENKFENMGAQMVKEVASKTSDKAGDGTTTATVLARAIYEEGLKLVAAGHSPMDLKRGIDKAVEVVVAELKKLSKPTADKKAIAQVGIISANGDETIGNIIADAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYVSPYFVTNRERMEVVFDDPYLLISEKKVSSMQDMIPILEQVARSGKPLLIIADEIEGEALATLVVNKIRGVLNVAAVKAPGFGDRRKELLKDIATLTGGMVVSEELGHKYETLTLNDLGRAKRVTVDKDNTTIVDGAGKKSEIEGRIKLIRSQIESSTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRTLPALDKKLGGEQDFGVEIIKKALQEPLRKISSNAGCEGAVVINKVKEGTGAFGFNARTEVYEDLEKAGVIDPTKVERTALQNAASVASLLLTTEAMVADKPXXXXXXXMPDYGG-DDMD...... 548
103 0.000e+00gi|485600019|gb|AGK84822.1| chaperonin [uncultured bacterium BAC25G1]  clstr ali  61  1MAKEIKFNIKAREELKNGVDALADAVKVTLGPKGRNVIIEKKFGAPHITKDGVTVAREIELEDAFQNMGAQLVKEVASKTGDQAGDGTTTATVLAQSIVNVGLKNVAAGANPMDLKRGIDKAVSAVVEGIKAQSQEVDDDEKIENVARISANNDEKIGALIAEAMKKVKKEGVITVEEAKGTETTVDVVEGMQFDRGYISPYFVTNSEKMECEMESPFILLYDKKISNLKELLPILESVAQSGRPLLIIAEDVDNEALATLVVNRLRGSLKICAVKAPGFGDRRKEMLEDIAILTGGTVISEVKGMQLAQANVQDLGTADKVTVNKDNTIIVNGAGSKEAIAERVNQIKAQIETTTSNYDKEKLQERLAKLAGGVAVLYIGAASEVEMKEKKDRVDDALSATRAAIAEGIVPGGGVAYIRCLSKLDKGDNDDENTGIAIIRRAIEEPLRQIVANAGVEGAVIVQKVKEGEGDYGYNARTDTFENFFATGVIDPAKVTRVALENAASIAGMFLTTECVIADKKEENP.................... 529
104 0.000e+00gi|1002735150|gb|AMN39067.1| chaperonin GroEL [Rhodoplanes sp. Z2-YC6860]  clstr ali  59  3.AKEVRFSVDARDRMLRGIDTLAHAVRVTLGPKGRNVVLDKSYGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASRTSDAAGDGTTTATVLAHAIVREGAKAVAAGMNPMDLKRGVDLAVEAVVADLQKNSKKVTSNEEIAQVGTISANGDAEIGRFLADAMKKVGNEGVITIEEAKSIETELEVVEGMQFDRGYASPYFITNTDKMRAELDDPYVLIYEKKLSGLQELLPLLEAVVQTSKPLVIIAEEIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVVTGGQAISDDLGIKLDNVTLAMLGRAKKVTIEKESTTIVSGAGKKNDIEARIYQIKTQIDETASDYDREKLQERLAKLSGGVAVLRVGGATEIEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRASQALTRPANDDQRTGIEIVRKALSWPARQIVLNSGEDGSVVIGKILEKDSAFGFDAQTGEYGNMLTKGIIDPTKVVRAALQGAASVAGLLITTEAMIAELPNKNGAPAMPSGCGMG......... 542
105 0.000e+00gi|501064989|ref|WP_012116233.1| molecular chaperone GroEL [Xanthobacter autotrophicus]  clstr ali  61  3.AKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAVVQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTVISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDYDREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALLRSIKALEKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDSFGYNAQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNPAAPAMPGGGMD......... 542
106 0.000e+00gi|652463782|ref|WP_026858561.1| molecular chaperone GroEL [Jeotgalicoccus psychrophilus]  clstr ali  57  1MAKEIKFSEDARRSMLAGVDKLANAVKVTLGPKGRNVVLDKAYSSPLITNDGVTIAKEIELEDKYENMGAKLVAEVANQTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGIRTGIGMAVERAVETLQEVSKPVQDKEAIAQVGAISAD-DPEIGKYISEAMEKVGNDGVITIEESRGFKTELEVVEGMQFDRGYLSPYMVTDSEKMIAELENPYVLITDKKISSIQDLVPLLEQIVQQSRPILIIADDVDGDAMTNLVLNKIRGTFNVIAVKAPGFGDRRKAMLEDIATLTGGQVITDELGLELKDATLDLLGNASKVHVSKDDTTIVEGAGDKEVISGRVNQIKAQIEETTSSFDKEKLQERLAKLAGGVAVIKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALVEVYSKVALEAEGDVKTGINIVLKALEAPLRQIVENAGLEGSVIVQQLKQQDAGIGYNAATDEWVNMIDAGIVDPTKVTRSALQNAGSVAAMFLTTEAVVADIPSEN..................... 525
107 0.000e+00gi|931530191|gb|KPL06958.1| molecular chaperone GroEL [bacterium SM23_57]  clstr ali  65  3.AKLISFDADARNALKKGVDILANTVKVTLGPKGRNVVIDKKWGAPTVTKDGVTVAKEIELEEPDENMGAQMVREVASKTSDVAGDGTTTATVLAQAIIHEGMRNVTAGANPMDLKRGIEKAAAAVVDSLKAQSKEVTKKEEIASVGAISANNDASIGDLISDAMDKVGKDGVITVEEAKGTETTLELVEGMQFDRGYLSPYFVTNPDDMEAMLEEPMILIYDKKISVMKDLLPVLEKVAQMGKSMLIISEDVEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKAMLEDIAILTGGRVISEEAGFKLENAVVTDLGTAKSIVIDKDNTTIIEGGGQTEDIKGRISQIKKQIDATTSDYDREKLQERLAKLAGGVAVLKIGASTEVEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRAIPKLDLKLEGDEAIGIAIVRRALEEPIRLIAENAGFEGSVVVQKVKDGKDGFGFNAQTEEYTDLVKDGVIDPTKVTRIALENAVSVGALLLMTDAVI............................ 520
108 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  59  10MAKEIKFAQDTRKALETGVNKLADTVKVTLGPKGRNVILDKKFGAPLITNDGVTIAKEIELEDRFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVTAGANPVLIRKGIQKAVEVAVEELKSQSRTIETKESISQVASISA-GDEEVGKLIAEAMEIVGKDGVITVEESKTMNTELDAVEGMQFDRGFISAYMVTDVDKMEAVLNDPYILITDRKISNIQDILPILEQIVQQGKKLLIIAEDVDGEALSTLVVNKLRGTFEVVAVKAPGFGDRRKAMLEDIATLTGGVVISEELGYDLKEADVTMLGRAGSIKVTKEATTIVDGFGDKVAIENRVNQIKHQVEETTSEFDKEKLMERLAKLAGGVAVIKVGAATEVEMKERKLRIEDALNATRAAVEEGIVAGGGTALVSVIPALDKELEGEVQIGAKIIRKALEEPLRQIAINAGLEGAVITERVINAEPEVGFDALNERYVNMIEVGIVDPTKVTRSALQNAASIAGVFLTTEAAVADLPEAEPA................... 538
109 0.000e+00JGI.Meta 7033888529 C5458146__gene_233114 chaperonin groL [Human Supragingival plaque microbiome from visit number 1 of subject 604812005] :  ali  64  23MAKEIKFDIEGRNKLKSGVDQLANAVKVTLGPKGRNVVMERKFGAPQVTKDGVSVAKEIELEDALENVGAQLVKEVASKTNDDAGDGTTTATVLAQAIVNVGLKNVTAGANPMDLKRGIDKAVAAVVENLRKQSKEVGDDLKIEQVATISANNDNEIGKLIATAMGKVKKEGVITVEEAKGIETTVEVVEGMQFDRGYISPYFITDPEKMEVALDHPMILLTDKKISSMQDLLPILEPVAKSGRSMLIIAEDVDGEALATLVVNRLRGSLKIAAVKAPGFGDRRKEMLEDIAILTGAVVISEDKGLRLADAKVEMLGEAEKVNITKDNTTIVNGNGDKEEIKKRVAQISAQIEKSTSDYDKEKLQERKAKLAGGVAVLYVGAPTEVEMKEKKDRVEDALSATRAAVEEGIIPGGGVAYVRALSALEKGTNDDETTGIRIIVRAIEEPLRQIVANAGLDGAVVVEKVRDGKGDFGYNARTDHYENLFESGVIDPTKVARVALENASSIAGMILTTECVMVDIKEENPAPM................. 554
110 0.000e+00gi|503433943|ref|WP_013668604.1| molecular chaperone GroEL [Aerococcus urinae]  clstr ali  58  1MAKDIKYSSDARQSLVEGIDKLANTVKVTLGPKGRNVVLERSYGSPLITNDGVTIAKDVELEDHFENMGAKLVSEVASKTNDVAGDGTTTATILTQALVHEGFKNVTAGANPVGIRRGMDQAIRKAVEALKEISVPVNAKESIANVAAISS-GDQEVGQLIADAMEKVGQDGVITIEESQSMDTALDVVEGMQFDRGYLSQYFVTDNDKMEAVLDDPYILLTDKKISNIQDILPLLEQIVQQGKSLLLVADDVEGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKEQLEDLAVLTGGTVITEDLGLELKDTSIDQLGQAARVTITKDDTTIVEGKGNKEQLEQRVAHIRKQIEETTSDYDREKLQERLAKLAGGVAVVRVGAATESEQKERKLRIEDALNATRAAVEEGIVAGGGTAFMNIQDKVKESLEGDEQTGADIVVRALETPLRQIAENAGLEGSVIVEHIHDKDQGVGYNAASGEWVDMISDGVVDPTKVSRSALQNAGSVAGLILTTEAVVADHPEEN..................... 527
111 0.000e+00gi|516663652|ref|WP_018029241.1| molecular chaperone GroEL [Porphyromonas somerae]  clstr ali  61  1MAKQIKFETEARDLLKSGVDQLANAVKVTLGPKGRNVIIDKKFGAPHITKDGVSVAREIELEDPFENMGAQLVKEVASKTNDDAGDGTTTATVLAQSIVNVGIKNLAAGASPMELKRGIDKAVATVVASLREQSKEIGDDAKIEHVAKISANGDETIGKLIAEAMEKVKKEGVITVEEAKGMETTVEVVEGMQFDKGYISPYFATNTEKMLVEFENPYILIYDKKISTLKEILHILEEVVQTGRGLLLIAEDIESEALATLVVNRLRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEETGLSLEAATMEMLGSAEKVTIDKDHTTIVNGGGAKENIEARVQVIKNQIEASTSDYDKEKLQERLAKLAGGVAVLYVGAPSEVEMKEKKDRVEDALSATRAAIEEGTVPGGGVAYIRATKALEKGETDDEQTGIDIIRRAIEEPLRQILANAGKEGAVVVQKLKDGEGDFGYNARTDKYEHLTETGVIDPTKVARVALENAASIAGMFLTTECVITDLPEKN--APAMPTPDMGGM....... 540
112 0.000e+00gi|647624819|ref|WP_025898344.1| molecular chaperone GroEL [Sneathiella glossodoripedis]  clstr ali  62  3.AKEIVFNGDARERMLKGVDVLSNAVKVTLGPKGRNVVLDKSFGAPRVTKDGVSVAKEIELSDKFENMGAQMIKEVASKQNDRSGDGTTTATVLAQSIVREGARSVAAGMNPMDLKRGIDVAVGKVVEDVQSRSKKISENEEIAQIATISANGDKEIGAIIAEAMEKVGNEGVITVEEAKGLHTELTVVEGMQFDRGYVSPYFVTDSEKMVCELEDPLILVHEKKLTSLQPMLPLLEKVVQANKPLLIIAEDIEGEALATLVVNKIRAGLKVAAVKAPGFGDRRKAMLEDISILTKAQVISEELGLSLEKAGMEVLGTAKKVVISKEETTIVDGAGDKADIEARVAQIKSQIETTTSDYDREKLQERLAKLAGGVAVIHVGGATEVEVKEKKDRVDDALHATRAAVEEGVVPGGGVALLYASRVLDNSENNDQKVGMEIIKRALQSPVRQIAENAGYDGAVVAGKLLDQDNNFGFNAQTGEYEDLVKAGVIDPTKVVRTALEDAASVSGLLITTEAMVAEIPEPPSKSPA-----MPDMGAMG... 542
113 0.000e+00gi|654380611|ref|WP_027859355.1| molecular chaperone GroEL [Marinobacterium jannaschii]  clstr ali  61  3.AKDVRFGDDARQGMLRGVNILADAVKTTLGPKGRNVVLDKAFGAPTVTKDGVSVAKEIELEDKFENMGAQMVKEVASQANDVAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKXXXXXXXXXXXXXXPCTDSKAIAQVGTISANSDEQVGEIIAEAMSKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINNQDNMSAEVEQPFILLVDKKISNIRDLLPILEQVAKSSRPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEEVGLNLETATLEQLGQAKRVSITKENTTIVDGVGAADTIEARVNQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRALSKVAEGANHDQTVGIELALRAMEAPMRQIVGNAGDEGSVVVSKVREGEGAFGYNAGTGEYGDMLEMGILDPAKVTRSALQAAASVAGLMITTEAMVADKPAEAGA................... 530
114 0.000e+00gi|850272432|ref|WP_047998970.1| molecular chaperone GroEL [Lactobacillus herbarum]  clstr ali  57  1MAKELKFSEDARSAMLKGVDQLANTVKSTLGPKGRNVVLEQSYGSPTITNDGVTIAKAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQSIVTEGMKNVTAGANPVGIRRGIEEATKTAVDSLHAMAHEVKTQEDIAQIAAVSSAS-EETGKLIAEAMEKVGHDGVITIEESRGVDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDIIPMLQSIVEQGKPLLIIADDISGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKEQLQDIAILTGGTVITDDLGLELKDTTIDQLGQANKVTVTKDNTTIVEGAGAKDAISERVDFIRNQISETTSDFDKEKLQERLAKLAGGVAVIRVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTAFINVIKDVALKETGDVQTGINIVQRALEEPVRQIAENAGLEGSVIVEKMKDQKPGVGFNAATDEWVDMIEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAEKP-DENAPAMPAAPN----PGMGGMM 541
115 0.000e+00gi|511345012|emb|CCX38835.1| 60 kDa chaperonin [Clostridium sp. CAG:1013]  clstr ali  59  1MAKKIIYGEEARKALLSGVNQLADTVKITLGPKGRNVVLDKKFGAPLITNDGVTIAKEVELEDAFENMGAQLVKEVATKTNDIAGDGTTTATLLAQALVREGMKNVAAGANPMILRNGVQKATKAAVDAIEQNSHKVDGTKDIARVAAVSSASD-EIGQLIADAMEKVTSDGVITVEESKTAETYSEVVEGMMFDRGYITPYMATDTDKMVAELDDPYILITDKKISNIQEILPLLEQVVQSGKKLLIIAEDIEGEALTTLILNKLRGTFTCVAVKAPGFGDRRKEMLVDIATLTGGQVISEEVGLELKDTQLSQLGHARQVKVDKENTIIVDGAGNSEEIKARVNQIRAQIETTTSEFDKEKLQERLAKLAGGVAVIKVGAATEIEMKEKKLRIEDALAATKAAVEEGIVAGGGTALIDAIPAVKDAAEGDEKTGAAIVLKALEEPVRQIAANAGIEGSLIVEHLKEGKVGYGYNALTGEYQDMIQAGIVDPTKVTRSALQNASSVASTILTTESLVADIKE--PAPAAPAAPDMGGM....... 540
116 0.000e+00gi|505172876|ref|WP_015359978.1| molecular chaperone GroEL [[Clostridium] stercorarium]  clstr ali  59  1MAKIITFDLEARKAIEAGVNKLANTVKVTLGPKGRNVVLEKKYGSPVITNDGVTIAKEIELEDPYENMGAQLVKEVASKTNDIAGDGTTTATLLAQAIVREGMKNLAAGANPIILKRGIDKATEKTVEVLKNNSRKIQGRNDMAYVATISS-GDPEIGNLIAEAMEKVTADGVITIEESKTSETYIEYVEGMSFDRGYISHYMVTDSEKMEAVIDDPYILITDKKISSAQDLLPALELIVKNGGKLLIIAEDVEGDALATLIVNKLRGTFTCVAVKAPGYGDRRKEMLQDIAILTGGQVISDELGLSLKDIKLEWFGKAKSVKVQKENTIIVDGAGDPKKIKDRIESIRKQIEETTSEYDKEKLSERLAKLAGGVAVIRVGAATETEMKEKKYRVEDALNATRAAVEEGIVAGGGTALIDAIPEVEKTLEGDEKTGAMIILKALEEPLRQIATNAGLDGSVIVERVKKSEKGVGFDAVKEEFVNMFDAGIIDPAKVTRSALQNASSIASMILTTESAVADKPEPKNTTPAMP.............. 534
117 0.000e+00gi|494128372|ref|WP_007068144.1| molecular chaperone GroEL [Fulvimarina pelagi]  clstr ali  61  3.AKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGIDAAIAKVVEALGEAARSIDTSDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNGEKMVAELEDAYILLHEKKLSNLQAMLPVLESVVQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALLRASNAVDKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESSFGYNAQTGEYGDMIQMGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPKKDN.................... 529
118 0.000e+00gi|493899297|ref|WP_006845123.1| molecular chaperone GroEL [Weissella koreensis]  clstr ali  58  1MAKELKFSEDARAKMKAGVDQLADTVKTTIGPKGRNVVIEQSYGAPTITNDGVTIAKSIELEDHFEDMGAKLVAEVASKTNDIAGDGTTTATVLAQAIINEGLKNVTAGANPVGVRRGIELATNAAVQSLHDMSKTVSTKEEIAQIASISAAN-EEVGALIAEAMDKVGHDGVITIEESKGIETTLDVVEGMQFDRGYMSQYMVTDNEKMEANLDNPFIMITDKKIGNIQDILPVLQQVVEQGRSLLIVADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKAMLEDLAVLTGGTVITDELGLNLKDVTIENLGQAAKVTVTKDSTTVVEGAGDKQLLSERVALIKGQIEETTSDFDREKLQERLAKLAGGVAVINVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTALVNAIPAVALTAEGDVQTGINIVERALEAPVRQIAENAGLEGSVIVNKLKEQTLGTGYNAADDTWVDMIDAGIVDPTKVTRSALQNAASVSALLLTTEAVVAEQPKDETVMPAAPQGGMNGM....... 539
119 0.000e+00gi|495889222|ref|WP_008613801.1| molecular chaperone GroEL [Magnetospirillum caucaseum]  clstr ali  64  3.AKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGXXXXXXXXXXXXKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEAKGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTCELDNPYILLHEKKLSGLQPLLPVLEQVVQSGRPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVNLEMLGTAKRITITKEDTTIVDGSGKKGDIDARCKQIRAQIEETTSDYDREKLQERLAKLAGGVAVIKVGGGSEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALLHAVKALEKSGNPDQEVGIGIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDSFGFDAQNGIYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPKKDA.................... 530
120 0.000e+00 GL0028066 [Complete] locus=scaffold5786_4:6770:8407:-  ali  62  1MAKDIKFNIEARELMKNGVDQLANAVKVTLGPKGRNVIIEKKFGAPHITKDGVTVAKEIELADAFENAGAQLVKSVASKTGDDAGDGTTTATVLAQSIVSVGLKNVAAGANPMDLKRGIDKAVAKVVEHIKGQAEQVGDDNKIEQVATVSANNDPEIGKLLAEAMKKVSKDGVITIEEAKGRDTTIGVVEGMQFDRGYLSAYFVTDTEKMECVMENPYILIYDKKISNLKDFLPILEPAVQSGRPLLVIAEDVDSEALTTLVVNRLRSQLKICAVKAPGFGDRRKAMLEDIAVLTGGVVISEEKGLKLEQATIEMLGTCDKVTISKDNTTIVNGHGQSELIKDRVNQIKNEIANSTSDYDKEKLQERLAKLSGGVAVLYVGAPSEVEMKEKKDRVDDALCATRAAIEEGIIPGGGVAYIRAIKALEEGANADETTGINIVKRAIEEPLRQIVENAGLEGSVVVEKVRQAEGDFGYNAREDKYENMKASGIIDPAKVTRVALENAASIAGMFLTTECVICDKKEEKA.................... 529
121 0.000e+00gi|550655575|ref|WP_022636063.1| molecular chaperone GroEL [Chitinivibrio alkaliphilus]  clstr ali  61  1MAKQIAFDMDARDRLMAGVDKLANAVKVTLGPKGRNVVLDRGFGAPTVTKDGVSVAKEIELEDKYENMGAELVKEVASNTSDGVGDGTTTATVLAQAIARHGLKYVTAGANPMDLKRGIDKAREALVTELKSMAKPVKGKEEVAQVGTISANNDKEIGELLADAMDKVGNDGVITVEEAKSIETYLDVVEGMQFDRGYLSPYFVTDQDTMEVVQENPYILITDKKVSAMKDLLPLLEKTAQQGKELLIIAEDVDGEALATLVVNKIRGTLKIAAVKAPGFGDRRKAMLEDIAVLTGGTVITEDAGLTLENATIDMLGSAKRVRITKDETTVIEGSGDQGKIQARADQIKKQIEDTSSDYDREKLQERLAKLAGGVAVVNIGAATETEMKEKKARVEDALHSTRAAVQEGIVPGGGVALVRAAKVLDEVENDDQKSAVEIVRRAIEEPLRFIASNAGEDASVVLNNVKHESGAYGFNAFSGVYEDLVQAGVVDPVKVTRTAIENAASISGLILTTECLVTDLPKDDD.................... 528
122 0.000e+00gi|518702330|ref|WP_019863562.1| molecular chaperone GroEL [Mesorhizobium loti]  clstr ali  61  3.AKDVKFSRDARERMLHGINILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELSDKFENMGAQMIREVASKTNDIAGDGTTTATVLAQSIVQEGNKAVAAGMNPMDLKRGIDLAVSDVVATLIKNATKIKTSEEVAQVGTIAGNGDESVGAMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPVLEAVVQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLRASLSINAGANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILDNKGAFGYNAQTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA................... 530
123 0.000e+00gi|1016781212|emb|CZT55130.1| 60 kDa chaperonin [Eubacteriaceae bacterium CHKCI005]  clstr ali  59  1MSKEIRFGAEARQALQAGIDKLADTVKITLGPRGRNVVLDKKFGAPLITNDGVTIAKEIELDDAFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIVREGMKNVTAGANPMILKKGIQKAVDAAIETVKSHCQKVSGSEDIARVATVSA-ADEVIGKLIAEAMEKVSADGVITVEDSKTAETYTEVVEGMQFDRGYISPYMVTDTDKMEAVIDDAYLLITDKKISNIQDILPLLEQIVNAGRKLVIIAEDIEGEALTTLLLNKLRGTFVCVGVKAPGFGDRRKEMLQDIAILTGGQVISEEVGLELKTTTMDQLGRAGQVKVQKENTIIVNGAGDSEAIKARVAQIRAQIETSTSEFDKEKLHERLAKLAGGVAVLKVGAATEVEMKEKKLRIEDALSATKAAVEEGIVAGGGVALLNAIPEVRKLLDGDEKTGVKIVLKALEEPVRQIAANAGLEGSIIVDKVNSGKPRFGYDALHEEYVDMINAGIVDPVKVTRSALQNAASVAAMVLTTESLVADKKEPNPPAAP-AAPDMGGM....... 541
124 0.000e+00gi|1011161145|ref|WP_062082622.1| molecular chaperone GroEL [Bacteroidales bacterium 6E]  clstr ali  63  1MAKEIKNNIEARDLLKKGVDQLANAVKVTLGPKGRNVVIEKKFGAPQITKDGVSVAKEIDLEDPYENLGAQMVKEVASKTGDDAGDGTTTATVLAQSIVTVGLKNVAAGANPMDLKRGIDKAVVKVVESLRNQAQNVGDDAKIESVAKVSANNDDAIGKLIAEAMEKVHKEGVITIEQSKGTDTYVDVVEGMQFDRGYISPYFVTDTEKMAAELDNPFILIHDKKISTMKDLLPVLEQTAQSGRPLLIIAEDVDGEALATLVVNRLRGALKVAAVKAPGFGDRRKEMLEDIAVLTGGNVITEEKGMKLEQTTLDMLGVAEKVTIDKENTTIVGGQGSTDAIKSRVSMIKKQIELTTSDYDREKLQERLAKLAGGVAVIYVGAASEVEMKEKKDRVDDALSATRAAVEEGIVPGGGVAYIRATEALKKGENDDEQTGIEIIKRAIEEPLRQIVENAGKEGAVIVQKVKEGKNDFGYNARLDIFQNLYEGGVIDPAKVTRVALENAASIAGMLLTTETVVVEKKEDKPAMPNP............... 534
125 0.000e+00gi|502939783|ref|WP_013174759.1| molecular chaperone GroEL [Syntrophothermus lipocalidus]  clstr ali  59  3.AKQLRFSEEARRSLEKGVDTLANAVKVTLGPKGRNVVLERKFGSPTITNDGVTIAKDIDLEDPWENMGCQLVKEVATKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPMIMKRGIDKAVKVAVEALKEISKPVESKXXXXXXXXX-XXXDTEIGDLIADAMEKVGRDGVITVEESQSVGTSLEVVEGMNFDRGYISPYMITDPDKMEATLSEPYILVTDKKISSINDILPVLEKVVQTGKPLLLIAEDVEGEALATLVVNKLRGTFTCVAVKAPAFGERRKAMLQDIAILTGGEVASEELGVKLENVTLNMMGRARQVRVKKDETIIIDGAGSEQAIKERINQIKKQIEETKSEYDREKLQERLAKLAGGVAVIQVGAATETELKEKKHRIEDALAATKAAVEEGIVAGGGTALINIMKKLEDDANGDERTGVLLVMKALEEPLRQIANNAGIEGSVVVQKVKELEAGIGFNALTGEYEDMIKAGIIDPVKVTRSALQNAASIAGMLITTETLVTEVPKEEPLP----RGGMPDM....... 536
126 0.000e+00gi|502793352|ref|WP_013028328.1| molecular chaperone GroEL [Sideroxydans lithotrophicus]  clstr ali  61  3.AKDVKFHDAARAKMVVGVNILADAVKVTLGPKGRNVVLDRSYGSPTITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVQEGMKFVAAGMNPMDLKRGIDQAVIAAVAELKKISKPCTTTKEIAQVGSISANSDTVIGEKIAAAMEKVGKEGVITIEDGQGLEDELDIVEGMQFDRGYLSPYFINNADKQIAAMENPFILLHDKKISNIRDLLPLLEQVAKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAVLTGGTVIAEEVGLSLEKATLAEMGQAKRIEVGKENTTIIDGAGKHEAILGRVGEIKKLAEESTSDYDKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRAKAAVAKGANHDQDAGITIVLRAMESPIRAITMNAGDEPSVVVNKVLEGKGSFGYNASSSEYGDMLVMGVVDPTKVTRVALQNAASIAGLMLTTACMVAELPEDKPA................... 530
127 0.000e+00gi|1015516700|gb|AMV71017.1| chaperonin GroEL [Desulfuromonas sp. DDH964]  clstr ali  62  3.AKEIKFGQDARASILKGVNTLANAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIEVEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYREGVKLVTAGHNPMEIKRGIDKAVIEAVEALKALSKPIKDHKEIAQVGTISANGDATIGNILAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDAERMETVMEEALILIHDKKISNMRDLLPILEPVAKQGRPLMIIAEDVEGEALATLVVNRLRGTLNVCAVKAPGFGDRRKAMLEDIAVLTGGKVISEEIGFKLENATLDMLGHAKRIVVDKENTTIIDGAGAEADIQGRVKQIRAQVEETKSDYDREKLQERLAKLVGGVAVVKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALVRCIAALNAKLGGEQQFGVNIVKRALEEPLRQIANNAGMEGSIVMDKVLGKKGSFGFDAAADVYGDMIEKGIIDPTKVARSALQNAASVAGLMLTTEACIAEKPKKDA.................... 528
128 0.000e+00gi|518038747|ref|WP_019208955.1| molecular chaperone GroEL [Phocaeicola abscessus]  clstr ali  62  1MAKELLFDIDARDQLKKGVDVLANAVKVTLGPKGRNVVLEKKFGAPQISKDGVTVAKEIELADPFQNTGAQLVKSVASKTGDDAGDGTTTATVLAQAIVGEGLKNVTAGANPMDLKRGIDKAVANVVETIGKMSEQVGNNEKIEQVATVSANNDPEIGKLIADAMRKVSKDGVITIEEAKGTDTTIGLVEGMQFDRGYLSPYFVTDAEKMECVMENPYILIYDKKISNLKDLLPILEPAVQSGRPLLIVAEDVDSEALTTLVVNRLRAQLKICAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGLKLEQATLDMLGSCEKATINKDTTTLVNGGGDSKDIHDRVAQIKAEMQNTTSSYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALCATRAALEEGLVPGGGVTYIRAAEKLDKGENEDETTGIEIIKRAIEEPLRQIVANAGKEGAVVVQKVREGKDDFGYNARLDKYENLHAAGVVDPAKVTRVALENAASIAGMFLTTECVVVEKKEEKPEMPNP............... 534
129 0.000e+00gi|496101998|ref|WP_008826505.1| molecular chaperone GroEL [Haloplasma contractile]  clstr ali  59  1MAKEIKYSESARRQMFDGVNKLANAVKVTLGPKGRNVVLDKKFGAPLITNDGVTIAKEIDLEDKFENMGAQLVQQVASKTNDVAGDGTTTATVLAQAMIEEGLKNISAGANPVSLRKGIEKATKVAVEELKAISKPIQGKEEIAQVAAISS-ADEEVGGLIAEAMEKVGHEGVITLEESRGFETEMEVVEGMQFDRGYLSPYMVSDSDKMVAELENPYILVTDSKISNLQEILPVLEQIVQESKPILIIAEDVEQEALATLVVNKLRGTFNAVAVKAPGFGDRRKRMLEDIAVLTGAELITEELGHDLKETAINQLGRAGKVIVSKDNTTIVEGNGSQKAIDERVNQIRMQIEESTSEFDKEKLHERLAKLSGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALLNVYNKVESEADGDELTGINIVLRALEAPVRQIAENAGIEGSIVIHKLKDMKDSEGFNALTGEYVNMVESGIIDPTKVTRSALQNAASISALFLTTEAAVAEIEDD...................... 524
130 0.000e+00gi|655903445|ref|WP_028973800.1| molecular chaperone GroEL [Spirochaeta cellobiosiphila]  clstr ali  61  1MAKQLMFEEEARRNLLRGVEKLSNAVKVTLGPKGRNVLLDKKFGAPTVTKDGVSVAREIELEDPYENMGAQLLKEVSIKTNDVAGDGTTTATVLAYSIAREGLKSVAAGINPMGIKRGIDRTVEAAVEEIGKLAKEIKDKEEISQVATISANNDRVIGDEIAHAMEKVGKDGVITVEESKTIETTTDFVEGMQFDRGYVSPYFASNRDTMTAVLDSPYILIFDKKISNMKDLLPILEKVAQASKPLLIIAEDVEGEALATLVVNTLRGTLNVCAVKAPGFGDRRKAMLEDIAVLTGGEVISEEVGLKLENAEIAQLGQAKMVKVEKENTTIINGEGSAKDIKERIGQIKAQIEETSSDYDREKLQERLAKLAGGVAVINVGAPTEVELKEKKHRVEDALSATRAAIEEGIVPGGGLTLIQVAKALDSLDTEEELVGYRIVTRSLEEPIRQIATNAGLDGSIIADKAKNEKKGIGFDASNMLWTDMVKAGIIDPAKVTRSALQNAASISGLLLTTECAITDLPEKEE.................... 530
131 0.000e+00JGI.Meta 7013610539 C4561120__gene_255721 chaperonin groL [Human Tongue dorsum microbiome from visit number 1 of subject 675950834]  ali  60  11MAKQLLFNEEARKKLLSGVEQISSAVKVTLGPKGRNVLLDKSFGAPTVTKDGVSVAREVELEDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVREGLKAVAAGMTPLELKRGMDKAVAIAVDDIQKNAKEIKGSEEVAHVASVSANNDQEIGKILADAIARVGKDGVIDVGEAQTMETVTEYVEGMQFDRGYISSYFVTDRDRMETVYDNPYILIHDKTISTMKDMLPLLEKVAQSGRPLLIIAEDVEGEALATLVVNSLRGALKTCAVKAPGFGDRRKEMLEDIAILTGGQVISEELGLKLETADLSQLGQAKSVKIDKENTTIIDGAGEKKHISDRVAQIKKQIENSSSEYDTEKLKERLAKLAGGVAVIKIGAVTEVEMKEKKHRVEDALNATRAAIEEGIVPGGGLALIQAAEALNKKLTEDEKIGFKIVKRALEEPIRQIAENAGIDGAVVAEKAKE-KRGIGFDAAKMEWVDMMKVGIIDPAKVTRSALQNAASIASLLLTTECAITNLPEKH--APAAPAPDMGGMGGM.... 553
132 0.000e+00JGI.Meta 7058562023 SRS011529_WUGC_scaffold_26401__gene_52198 chaperonin groL [Human Stool microbiome from visit number 1 of subject 1591668  ali  61  1MAKEIKFDIKAREALKKGVDQLSNAVKVTLGPKGRNVILDKKFGAPHITKDGVSVAREVELDDEFENIGAQLVKEVASKTNDDAGDGTTTATVLAQAIVTEGLRNVEAGANPMDLKRGIDKAVAKVVESIKEQSQEVGDDSKIENVARVSANGDAKIGELIAEAMKKVKKDGVITVEEAKGTDTHVDVVEGMQFDRGYISPYFVTNSEKMACEMEHPYILIYDKKISVLKDMLPILEQTAQSGRPLLIIAEDVDSEALATLVVNRLRGSLKVCAVKAPGFGDRRKEMLEDIAILTGGLVISEDKGIKLDGATMDMLGSAEKVTVTKENTTVVNGAGAKENIKERVAQIRTQIENTKSTYDKEKLQERLAKLAGGVAVLYIGAPSEVEMKEKKDRVDDALSATRAAVAEGIVPGGGVAYIRSIDALEKGENDDETTGIHIVKRAIEEPLRQIVNNAGLEGAVVVNEVRNGKGDYGYNARTEKYENLFETGVIDPAKVARIALENAASIAGMFLTTECVIAEKKEPQPAAPAAQP-------GMGGMM 542
133 0.000e+00gi|502592861|ref|WP_012830443.1| molecular chaperone GroEL [Haliangium ochraceum]  clstr ali  59  3.AKEIVFSTQARAEIAKGLNMLANAVKVTLGPRGRNVVIEKSWGAPTVTKDGVTVAKEVEVTNKLQNMGAQMMKEVASKTSDIAGDGTTTATVLAQAIFTEGAKLVAAGVNPMDLKRGIEAAVEEIVDELSKLSTPTKGKTDIAQVGTISANGDSTIGDMIAEAMEKVGKEGVITVEESKTMQSELDVVEGMQFDRGYLSPYFVTDPDRMEVVLNDPFLLICEKKISNMKDLLPVLEQVAKSGRPLLILAEDVDGEALATLVVNKLRGTLQVAAVKAPGFGDRRKAMLTDIATLTGGQAVTEDIGVKLDGVTLQELGQAKRVVITKDNTTIVEGAGETSAIEGRVKQIRREVEDTTSDYDREKLQERLAKLVGGVAVIRVGAATEVEMKEKKARVEDAMHATRAAVEEGIVPGGGVALIRSGSRLDKTFDDDRRFGVNIVRQAIEAPLRQISHNAGVDGSIIVSKVREGEGNFGYNAATLEYQDLVENGVIDPTKVVRSALQNAASVAGLMLTTEALVAEKVKDEDDAGSHDHGDY.......... 538
134 0.000e+00gi|750646986|ref|WP_040928851.1| molecular chaperone GroEL [Nosocomiicoccus massiliensis]  clstr ali  57  1MAKELKFSEDARQSMLRGVEKLANAVRVTLGPKGRNVVLDKQFTAPLITNDGVTIAKEIELEDRFEDMGAKLVSEVATKTNDIAGDGTTTATILAHAMIEEGLKNVTAGANPVGIRRGITKAVEEAVKALEDISKPVQDKESIAQVGAISAN-DKEVGEFISEAMEKVGNDGVITIEESRGLNTELEVVEGMQFDRGYSSPYMVTDSEKMIAELDNPYILITDKKITNFQDLLPILEQIVQQGRPILIIADDVEGDALANLVLNKLRGTFTAITVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLELKDASLDMLGTASKVHVDKENTTIVEGSGDETTIKGRVSQIKAQLEDTDSSFDREKLQERLAKLSGGVAVIKVGAATETEMKERKLRIEDALNSTRAAVEEGIVSGGGTALIEVYDKVALDAEGDEQTGINIVLKALEAPVRQIAENAGLEGSVIVTKLKEQTGGVGYNAETDEWVNMIEAGIVDPKKVTRSALQNAGSIASMFLTTEAVVADIPDEDN.................... 527
135 0.000e+00gi|489695205|ref|WP_003599371.1| molecular chaperone GroEL [Methylobacterium extorquens]  clstr ali  60  3.AKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLRRGIDLATAAAVKDITGRARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEAKTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELEDPYILIHEKKLSSLQPLLPVLEAVVQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQTISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALLRAKAAVSKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVENGSETFGFDAQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEKAPPLPPSGPD........... 539
136 0.000e+00gi|57339736|gb|AAW49855.1| hypothetical protein FTT1696 [synthetic construct]  clstr ali  62  29.AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGTPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALDTGENDDQNYGIALLRKAIEAPLRQIVSNAGGESSVVVNQVKANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE....................... 552
137 0.000e+00gi|740413720|ref|WP_038246960.1| molecular chaperone GroEL [Zetaproteobacteria bacterium TAG-1]  clstr ali  64  1MAKEIQFGDEARAKMLAGVDKLANAVKVTLGPKGRNVVLDKSWGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASKTADIAGDGTTTATVLAQAIAKEGNKAVAAGMNPMDLQRGIDQAVAALTAELANLSNPVKNQEEVAQVGTISANGDAEIGKIIADAMEKVGKEGVITVEEAKGLETELDVVEGMQFDRGYLSPYFVTNADRMEAELKDAYILFFEKKISNMRDLLPVLEAVARSGKPLMIIAEDIEGEALATLVVNKMRGVMNVAAVKAPGFGDRRKAMMEDMAILTNGKVISEDLGLKLENVTLEDLGQAGTVQITKDTTIIVDGAGDKDAIAARVALIRKQAEESTSDYDKEKLQERLAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRASKALAKGANHDQDAGINIVRTAIEAPLRQIVSNGGGEASVVVNEIKSKDANFGYNAGTEEYGDLVKMGVIDPTKVTRTALQHAASIAGLLITTEAMVADI......................... 524
138 0.000e+00gi|516798416|ref|WP_018106662.1| molecular chaperone GroEL [Porphyromonas bennonis]  clstr ali  62  1MAKQIKYSTEARTLLKDGVDKLSDAVKTTLGPKGRNVILDRKFGAPHITKDGVSVAKEIELEDPYENMGAQLVKEVASKTNDDAGDGTTTATVLAQSIISVGLKNVAAGAAPLEIKRGIDKAVKVIVEDLKKQSVEVGTDKKIEYVATLSANGDEEIGKLIAEAFGKVKKEGVITVEEAKGMETYVDVVEGMQFDKGYISPYFVTDTDKMLTEFDNPYILIYDKKISNIKDILPILEKVSQSGRPLLIIAEDVESEALATLVVNKLRGILQIAAVKAPGYGDRRKQMLEDIAILTGATVVSEEVGLKLENATADMLGSAEKISVDKDHTTIVGGKGDKDALANRVSQLRNQIEATTSDYDREKLQERLAKLAGGVAVLYVSAPSEVEMKEKKDRVDDALSATRAAIEEGTVPGGGVAYIRAQKALEKGANDDEQTGIDIICRAIEEPLRQIVANAGKEGAVVVQKVRESEGDYGYNAREDRFENLRESGVIDPTKVSRVALENAASIAGMFLTTECVITDIKEDE--PAMNPAAGMPGM....... 541
139 0.000e+00gi|930609048|ref|WP_054261215.1| molecular chaperone GroEL [Propionispora sp. Iso2/2]  clstr ali  60  1MAKQIIFDEEARRALERGVNALANTVKVTLGPKGRNVVLDKKFGAPTITNDGVTIAKEIDLEDPYENMGAQLVKVVATKTNDVAGDGTTTATLLAQAMIHEGMRNVAAGANPMIIKKGIERAVNSLVDEIKKDAKKVETQEAIAQVASISA-SDTEIGKLIAEAMEKVGKDGVITVEESKTMGTDLEVVEGMQFDRGYISPHMITDVDKMEAVLNEPYILITDRKIGAVADLLPLLEKVVKQGKELLIIAEDVEGEALATLVVNKLRGTFRAVAVKAPGFGDRRKAMLEDIAILTGGNVITEELGRKLDSVEISDLGKARLVRVAKEETTIVEGSGSADKIKGRVNQIKAQIEETTSDYDKEKLQERLAKLAGGVAVIRVGAATEVELKEKKLRIEDALNATRAAVEEGIVPGGGTAFIDALPVLDKEASGDEATGVAIVKRAVEEPLRQIANNAGLEGSVIVENAKKAGKGIGFNALTEEYTDMIAAGIVDPVKVTRSALQNAASIAAMVLTTETLVAD.......................... 520
140 0.000e+00gi|496509501|ref|WP_009217784.1| molecular chaperone GroEL [Bacteroidetes oral taxon 274]  clstr ali  63  1MAKEITFDIDAREQLKQGVDALANAVKVTLGPKGRNVIIEKKYGAPQITKDGVTVAKEIELEDSVNNLGAQLVKEVATKTGDAAGDGTTTATVLAQAIINVGLKNVTSGANPMDLKRGIDKAVAEVVKAIRKQSQIVNDYDKIEQVATISANNDSEIGALIAEAMKKVSKDGVITIEEAKGTATTIEVVEGMQFDRGYISPYFVTNTEKMECEMENPYILIHDKKISSLKELLPILEPAVQSGRPLLIIAEDVDSEALTTLVVNRLRSNLKISAVKAPGFGDRRKEMLEDIAILTGGMVISEERGLKLESATLEMLGTAEKVTIDKDNTIIVNGAGKKQSIADRINQIKAQISATTSDYDREKLQERLAKLSGGVAVLYVGAGSEVEMKEKKDRVDDALSATRAAIEEGIVPGGGVSYIRAIEAVAKGDNDDEKTGIEIIRRAIEEPLRQIVTNAGKEGAVVVQKVSEGTGDFGYNARMDRYENLLAAGVVDPAKVTRVALENAASIAGMFLTTECVIVDKKEENPAP.................. 531
141 0.000e+00gi|647624181|ref|WP_025897731.1| molecular chaperone GroEL [Sneathiella glossodoripedis]  clstr ali  60  2MAKIVKFGTDARAEILKGVNTLADAVKVTLGPKGRNVVLDKSFGAPRVTKDGVSVAKEIELEDKLQNMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGIDLAVSKAVESIKAGAKPVSGGEEVAQVGTISANGEKEIGSIIAEAMQRVGNEGVITVEEAKGLETELDVVEGMQFDRGYLSPYFVTNAEKMLTEMESPYILLHEKKLTNLQPMLPILEAVVQAGKPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTNGQLISEELGIKLENVTLDMLGTAKTVTISKEETTIVDGAGSKEEIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVALIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYASAALKEGENNDQSVGVKIIARALQAPVRQIAENAGHDGAVVAGKLLEQDATYGFNAQTGQYGNLLNDGVVDPAKVVRTALEDAASIAGLLITTEATVTDAPAKEGA-AGPAMPD........... 538
142 0.000e+00gi|493484149|ref|WP_006438972.1| molecular chaperone GroEL [[Clostridium] hiranonis]  clstr ali  59  1MAKEIKFSEDTRKALAAGVNKLADTVKVTMGPKGRNVILDKKFGTPLITNDGVTIAKEIELEDRFENMGAQLVKEVAVKTNDIAGDGTTTATVLAQAIIREGLKNVTAGSNPVLLRKGIQKAVEVAVEQLKAHSKDISTKEEISQVASVSS-GDEEVGKLLAEAMEIVGKDGVITVEESKTMHTELDAVEGMQFDRGFVSAYMVTDVDKMEAVLDNPYILITDKKISNIQEILPILEQIVQQGRKLLIIADDVEGEALSTLVVNKLRGTFDVVAVKAPGFGDRRKDMLGDIATLTGAQVISDELGYDLKDTELYMLGNAASVKVTKEATTIVGGAGFKEAIDERINQIRYQIDQTTSDFDREKLQERLAKLAGGVAVVRVGAATEVEMKEKKLRIEDALNATKAAVEEGIVAGGGTALVSVIPAVEESLEGEEKLGANIIRKALEEPLRQIAINAGLEGAVIVKNVMDADLHVGFDALNEEYVNMIEAGIVDPTKVSRTALQNAASIAGVFLTTEAAVADIPEKEADPMA---------GGMPGMM 539
143 0.000e+00 GL0129455 [Complete] locus=scaffold6506_6:745:2376:+  ali  59  1MAKQIKYGEEARKALEAGVNTLADTVKITLGPKGRNVVLDKKYGAPLITNDGVTIAKEIELKDPFENMGAQLVKEVSTKTNDVAGDGTTTAVVLAQAMIGEGLKNLAAGANPIVLKKGISKAVDVVVDELKAISKPVESKNSIAQVASISA-GDETVGELISEAMEKVGKDGVITIQESKTMKTELTTVDGMSFDRGYASAYMVTDTDKMIAVYDNPLILITDKKISSIQEILPVIEPIAQQGQKLMIIAEDVEGDALAALVVNKLKGVFNCVAVKAPGFGDRRKAMLEDIAILTGGKVISSELGLEFKDVTPDMLGRAGQIKVDKDNTVIIDGAGDRDEIKARIQSIKAQIAETTSDYDREKLQERLAKLAGGVAVINVGAATEVEMKEKKLRIEDALAATRAAVEEGIVPGGGTALLTAIPALKKKLSGDEKTGAEIILRAIEAPVRQIAKNAGLDGSVILNNIRTKNPNYGFDAYKNTYVDMVEAGIIDPTKVTRSALQNAASIASTLLTTESVVTDIPEPVQPMP................. 532
144 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  58  1MSKKILYGEEARKAIERGVNQLADTVKVTLGPKGRNVVLDKKYGAPLITNDGVTIAKEIELDDPFENMGAQLVKEVSIKTNDVAGDGTTTATVLAQAMIREGIKNVAAGANPMVMRRGMNKAIDVAVEAIKSNSTKVNGKADIAKVAAISAN-DETIGNLIADAMEKVSKDGVITIEESKTMATNLSVVEGMQFDKGYISPYMVTDTDKMEAVMDDPYILITDKKISNIQEILPILEKIVQQGKKLVIIADDVEGDALTTLVLNKLRGTFTCVAVKAPGYGDKRKEMLRDIAILTGGEVITDELGLDLKEVELEQLGRARQVKVEKENTIIVDGAGDKEQIAERVKQIRSELDRTESEYDKEKLQERLAKLVGGVAVIEVGAATEVEMKEKKLRIEDALSATRAAVEEGIVAGGGTAFVNAMPAVEKEVEGDEKTGVKTVLMALEEPLKQIAFNAGLEGSVILDKVLHEKTGVGFDALNEKYVDMKKEGIIDPTKVTRSALQNAASIASMVLTTESLVADKKEENCNCHHEGAQMPGGMD...... 542
145 0.000e+00JGI.Meta 7016939215 SRS052697_LANL_scaffold_70386__gene_146962 chaperonin groL [Human Stool microbiome from visit number 1 of subject 706846  ali  59  1MAKQFKYGEEARRALETGVNILADTVKITLGPKGRNVVLDKKYGAPLINNDGVTIAKEIELEDPFENMGAQLVKEVSVKTNDVAGDGTTTAAVLAQAIFHEGVKNIAAGANPMVLRKGIMAAVDTAVDSLKSISKPIESKTAISQVASISA-GDESVGSLIADAMEKVGKDGVITVEESKTLDTNLTIVEGMQFDRGYASSYMVTDTDKMEAVLDNPLILITEKKISSIQEILPVLEQVVQAGRKLLIIAEDVEGEALATLVVNKIRGTFTCVAVKAPGFGDRRKAMLQDIAILTGGQVISEELGLELKDTTMDMLGNARQVKVDKENTTIVEGAGSADAIKARVASIKAQIEETTSDYDREKLAERLAKLAGGVAVINVGAATEVEMKERKLRIEDALAATRAAVEEGIVPGGGTSFISAIPAVKEKLSGDEKTGAAIIMKALEAPIRQIAANAGLEGSVIVDKVLNGSVGFGFDAAKDEYGNMVEKGIIDPTKVSRSALQNAASVASVMLTTEALVADI-PAPEPAAPAPQGGMGGM....... 541
146 0.000e+00gi|496436853|ref|WP_009145698.1| molecular chaperone GroEL [Phascolarctobacterium succinatutens]  clstr ali  58  1MAKQILFNEEARRSLERGVNALADAVKVTLGPKGRNVVLEKKFGAPTITNDGVTIARDIELEDPFENMGAQLVKEVSIKTNDVAGDGTTTATVLAQAMINEGMRNVAAGANPMVLKKGIKKAVDVLVDELKNVSQKVETKAAKAQVASISA-ADDEIGNLIADAMEKVGDDGVITVEESKTMETHLETVEGMQFDRGYISPYMATDADKMEAVLSNPYVFITDRKITMIADIMPVLEKVVQNGGELLIIAEDVEGEALATLVVNKLRGTFKAVAVKAPGFGDRRKAMLQDIATLTGATVISEEVGRKLDSASMADLGRAGQVRVTKELTTIVDGLGDKDAIAARVAQIRAQIPETTSDFDKEKLQERLAKLAGGVAVIKVGAATEVELKDKKLRIEDALNATRAAVAEGIVAGGGTALLQVQPALAKKATGDEKTGVEIVKRAIEEPVRQIAYNAGLEGAVIVDTIKRSRKGYGFNALTEEYVDMIEAGIVDPTKVTRSALQNAASIASMVLTTESIVADKPAKE..................... 525
147 0.000e+00gi|575443805|gb|AHG75987.1| 60 kDa chaperonin [Mannheimia varigena USDA-ARS-USMARC-1296]  clstr ali  61  15.AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDRAYGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAVVEELKAISKPCETSKEIEQVGTISANSDSTVGQLIAQAMEKVGKEGVITVEDGTGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKVSNIRELLPVLEGVAKAGKPLVIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEELGQAKRVVISKDNTTIIDGIGDETQIKGRVAQIRQQIEDSTSDYDKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALVRAATKVAKGDNEEQNVGIKLALRAMEAPLRQIVANAGEESSVVARNVKDGSGNYGYNAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKDEKLDPAA............... 547
148 0.000e+00gi|653535947|ref|WP_027575248.1| molecular chaperone GroEL [Bradyrhizobium sp. WSM1743]  clstr ali  59  3.AKDLKFATEARERMLRGIDALANAVKVTLGPKGRNVVIERSFGAPRITKDGITVAKEIELEDRFENMGAQMVREVASRTSDIAGDGTTTATVLAEAIVKEGAKSVAAGMNPMDLKRGIDLAVDAIVHDLKSHARKVTANEEIAQVATISANGDAEIGKFLADAMKKVGNEGVITVEEAKSLSTELEIVEGMQFDRGYISPYFATNAEKMRVELEDVYLLIHEKKLSVLQTLLPLLEAVAQSGKPLLIVAEDVEGEALATLLVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDIGIKLENVTLDMLGRAKKVVVDKESTTIVDGAGAKKDIEARTTQIKMQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAHHATRAAVEEGILPGGGVALLRAQKALKRTANDDQKAGVEIVRRALRMPACQIAENAGEEGSLVVNKVLENDNNWGFNAATGEYQDMVKAGVIDPAKVVRTALQDASSIAALLITTEALVAEKPKKAETHA----PGMPPMD...... 540
149 0.000e+00gi|518802259|ref|WP_019958213.1| molecular chaperone GroEL [Vitreoscilla stercoraria]  clstr ali  61  3.AKEVKFGNDARQKMVEGVNVLANAVKVTLGPKGRNVVLDRAFGGPHITKDGVSVAKEIELKDKFENMGAQLVKEVASKTNDIAGDGTTTATVLAQAVVAEGMKYVTAGMNPMDLKRGIDKAVNALVEELKVIAKPVEKSKEIAQVASISANSDTSIGDIIAQAMNEVGKEGVITVEDGKSLENEVEVVKGMQFDRGYLSPYFINNAEKQIAELDAPFVLLYDKKISNIRELLPVLEQVAKTSRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTVIAEEVGLSLEKATLEDLGQAKRIEVGKENTTVIDGVGGKEVVDARVKEIRQQIEVSTSEYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGVVPGGGVALLRARSALVKGDNAEQDAGIKIVLRAIEEPLRQIVQNAGDEPSVVVNEVLKGEGNFGYNAGTGEYGDMLEMGVLDPAKVTRSALQHAASIASLILTTDAMVAEIPEDKPAMP................. 533
150 0.000e+00gi|647585767|ref|WP_025862935.1| molecular chaperone GroEL [Prolixibacter bellariivorans]  clstr ali  64  1MAKEIKFEIEARELLKKGVDQLADAVKVTLGPKGRNVIIDKKFGAPQVTKDGVTVAKEIELAEPYANMGAQLVKEVASKTGDDAGDGTTTATVLAQSIINVGLKNVTAGANPMDLKRGIDKAVAKVVESISAQSKTVGDDSKIEQVARISANNDLEIGKLIAEAMERVHKEGVITVEEAKGTETYVEVVEGMQFDRGYISPYFVTDTEKMSAELENPFILIHDKKISTMKDLVPILEATHQSGRPLMIISEDIDGEALATLVVNRLRAGLKVCAVKAPGFGDRRKEMLEDIAILTGGTVITDEKGMKLEDTTLEMLGQAEKITVDKENTTIVNGSGESSNIAARVAQIKNQIESTTSDYDREKLQERLAKLSGGVAVLYVGAPSEIEMKEKKDRVDDALSATRAAVEEGIVPGGGVAYIRAISVLEEGDNEDETTGIEIVKRAIEEPMRQIVANAGLEGAVIVNKVMEGKDDFGYNARIGEYQNLFESGVIDPAKVTRVALENAASIAGMFLTTECVLVEEKEEN..................... 528
151 0.000e+00gi|889549190|emb|CMT17325.1| 60 kDa chaperonin 2 (Protein Cpn60 2) (GroEL) [Mycobacterium tuberculosis]  clstr ali  57  1MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISA-GDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLDEKLEGDEATGANIVKVALEAPLKQIAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAVVADKPEKEKA................... 527
152 0.000e+00gi|517963933|ref|WP_019134141.1| molecular chaperone GroEL [Kallipyga massiliensis]  clstr ali  60  1MAKDIKYSDDARKAMQEGVNKLADTVKITMGPKGRNVVLEKSFGSPVITNDGVTIAKEIELEDRYENMGAQLVKEVATKTNDVAGDGTTTATLLAQALVQEGLRNLAAGANPMVLRKGMQKTTEETIRILKDHSKEVDTMAAIASVGSISS-GDEAIGQMIAEAMEKVGKDGVITVENSNTMENTLEVVEGMQFDRGYLSPYMVTDGEKMVAELEDPYLLITDKKISNIQEILPLLEQVMQSSKPLLIIAEDIEGEALATLVLNKIRGTLNVVGIKAPGYGDRRKEMLQDIAILTGGQVITEELGLELKNASIDQLGQAAKVNIDKENTVIVGGHGDAKTLEERVEHIKKQIEATDSDYDREKLQERLAKLSGGVGVIRVGAATETELKEKKLRIEDALSATRAAVEEGIVAGGGVALVDAIPAVKKKLEGDEKVGGAILLRALEEPLRQIVKNSGHEDSVVLHKVMEMEAGMGYDAYKDEYVDMFESGIVDPTKVTRSALQNAVSIVAMLLTTEAAVTDIPEKEEPAPVPGPG............ 536
153 0.000e+00JGI.Meta 7004764486 SRS013705_Baylor_scaffold_101732__gene_132746 chaperonin groL [Human Tongue dorsum microbiome from visit number 1 of sub  ali  58  1MAKQILFNEEARRALGNGVDALANAVKVTLGPKGRNVVLDKKFGAPTITNDGVTIARDIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAMIQEGMRNVAAGANPMILKRGVEKAVKRLVEEIQKRAIEVNDKEAIAQVASISA-GDEEVGGLIADAMEKVGKDGVITVEESKTMGTQLSVVEGMQFDRGYISPYMVTDPDKMEAVMSEPYIMVTDRKIASIQEMLPTLEKVVQAGKELLIIAEDVEGEALATLVVNKLRGTFKAVAVKAPGFGDRRKAMLQDIATLTGATVITEEVGRKLDSIGIEDLGTARQVRVTKDETTIVEGHGDAAAIKDRVAQIKAQIAETTSDFDKEKLQERLAKMSGGVAVIEVGAATEVELKDKKLRLEDALNATRAAVEEGIVAGGGTTFIDILPVLDEKEEGDVQTGINLVKRAVEEPVRQIAHNAGLEGSVIVAKVMDSPDGVGFNALKEEYVDMVKAGIVDPAKVTRTALQNAASIASLVLTTETLVSDKPEPAS.................... 526
154 0.000e+00gi|545654346|ref|WP_021761816.1| molecular chaperone GroEL [Desulfovibrio gigas]  clstr ali  63  3.AKEILFDTHARERLQRGVDKLANAVKVTLGPKGRNVVIEKSFGSPIITKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQSIFNEGVKLVAAGRNPMAIKRGIDKAVAAIVAELGSFAKPTRDQKEIAQVGSISANNDPTIGNIIAEAMNKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFITDPEKMVCEMDEPLILVHDKKISSMKDMLPVLEQVAKMAKPLLIIAEDVEGEALATLVVNKLRGTLQVTAVKAPGFGERRKAMLEDIAVLTGGTLAAEEMGKKLENVTLEDLGRAKRVVIDKENTTIVDGYGESDAIKARIKQIRAQIDETTSDYDREKLQERLAKIVGGVAVINVGAATETEMKEKKARVEDALNATRAAVEEGIVPGGGVALVRCSKVLADALDDDEQAGVNIIRRAVQEPLRMIASNAGVEGAIVLEKVMGGTDGYGYNAASCEYVDLIAEGVIDPKKVTRIALQNASSVASLLLTTEAAIA........................... 522
155 0.000e+00gi|931537830|gb|KPL13749.1| molecular chaperone GroEL [candidate division WOR_3 bacterium SM1_77]  clstr ali  61  3.AKEIRFNEEARRSIQRGVKLLSDAVKVTLGPKGRNVILEKKFGAPTITKDGVTVAKEIDLEDKFENVGAQMVKEVASKTSDVAGDGTTTATILAEAIYREGLKTVTAGANAMEVKKGIDKAVEDVVAALKKLSTPIKGSTDIAQVAAISANNDETIGKLIADAMEKVGKDGVITVEEAKGMETTLDVVEGMQFDRGYLSPYFITNPERMECVLEDAYILLYEKKISAMKDLVPMLEKVAQKGRPIVILSEEVEGEALATLVVNKIRGTLACAAVKAPGYGDRRRAMLEDIAVLTGGKLISEDIGIKLENVQVADLGHAKRITIDKENTTIVEGAGKKDDIQARIGQIKNEIEDTTSDYDKEKLQERLAKLAGGVAVLNVGAATEVAMKEKKARVEDALHATRAAIEEGIVPGGGVAFIRSLPELAKKLPGDQQIGVEIVRRALEEPTRQLAANAGKEGSVIVEQVKKDKLSVGYNVMTEKFEDMVAAGIIDPTKVSRTALQNAASIASLLVTTEAVVVEKPEEEKPSMAPP.............. 534
156 0.000e+00gi|973059614|gb|KUK32214.1| 60 kDa chaperonin [Thermoanaerobacterales bacterium 50_218]  clstr ali  59  1MPKELNFREEARYALERGVDILANTVKVTLGPKGRNVVLEKKFGPPQITNDGVTIAKEIDLEDPWENMGAQLIKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVAAGANPMLLKRGIERATAAAVEELKKLAKPVESKEAIAQVASISS-GDKEIGKWVADAMEKVGNDGVITVEESKTIGTTLEVVEGMQFDRGYISPYMVTDPEKMEADLEEPYLLLVEKKVSAAADIIPILEKVAQTGRPLVVIAEDVEGEALATLVVNKLRGTISCAAVKSPGFGERRKAILRDIAILTGGQVVSEEAGMKLENVTLDMLGRAGRVKIGKEETTIIDGHGSPEAIEKRIAQIKSEYEQSTSEYDREKLQERMAKLSGGVAVIKVGAATEVELREKKHRIEDALAATKAAVEEGIVAGGGVALINVIPALEKEAEGDEATGINIVKKALEEPLKQIAINAGQEGSVVVEKVKAMEPGKGFNALTGCYEDMFEAGIIDPAKVTRTALQNAASIAAMVLTTECLIXXXXXXXXXXXMPQMPPM.......... 537
157 0.000e+00gi|497443610|ref|WP_009757808.1| molecular chaperone GroEL [Ahrensia sp. R2A130]  clstr ali  61  3.AKEVKFGSDARTRMMRGVDILADAVKVTLGPKGRNVILDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDAAVDEVVASLKKMSKKIKTSDEVAQVGTISANGEAEIGGRIAEAMQRVGNEGVITVEEAKSLESTLDVVEGMQFDRGYLSPYFVTNPEKMLCELDDPYILLHEKKLTSLQAMLPILEAVVQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDLAVLTGGSVISEELGIKLEGVTLDMLGTAKRVSISKEETTLVDGAGKKKDVEGRVSQIKKQIDETSSDYDREKLQERLAKLAGGVAVISIGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALLRASNNMKEGENADQAAGVAIVKRALQAPIRQIAENAGDEGSVVVGKILDQKATYGYNAANGEYGDMVAMGIIDPVKVVRHALQDAASIASLLITTEAMVAEKPAKE..................... 528
158 0.000e+00gi|524464446|emb|CDC05725.1| 60 kDa chaperonin [Clostridium sp. CAG:343]  clstr ali  60  1MAKVIKFGEDARKSLLEGVNKLADTVKVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDKFENMGARLVKEVSTKTNDVAGDGTTTATVLAQSMIKEGVRNVAAGSDPMAIKRGIDKAVNTAVEGLKEISSTVNGKEDIARVASISANN-EEIGNLIADAMEKVSKDGVITIEESKTSNTELNVVEGMQFDKGYLSPYMATDTEKMEAVLDNPYILITDKKISNIQEILPLLESLMQESGKLLIICDDMEGEALSTLILNKLRGVLNVVAVKAPGFGDKRKAMLEDIAVLTGGEVITSDLGLELKDTTIAQLGKAKQVKVQKENTIIVDGAGDKQKIADRVGQIKAQINETQSDYDKEQLQERLAKIAGGVAVIGVGAATEVEMKDKKLRIEDALSATKAAVEEGIVSGGGTALINVIPKVSKTLENGEKLGAQIVLKALEEPVKQIAVNAGLEPAVIVNKVKESEAGIGFDAANEQYVDMKKVGIVDPTKVTRSALQNAASIASMVLTTESLVTDAPEPKNCNCGSQEGGMPGMDGM.... 545
159 0.000e+00gi|518368793|ref|WP_019539000.1| molecular chaperone GroEL [Proteiniphilum acetatigenes]  clstr ali  62  1MAKEIKFNMDARDLLKKGVDELADAVKVTLGPKGRNVIIDKKYGAPQITKDGVTVAKEVELDDAFQNMGAQLVREVASKTNDDAGDGTTTATVLAQSIIGVGLKNVTAGANPMDLKRGIDKAVATVVDNLKNQAVEVNDLKKIENVAKISANGDETIGKLIAEAMQKVSKEGVITVEESKGTDTYVDVVEGMQFDRGYISPYFVTDTEAMEVDFENPLILIHDKKISAIKDLLPILEKGIQTGKPLLIIAEDIDSEALTTLVVNRLRGSLKVAAVKAPGFGDRRKEMLEDIAILTGGVVISEEKGLTLENASLDMLGSAEKVTIDKDTTTIVNGDGEKEAISNRIGQIRAQIEKTTSDYDREKLQERLAKLAGGVAVLYVGAPSEVEMKEKKDRVQDALSATRAAVEEGTVPGGGVAYVRAIEALEKGENEDETTGIEIVKRAIEEPLRQIVSNAGKEGAVVVQKVREGKADFGYNARTDQYENLYETGVIDPAKVTRVALENAASIAGMFLTTECVITDKKEENPA................... 530
160 0.000e+00gi|499961826|ref|WP_011642544.1| molecular chaperone GroEL [Maricaulis maris]  clstr ali  60  3.AKDVLFGSDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELADKFENMGAQMLREVASKTNDVAGDGTTTATVLAQSIVREGMKSVAAGMNPMDLKRGIDKAVAIVMDDIKASSTPVKDSSEVAQVGTISANGASDIGEMIAKAMDKVGKEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITDADKMQVEMEEPYILLFEKKLTSLQPMLPILEAVVQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDLAILTGGQVISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIRRQSEETTSDYDREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLKASAKLAEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPATFGFNAQTEEYGDMLAFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKEE..................... 529
161 0.000e+00gi|500018477|ref|WP_011699195.1| molecular chaperone GroEL [Syntrophobacter fumaroxidans]  clstr ali  59  1MAKEIKYYAEAREKIMAGVDTLADAVKVTLGPRGRNVVLEKSWGPPTVTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTSDVAGDGTTTATILAQAIYRAGSKLVSAGHNPMALKRGIELAVAAAVRELRNMSKPTKDQKEIAQVGTISANNDVAIGDIIAEAMNKVGKEGVITVEEAKSMETTLEVVEGMQFDRGYVSPYFVTDPERMEVVLEDPYILINEKKISNMKDLLPVLEQIAKMGAPLLIVAEDVEGEALATLVVNKLRGTLKVSAVKAPGFGDRRKAMLEDLAVLTGGKVVSEDIGVKLENVSLQDLGRAKTVRIDKDNTTIVDGAGARSAIEARVKQIRAQIDETTSDYDREKLQERLAKIVGGVAVVRVGAATETEMKEKKARVEDALNATRAAVEEGIVPGGGVALLRCLPALEKDLHGEDAFGVKIVMRALEEPVRQIANNAGHEGSVVVQQVKQGTGSHGFNADTEVYEDLSAAGVIDPTKVVRFALQNAASVASLLLTTEAMIAEKPKKQKPAPAMPGAGMEDM....... 541
162 0.000e+00gi|818647244|gb|KKS93978.1| 60 kDa chaperonin [Parcubacteria group bacterium GW2011_GWA2_43_13]  clstr ali  62  1MAKQILFDEKARQAMKRGVDQLANAVKVTLGPKGRNVVLDKGFGSPTITKDGVSVAKEIELEDKFENIGAELVKEVASKTNDVAGDGTTTATVLAQNMIAVGMKNVTAGASPIAMKRGMDRAVEIVVEELKKLSKEVSGKQEIGQVAAISAN-DPDIGNKIAEAMEKVGKDGVITVEEAQSFGIQTELVEGMQFDRGYVSHYMVTNAERMEAELDDPVILITDKKISAIADILPLLEKLAQSGRKLVILAEDVDGEALATLVVNKLRGTFHTLAVKAPGFGDRRKEVLQDIAILTGGRVISEEIGLKLENAEVDMLGTARKVIATKENTTIIEGRGDEKAIKDRINQIKKQIEETDSDFDREKLQERLARLSGGVAIIKVGAASEVEMKEVKHRIEDALSATKAAVEEGIVPGGGVAFLRAQEALHLNVEGDEKIGIEIVRRALEEPLRQIASNAGKDGSIVVEEVRKLKGTMGYNAEKNEYEDMLSAGIVDPTKVTRSALQNAASVAGMFLTIEAVITELPEKKEGPAHGGMPQGMGMD...... 541
163 0.000e+00gi|349858777|gb|AEQ20433.1| chaperonin GroEL protein [uncultured bacterium CSL12]  clstr ali  60  1MAKDVKFHDSARAKIVAGVNILADAVKITLGPKGRNVVLERSYGAPTITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIVKEGMKFVAAGMNPMDLKRGIDKAVESVVAELKKISKPTTTSKEIAQVASISANSDSSIGEKIAEAMEKVGKEGVITVEDGKSLVMELEVVEGMQFDRGYLSPYFINTPDKQISILEDAYILLSEKKISTIRDLLPVLEQVAKAGKPLLIIAEDVDSEALATLVVNNLRGILKTCAVKAPGFGDRRKAMLEDIATLTGGTVIAEEVGLSLEKVALTDLGRAKRIEIGKEETTVIDGAGDAKAIQDRVKTLRKQIEDTTSDYDKEKLQERVAKLAGGVALIKVGAATETEMKEKKARVEDALHSTRAAVEEGIVAGGGVALLRARSALNKGDNHDQEAGIKIVLRALEEPLRCIVANAGEEPSVVLDKVVQSKGNFGYNAQTGEYGDLVEMGVVDPTKVTRAALQNAASVAGLILTTDAMVAESPREESS................... 530
164 0.000e+00gi|652814813|ref|WP_027106113.1| molecular chaperone GroEL [Lachnospiraceae bacterium V9D3004]  clstr ali  59  1MAKEIRYGAEARKSLEIGVNKLADTVSVTLGPKGRNVVLDKSYGAPLITNDGVTIAKEIELEDGFENMGAQIVKEVATKTNDVAGDGTTTATVLAQAMINEGMKNLAAGANPIILRKGMHKATECAVDAIKKMSRKLSGKNQIAKVAAISA-GDEQVGEMVADAMAKVSKDGVITIEESKTMLTELDLVEGMQFDRGYVSAYMCTDMDKMEANLDDPYILITDKKISNIQEILPLLEQIVQSGSRLLIIAEDVEGEALSTLVINKLRGTFQVVAVKAPGYGDRRKDMLRDIAILTGGQVITEELGLDLKETTMDQLGRAKSVKVQKENTIIVDGLGDKAEIDARVSMIKKQIEETTSDFDREKLQERLAKLAGGVAVIRVGAATETEMKEKKLRMEDALNATRAAVEEGIIAGGGSAYIHASKKVEEKLEGDEKTGANIILKALSAPLFKIAENAGVEGSVIINKVYESKTGTGYDALTDEYVDMVKTGILDPAKVTRSALQNATSVASTLLTTESVVSTIKEETPAMPA-GAPGMGMM....... 540
165 0.000e+00gi|671491940|ref|WP_031482970.1| molecular chaperone GroEL [Desulfovibrio frigidus]  clstr ali  63  1MAKQILFDAKAREKLKIGVDKLADAVKVTLGPKGRNVVIDKSFGSPVITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAVFAEGVKLVAAGRNPMAIKRGIDKAVEAIIDHLEVLAKPTRDQKEIAQVGTISANNDVTIGNIIAEAMNKVGKEGVITVEEAKGIDTTLDVVEGMQFDRGYLSPYFVSNAEKMICEMDEPLILVSEKKVSSMKELLPVLEQVAKMSKPLVIIAEDIDGEALATLVVNKLRGTLNVVAVKAPGFGERRKQMLSDIATLTGGSVVSDELGLQLEGVTLEDLGSAKRIVIDKDNTIVVDGAGKVDAIKARVSQIRSEIDDTTSDYDREKLQERLAKIVGGVAVINVGAATETEMKEKKARVEDALNATRAAVEEGIVAGGGTALIRCLPALDKPSDDDETAGINIIRRAIEEPLRQIAANAGLEGSVVVEKVKLSKDGHGFNAAIGEYVDLIKAGVIDPKKVTRIALQNAASVAGLLLTTECAIAEKPVKAAADAGMPA............. 535
166 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  62  1MAKEIKFNIEAREQMKQGVDQLANAVKVTLGPKGRNVIIEKKFGAPHITKDGVTVAKEIELADAFQNAGAQLVKSVASKTGDDAGDGTTTATVLAQSIVSVGLKNVAAGANPMDLKRGIDKAVAKVVEYIKSQAEQVGDDSKIEQVATVSANNDPEIGKLLADAMQKVSKDGVITIEEAKGRDTTIGVVEGMQFDRGYLSAYFVTDTEKMECVMENPYILIYDKKISNLKDFLPILEPAVQSGRPLLVIAEDVDSEALTTLVVNRLRSQLKICAVKAPGFGDRRKAMLEDIAVLTGGVVISEEKGLKLEQATIEMLGSCDKVTISKDNTTIVNGHGQSELIKDRVNQIKNEIANTKSDYDKEKLQERLAKLSGGVAVLYVGAPSEVEMKEKKDRVDDALCATRAAIEEGIIAGGGVAYIRATSVLDKGDNADETTGINIVKRAIEEPLRQIVENAGLEGSVVVEKVRQGEGDFGYNAREDKYENLKASGIIDPAKVTRVALENAASIAGMFLTTECVICDKKEDKPEMP................. 532
167 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  60  20MAKEIKYGAEARAALEAGVNQLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMVNAGMKNLAAGANPIILRKGMKKATACAVETIGKMSQKVNGKEHIARVAAISA-GDEAVGQLVADAMEKVSNNGVITIEESKTMQTELDLVEGMQFDRGYISAYMATDMDKMEAVLDNPYILITDKKISNIQEILPLLEQIVQSGAKLLIIAEDVEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKAMLEDIAILTGGTVISSELGYELKDTTMDMLGRAKSVKVQKENTVIVDGEGDKEALQSRIAQIKKQIEETTSDFDREKLQERLAKLSGGVAVIRVGAATETEMKEAKLRLEDALAATRAAVEEGIICGGGSAYIHASKEVAKTLEGDEKTGAGIVLKALEAPLYHIAANAGLEGSVIINKVRESEVGVGFDALKEEYVDMVSAGILDPAKVTRSALQNATSVASTLLTTESVVANIKEE...................... 545
168 0.000e+00gi|951508674|ref|WP_057874366.1| molecular chaperone GroEL [Lactobacillus rennini]  clstr ali  59  1MAKELKFSESARSSMLQGVDKLADTVKTTLGPKGRNVVLEKSYGSPTITNDGVTIAKDIELEDRFENMGAKLVAEVASKTNDNAGDGTTTATVLAQAIVREGMKNVTAGANPVGIRDGIEKATKAAVDQLHKISHKVDGKSDIAQIAAVSSSN-KEVGKLIADAMEKVGNDGVITVEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNEKMEADLDNPYILVTDKKISNIQEILPLLQKIVEQGKALLIIADDVEGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIAALTGATLITSDLGLELKDTDISQLGQAGKVTVTKDNTTIVEGAGDKDAINNRVSEIKAQIAETTSDFDREKLQERLAKLAGGVAVVRVGAATETELKEQKYRIEDALNATRAAVEEGYVAGGGTALINILKAVDLKEDGDVQTGINIVLRALEEPVRQIAENAGVEGSVVVEHMKTMDPEVGYNAANGKWENMIEAGIIDPTKVTRSALQNAASVSSLLLTTEAVVADKPEPDN.................... 526
169 0.000e+00gi|502024749|ref|WP_012697347.1| molecular chaperone GroEL [Laribacter hongkongensis]  clstr ali  61  3.AKDVKFGDSARSKMVDGVNILADAVKVTLGPKGRNVVLERSYGAPTITKDGVSVAKEITLKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQAIMQEGMKYVAAGMNPIDLKRGIDKAVVALVAEIKNIAKPCATTKEIAQVGAISANSDTVIGDKIAAAMEKVGKEGVITVEDGSGLEDELEVVEGMQFDRGYLSPYFINQPEKQIAQLDNPFILLCDKKITNIRELLPVLEQVSKAGRPLLVIAEDVEGEALATLVVNNMRGILKTVAVKAPGFGDRRKAMLEDIAILTGGTVISEEIGLPLEKATIDMLGQAKRIEVSKDTTTIIDGVGTAEAIKARVEQIRAHIETASSDYDREKMQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALLRARANLKEVANAEQAAGVQIVMRAIESPLRQIVANAGDEPSVVVNKVYEGSGNFGYNAATGEYGDLVEMGVLDPAKVTRSALQHAASVAGLMLTTDCMVAELPEDKPAMPA................ 534
170 0.000e+00gi|651261272|ref|WP_026394611.1| molecular chaperone GroEL [Acetobacterium dehalogenans]  clstr ali  61  1MAKEIKFREDARAGLITGVDKLANTVKVTLGPKGRNVILSKSYGSPTITNDGVTIAKEIELEDAFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIVREGNRNVVAGANPMVLKKGIEKAVAAVVEELKANSKKIESKEAIAQVASISA-ADAEIGKLISEAMDKVGDDGVITVEEGKGMGTELEFTEGMQFDRGYLSAYMVTDTEKMVAILDNPYILITDKKISNIQEILPVLEQIVQTGSKLLIIAEDVEGEALATLVVNKLRGTFNCVAVKAPGFGDRRKAMLADIAALTGGEVISDELGLELKTTTIEQLGRARQVKVDKEDTIIVEGSGNKDAVEERIRQIKAQIPETSSEYDKEKLQERLAKLSGGVAVIQVGAATETELKEIKYRIEDALNATRAAVEEGVVSGGGTAYINAIPKVDETLEGDEKTGAYIIRRAIEEPMRQIAENAGLEGSVIVSQMAGKAIGVGYDAAKGEFVDMFKAGIIDPTKVTRSAIQNAASVSAMFLTTEVAVADLPSEDA.................... 528
171 0.000e+00gi|984720682|gb|AMB94243.1| molecular chaperone GroEL [Aerococcus sanguinicola]  clstr ali  57  1MAKDIKFSEDARQALVRGVDKLANTVKITLGPKGRNVVLEQSYGSPLITNDGVTIAKDIELEDHFENMGAKLVAEVASKTNDVAGDGTTTATILTQAIVREGLKNVTAGANPVGVRRGIDEAIRTAVEGLKENSVQVESQDAIANVAAISS-GDQEVGKLIAEAMGKVGEDGVITIEDSKSIDTTLDVVEGMEFDRGYLSQYMVTDNEKMEASLENPYILLTDRKISNIQDILPLLEQILQQGSPLLLIADDVDGEALPTLVLNKLRGTMNVVAVKAPGFGDRRKEMLEDLAVLTGGQVISEDLGLELKDATINHLGKAGSVTVTKDHTTVVEGGGNKEQLEQRIALIRKQIEESTSDYDREKLQERLAKLAGGVAVVKVGAATESEQKERKLRIEDALNATRAAVEEGIVAGGGTALMNVQDKVEKALEGDAATGARIVARALEEPLRQIVENAGLEGSVIVERLRSKDQGIGFNAQNNEWVDMIEAGIVDPTKVTRSALQNAGSVAGLILSTESVVADKPEPE-APAVDPSAMAGGM....... 540
172 0.000e+00gi|260222491|emb|CBA32107.1| 60 kDa chaperonin 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  61  3.AKEVKFHDGARTRILKGVNVLADAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELKDKFENMGAQMVKQVASKTADVAGDGTTTATVLAQAIVKEGMKYVTAGMNPMDLKRGIDKATEAVVAELKALSKPCSTNKEVAQVAALSANSDSAIGDIIAKAMEKVGKEGVITVEDGKSLDNELDVVEGMQFDRGFISPYFVNNADKQTCVLDEPLVLLHDKKISNIRDLLPVLEEVAKAGRPLLIIAEDLEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGGTVIAEEVGKQLDKTTLADLGRAKRVEIHKDTTTIIDGAGDQSAIKARVATLRAEIENSTSDYDKEKLQERIAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRARAAIKKGANEDQDAGIKIVLRAIEEPLRAIAFNAGDEASVVIDKVLAGKGAWGYNAGTSQYGDLIEMGVIDPTKVTRTALQNAASVAGLILTTDASVAEAPKEEKATA-PASADMD......... 539
173 0.000e+00gi|740771189|ref|WP_038556473.1| molecular chaperone GroEL [Draconibacterium orientale]  clstr ali  63  1MAKEIKFDIEARDLLKSGVDQLANAVKVTLGPKGRNVVIEKKFGAPQITKDGVTVAKEIELSDAYENMGAQMVKEVASKTGDDAGDGTTTATVLAQSIVNVGLKNVTAGANPMDLKRGIDKAVEAVVASIKEQAQTIGDDAKIESVAKISANNDAVIGSLIAEAMKKVHKEGVITIEEAKGTDTYVDVVEGMQFDRGYLSPYFVTDAEKMVAELDNPFILIHDKKISTMKDLLPVLEATAQTGRPLMIISEDVDGEALATLVVNRLRGSLKVCAVKAPGFGDRRKEMLEDIAILTGGTVITEEKGMKLEQATIDMLGQCEKITVDKENTTVVNGAGAQEAIAARVNQIKTQMETTTSDYDKEKLQERLAKLAGGVAVIYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALVRAIAALEKGENEDETTGVEIVKRAIEEPLRQIVANAGKEGAVVVQNVKDGEGDYGYNARTDEYQKLYEAGVIDPAKVTRVALENAASIAGMFLTTETVIVEVKEDAP.................... 529
174 0.000e+00gi|647358264|ref|WP_025773359.1| molecular chaperone GroEL [Moorella thermoacetica]  clstr ali  59  1MAKQVVFDREAREALEKGITKLTEAVRVTLGPRGRNVVLEKKFGAPTITNDGVTIAKEVELEDPLENVGALLVREVASKTNDVAGDGTTTACVLAQAIVREGMKNVAAGANPMFMKRGIEKAVAAVVENLKAQARPVETKDSISQVASISAN-DPQIGALVADAMEKVGKDGVITVEESKGMETAVDVVEGMQFDRGYISPYMVTDNERMEAVLEEPYILITDKKITAVADLVPVLERVVRTGKPLLIICEDMEGEALATLVVNKIRGTFTCVAVKAPAFGDRRKAMLQDIAILTGGQVITEEAGLKLENTTLDMLGQARQVRVGKEETTIVEGRGKEEAIEARIAQIRREYEESTSDYDREKLQERLAKLAGGVAVIKVGAATETEMKEKKMRIEDALAATRAAVEEGIVPGGGTALVRAQAALDVQAQGDELTGVRLVYRALEEPMRQIAANAGVDGSVVVEKVRQSGDSMGFNAATREYVNLFEAGIVDPLKVTRSALENAASIASLVLTTESLIADIPEEE..................... 525
175 0.000e+00gi|750522065|ref|WP_040803934.1| molecular chaperone GroEL [Zhongshania aliphaticivorans]  clstr ali  59  2MAKDVVFGNEARQRMVAGVNILANAVKVTLGPKGRNVVLEKSYGAPTITKDGVSVAKEIELEDRLENMGAQMVKEVASRASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDIKRGIDKAIAAAVEEVKKLSSPCADTKAIAQVGTISANSDSNIGDIIAEAMDKVGKEGVITVEEGQGLHNELDVVEGMQFDRGYLSPYFVNNTENMSVEHDSPYILLADKKISNIREMLPLLEQVAKSSRPLIIVAEDVEGEALATLVVNTMRGIVKVAACKAPGFGDRRKAMLQDLAILTGGTVISEEVGLDLEQATLEHLGTAKRVTMDKENTVIVDGAGDAAAIQSRVAEIRTQIENTSSDYDREKLQERVAKLAGGVAVIKVGAATEMEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRAITNIGEGDNEDQTAGINAALRALEAPLRQIVTNAGDEASVVLDKVRNGTGNFGYNAGTGEYGDMMEMGILDPAKVTRTALQAAGSVAGLIITTECMIADAPKAES.................... 529
176 0.000e+00 GL0021632 [Complete] locus=scaffold3438_1:220:1848:-  ali  60  3MAKEIKYGAEARAALEKGVNQLADTVRVTLGPKGRNVVLDKSFGTPLITNDGVTIAKEIELEDGFENMGAQLIREVAAKTNDVAGDGTTTATVLAQAMVNEGMKNLAAGANPIVLRKGMKKATDAAVEAIANMSRQVTGKDQIAKVAAVSS-GDEAVGNMVADAMEKVSKDGVITIEESKTMQTELDLVEGMQFDRGYISAYMATDMEKMEAVLDDPYILITDKKISNIQDLLPLLEQIVQSGARLLIIAEDIEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKEMLNDIAILTGGQVISDELGMDLKEATMDLLGRAKSVKVQKENTVIVDGCGDKKAIEDRVAQIKKQIEETTSEFDREKLQERLAKLAGGVAVIRVGAATETEMKEAKLRMEDALNATRAAVEEGIIAGGGSAYIHASKEVAKTLEGDEKTGANIILKALEAPLFHIATNAGLEGAVIINKVRESEPGVGFDAYKEEYVDMVSEGILDPAKVTRSALQNANSVASTLLTTESVVSTIKEETPAMPTAP-GGMGMM....... 542
177 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  58  10MAKQIKFGEDARKSLLEGVNKLADTVKVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDKFENMGARLVKEVSEKTNDVAGDGTTTATVLAQAMIKEGVKNVAAGADPMAMKRGIDKAVKSAVEELKTISVPVNGKDDIARVASISANND-EVGELIAEAMEKVSKDGVITIEESKTSTTQLNVVEGMQFDKGYVSPYMVTDTEKMEAIVDNPYILITDKKISNIQEILPLLEALMQQSGKLVIICDDIEGEALSTLVLNKLRGVLNVVAVKAPGFGDKRKAMLQDIAILTGGEVITSDLGLELKDTQIEQLGRARQVKVQKENTIIVDGSGDKQQIADRVGQIKAQINETKSEYDKEGLQERLAKMAGGVAVIEVGAATETEMKDKKLRIEDALSATKAAVEEGIVAGGGTALINVVPAVEKTVNGGEKLGAEIVLKSLEEPVKQIARNAGLEPAVIADNVRKSEVGVGFDASKEEYVDMKKAGIVDPTKVTRSALQNAASIASMVITTESLVTDIPEKDCHCGHEGGMGASGMEGM.... 553
178 0.000e+00gi|518796037|ref|WP_019951991.1| molecular chaperone GroEL [Kushneria aurantia]  clstr ali  60  3.AKNIRFSDDARKRMARGVNTLADAVKTTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDAAGDGTTTATVLAQSIVNEGLKGVTAGMNPMDLKRGIDMAIQKAVEEIRTMSVPCTDSKAIAQVGTISANGDATIGQIIADAMQKVGKEGVITVDEGRGFEDELEVVEGMQFDRGYLSPYFVTNQETMAVEQEDPYILLVDKKISNIRELLPVLESVAKAGKPLMIIAEDIEGEALATLVVNNMRGIVKVAAAKAPGFGDRRKAMLQDIAILTGGTVISEEVGLTLEQATLDHLGSARRVTMSKENTTVIDGNGVEADIEARVSQIRAQIEETSSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHSTRAAVEEGVVPGGGTALVRAAARLHDGNNEDQTHGIQLTIRALESPLRQIVTNAGEEASVILNRVRDGEGNFGYNAQTGEYGDLFDMGVLDPAKVARTALQSAGSVGGLMITTEAMIAEDPDEKES................... 530
179 0.000e+00gi|517072471|ref|WP_018261289.1| molecular chaperone GroEL [Methylobacterium sp. WSM2598]  clstr ali  62  3.AKDVRFSADAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGIDLAVAAVAEDLKQNSRKITRNDEIAQIGTISANGDAEIGRMLAEAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGEKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAMHATRAAVEEGIVPGGGAALLRAKAAAQKSDNADVQAGINIVVRALEAPIRQIAENAGVEGSIVVGKVAEGSATFGFDAQNETYVDLIEAGIVDPVKVVRTALQDAASVAGLLVTTEAMVADAPKKEAPPAMP............... 535
180 0.000e+00gi|654802152|ref|WP_028255856.1| molecular chaperone GroEL [Veillonella magna]  clstr ali  58  1MAKEILFNEDARRALGRGVDALANAVKVTLGPKGRNVVLDKKFGAPTITNDGVTIARDIELADPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIQEGMRNVAAGANPMILKKGIEMAVNTLVDEIKKRAIKVNGKADIAQVASVSA-ADTEIGGLIAEAMEKVGNDGVITVEESKGLQTDLNVVEGMQFDRGYISPYMVTDADKMEAVMNDPYILITDRKISAIADLLPTLEKVVKQGKELLIIAEDLDGEALATLVVNKLRGTFKAVAVKAPGFGDRRKAMLEDIAILTGGTVITEDMGRKLDSVDLVDLGSARQVRVTKDETVIIDGVGDSEAIKQRVSQIRGQLDETTSEFDREKLQERLAKLSGGVAVIEVGAATEVELKDKKLRIEDALNATRAAVEEGIVAGGGTTFIDIVSALDLHEEGDVQTGINLVKRAVEEPLRQIAYNAGLEGSVVVEKVKNTDAGIGFNALTEEYTDMVKAGIVDPAKVTRSALQNAASIASLVLTTETIVADKVEEN..................... 525
181 0.000e+00gi|503144690|ref|WP_013379351.1| molecular chaperone GroEL [Eubacterium limosum]  clstr ali  62  1MAKDIKFSADARESLIAGVDKLADAVKVTLGPKGRNVILAKSYGAPTITNDGVTIAKEIELEDAFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIVREGNRNVVAGANPMVLKKGIEKAVEVVVDELKANSKPVETREAKAQVASISA-ADTEIGDLIAEAMTKVGDDGVITVEEGKGMGTELEFTEGMQFDRGYLSGYMVTDTEKMVAELDNPYILITDKKITNIQELLPVLEQIVQQGAKLLIIAEDVEGEALTTLVLNKLRGTFNCVAVKAPGFGDRRKAMLQDIAALTGGQVISEEVGLELKNADMSMLGRARQVKVDKDNTIVVDGQGDRAVVEERVAQIKAQIPETTSDYDKEKLQERLAKLAGGVAVIQVGAATEVELKERKYRIEDALNATRAGVEEGMVPGGGSAFIETLDKVDETLEGDEKIGATIIRRAIEEPVRQIAENAGLEGSVIVNELRKKDTGVGFNAATGEFVNMIEAGIIDPTKVTRTAIQNAASICAMFLTTEVAVADLPEE...................... 526
182 0.000e+00JGI.Meta 7064307180 SRS019064_WUGC_scaffold_11337__gene_10134 chaperonin groL [Human Right Retroauricular crease microbiome from visit numbe  ali  60  3.AKDILFGNGARQKMVAGVNTLADAVKVTLGPKGRNVVIDRSFGGPNITKDGVTVAKEIELKDKFENMGAQMVKQVASKTSDVAGDGTTTATVLAQSLIAEGMKFVAAGMNPMDLKRGIDKAVTAIVKEIQSISQSCNNTKAIRQVGSISANSDESIGNIIAEAMEKVGKEGVITVEDGKSLQNELEVVEGMQFDRGYLSPYFITDTEKQIAALDSPYILLTDKKITNIRELLPLLEQVAKAGHPLLIIAEDVEGEALATLVVNNIRGTLKTVAVKAPGFGDRRKAMLQDIAILTGGTVVAEEVGLSLEKAELAQLGQASRVEIAKENTTIINGAGDKSAIQARVKEIRQQIESATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRAAQAITKGDNSEQDAGIKIVLNAVKAPLSQIIRNAGDEAAVVVDKVLNGKQNFGYNAATSEYGDMFEMGVLDPAKVTRTALQHAASVAGLMLTTDCMITDEPEDKKDLA................. 532
183 0.000e+00gi|518059547|ref|WP_019229755.1| molecular chaperone GroEL [Sedimentibacter sp. B4]  clstr ali  60  1MAKIIKFDEDARRSMERGVNALADTVKVTLGPKGRNVVLQKSFGSPVITNDGVTIAREIELADPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVAAGANPMILKRGIQAAVEAAVAELKSTTKKVETSEEIAQIASISA-GDEEIGKLISEAMDKVGKDGVITVEESKTMGTDLTVVEGMQFDRGYLSAYMVTNTEKMEAVMDNPYILITDKKISNIQEILPILEQIVQSGRSLVIIAEDIEGEALTTLILNKLRGTFNCVAVKAPGFGDRRKEMLRDIAILTGGQVITEELGYELKDTTIDMLGNAATVKIDKENTIIVHGAGSQEEIAERAKQIKSQYEESTSEFDREKLQERLAKLTGGVAVINVGAATETEMKDKKLRIEDALNATRAAVEEGLVSGGGVALLKVVSEVAAGLTGDAKTGAKIIEKALEEPVRQIAANAGLEGSVIVEKIKNSAKGIGFDALNEKYVNMIEAGIVDPTKVTRSALQNAASVASMLLTTEAAVADEPKKDE.................... 528
184 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  59  1MAKQILFDEEARRALGRGVDALANAVKVTLGPKGRNVVLDKKFGAPTITNDGVTIARDIELEDPFENMGAQLVKEVATKTNDIAGDGTTTATLLAQAMIHEGMKNVAAGANPMIIKKGIDEAVKTLVDEIKAKSKKVEGQADIAQVATISSAN-EETGKLIAEAMEKVGKDGVITVEESKTMRTNLSVKEGMQFDRGYISPYLVTDTDKMEATLDDPYILITDRKISAINDILPILEQVVKAGKQLAIIAEDVDGEALTTIVVNKLRGTFKALAVKAPGFGDRRKAMLQDIATLTGGTVISEELGRKLDSVTLADLGQAHKMVSTKDETTIIGGKGDKEAIAERVAQIKQQISQTTSDFDREKLQERLAKLSGGVAVIEIGAATEVEMKDKKYRIEDALNATRAAVEEGIVAGGGTTFLDILPALDKEVEGDEKVGVNIVKRAIEEPVRQIAQNAGLEGSVVVENVKKAGTGIGFNALKNEYVDMLKAGIVDPAKVTRSALQNAASIASMVLTTETLVADKPEKE..................... 525
185 0.000e+00JGI.Meta 7015916184 SRS014979_WUGC_scaffold_25451__gene_53360 chaperonin groL [Human Stool microbiome from visit number 1 of subject 7640629  ali  59  1MAKEIKFNEDSRKALVKGVDQLADTVKITLGPKGRNVVLDKKFGAPLITNDGVTIAKEIEFEDRFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNIAAGANPMILKKGIQKAVDATVESIHEGSQKVRGKDDIARVASVSAN-DDSVGALIADAMEKVTNDGVITVEESKTMGTNLEVVEGMQFDRGYVSAYMATDTDKMEAILEDPYILITDKKLSNIQEVLPILEQIVQQGKKLLIIAEDVEGEALTTLIVNKLRGTFACVAVKAPGFGDRRKEMLRDIAILTGGEVITEELGYDLKETTIEMLGRARQVKVAKENTIIVDGAGDKDEIKKRILSIKSQIEETTSEFDKEKLQERLAKLSGGVAVIQVGAASETEMKERKLRIEDALAATKAAVEEGIVAGGGTAYINAISSVAKLLSGDERTGVQIVMKALEEPVKQIAINAGLEGAVIVDKVKAAKPGIGYDVLTEKCVDMISAGIVDPAKVTRSALQNAASVASILLTTEAVVADIPEPE..................... 527
186 0.000e+00gi|763180327|ref|WP_044059748.1| molecular chaperone GroEL [Pseudomonas aeruginosa]  clstr ali  58  15.AELIKRHQDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQAFIREGSKAVAAGMNPMDLKRGIDQAVKAAVEELKKLSKPTADDNAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQQSQQVEMDDPFILIHDKKISNVRELLPVLEGVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVAAVKAPGFGDRRKAILEDIAVLTNGTVISEEVGLSLEKATINDLGRAKRVVITKENSTIIDGAGDAERIQARIGQIKAQIEETSSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRALQAIGKGANEDQNHGIQIALRAMEAPLREIVTNAGEEPSIILNTVKGMKPSYGYNAANGQYGDMIEMGILDPTKVTRTALQNAASIAGLMITTEAMVAEAPKKEEPAPAH............... 551
187 0.000e+00gi|495859144|ref|WP_008583723.1| molecular chaperone GroEL [Niabella soli]  clstr ali  63  1MAKQLYFNVEARNKMKKGVDSLANAVKVTLGPKGRNVVLEKKFGAPAITKDGVTVAKEIELEDVVENMGAQMVKEVASKTADIAGDGTTTATVLAQAIIGEGLRMVAAGANPMDLKRGIDKAVSLVVESLKAQSQTVNDSKKIKQVATISANNDEQIGDLIAQAFGKVGKEGVITVEEAKGTDTTVDVVEGMQFDRGYISPYFVTNSEKMEAELQNPYILIYDKKISTMKDILGILEKVAQSGRPLVIIAEDLEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKEMLTDIAILTGGTVISEELGHKLEGAELNALGQASSITIDKDNTIVVGGKGKKADITGRVNQIKAQIENTTSDYDREKLQERLAKLSGGVAVLYVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVAYIRAVDSLGVKVKGDEATGMAIVKRALEAPIRTLTDNAGIDGSIVVQKIKEGKADFGFNARTETYENLFKAGVIDPTKVSRVALENAASIAGMLLTTECVIADKPEPK--AAAPAMPGGPD........ 540
188 0.000e+00gi|984751851|gb|KWW28942.1| chaperonin GroEL [bacterium P201]  clstr ali  65  1MAKDILFNIESRDGLKKGVDALSNAVKVTLGPKGRNVVIEKSYGAPQITKDGVTVAKEIELIDPVENMGAQLVKEVASKTNDLAGDGTTTATVLAQSIVATGLKNVTAGANPLDLKRGIDKAVAAVVASLKKMSVKVDDNEKIKQVATISANNDSEIGGLIAEAMGKVKQEGVITVEDAKGINTYVDVVEGMQFDRGYISPYFVTNTEKMEAVYENPYILIYDKKISVMKDLLPVLEKTLQTGRALIIIAEDIDGEALATLVVNRLRGSLKVAAVKAPGFGDRRKEMLEDIAILTGGTVISEEKGYKLEDATLQMLGQADKVSINKDNTTIVNGHGAKNDIEARTAQIKAQIKTTTSDYDREKLQERLAKLAGGVAVIYVGAASEVEMKEKKDRVEDALNATRAAIEEGIIPGGGVGFIRAIKAIEKGDNEDETTGIAIIKRALEEPLRQIVENAGLEGSVVVNKVKEGKNDFGFNARTEVYENLLQTGVIDPVKVSRVALENAASIAGMLLTTECVISNHKE....................... 526
189 0.000e+00gi|494076924|ref|WP_007018979.1| molecular chaperone GroEL [Bermanella marisrubri]  clstr ali  63  1MAKDVKFGDSARSKMLKGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASQANDKAGDGTTTATVLAQAIINEGLKSVAAGMNPMDLKRGIDKATAAVVEELAKLSRPCTDSKNIAQVGTISANSDKTVGDLIAQAMEKVGKEGVITVEEGQGLADELEVVEGMQFDRGYLSPYFINNQEKMNVELENPLILLADKKIDNLQEIIPLLENVAKSGRPLLIVAEDVEGQALATLVVNTMRGTFKVAAVKAPGFGDRRKAMLQDIATLTGGKVISEEVGMSLETTSLEDLGTAKKVVIDKENTVMVGGAGSDADVTARCEQIRSEIETTTSDYDKEKLQERLAKLAGGVAVIKVGAGSEIEMKEKKDRVEDALQATRAAVEEGVVAGGGVALIRAISNVTTGDNEDQNVGIALALRAMEAPIRQIAYNAGDEASVVVDKVKSGEGSFGYNASTGEYGDMIELGIIDPTKVTRSSLQAAASVGGLMITTEAMVADIPEEN..................... 526
190 0.000e+00gi|524783663|emb|CDE80752.1| 60 kDa chaperonin [Ruminococcus sp. CAG:353]  clstr ali  61  1MAKDIIYGEEARKSLQAGIDKLADTVKITLGPKGRNVVLDRKFGAPLITNDGVTIAKEIELDNAFENMGAQLVKEVATKTNDAAGDGTTTATLLAQALIREGMKNIAAGANPMVVKKGMSKAVAAAVDAIKANSKEVEGSADIARVATVSS-ADEEVGKLIAEAMEKVTSDGVITIEESKTAETYSDVVEGMQFDRGYITPYMVTDTDKMEAVIDDAYILITDKKISSIQEILPLLEQIVQSGKKLVIIAEDIEGEALSTLIVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVISEEIGLELKDTQVAQLGRAKQVKITKENTIIVDGQGNKDDIKDRINQIKAQIEVTTSEFDKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKLRIEDALAATKAAVEEGIVAGGGTALINAMPAVSKSLQGDEKTGAQIVLKALEEPVRQIAKNAGLEGSVIIDKIRSRKVGYGFDAYNETYVDMIPAGIVDPTKVTRSALQNAASVAAMVLTTESLVADIKEE...................... 527
191 0.000e+00gi|501449059|ref|WP_012472508.1| molecular chaperone GroEL [Candidatus Amoebophilus asiaticus]  clstr ali  63  1MAKHIIFDSEARAKLKSGVDTMANAVKVTLGPKGRNVVIDKKYGAPSITKDGISVAKEIELKDPVENLGAQLIKEVASKTADGAGDGTTTATVLAQSIFSAGIKNVAAGANPMDLKRGVDKAIEAVVERLKQNSRKISNSKEIEQVATISANNDSKIGKMIADAMDKVGKDGVITVEEAKGTETEVKVVEGMEFDRGYLSPYFVTNTEKMEAELGNAYILICDKKISVMKELLPILEAISQTGRPLLIIAEDIEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGYKLENATLDYLGTAEKINIDKENTLIVNGGGKKEDIQARISQIRSQIENTTSDYDKEKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVQEGVVAGGGVALIRTIPALEEVENEDQATGINIVRTSLEAPLRTIVSNAGGEGAVIVQKIREAQGDFGYNARTGNFENLYEAGVIDPTKVTRLALENAASIASLLLTTECVIADEKEEDKPGVGAP.............. 534
192 0.000e+00gi|750615672|ref|WP_040897540.1| molecular chaperone GroEL [Verrucomicrobiae bacterium DG1235]  clstr ali  62  2MAKQLLFDEKARQAVLRGVETLAKAVKVTLGPKGRNVVIDKKFGSPTVTKDGVTVAKEIELPDPYENMGAQMVREVASKTSDSAGDGTTTATVLAESVYRAGLKSVTAGSNPIYLKRGIDKAVEAAVAELTKISKAVESREEVKQVATVSANWDETIGDIIADAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYLSPYFTTDAETMEAVLEDAYILIHEKKISNLNDLLPLLQTVAKSGKPFLLIAEDIEGEALAALVVNKIRGTLNVCAVKAPGFGDRRKAMLEDIAVLTGGRCVTEDLGIKLENVQISDLGSAKRVTIDKESTTIVEGAGSANDIQGRVKQIRRQIEETSSDYDREKLQERLAKLAGGVAVINVGAATEPDMKEKKARVEDALHATRAAVEEGIVPGGGVALIRAAKAIDLKLEGDEAIGAQIIKTAVAGPIRQLCANAGVEGSVVVKEILSQEGNMGYNVATDTYEDLLKAGVVDPTKVTRSALQNAASISGLLLTTECMITDIPEEKSA................... 529
193 0.000e+00gi|527331419|ref|WP_020915576.1| molecular chaperone GroEL [Candidatus Profftella armatura]  clstr ali  61  1MAKQVIFGDDARAKIVNGVNILANAVKVTLGPKGRNVILERSFGAPIVTKDGVSVAKEIELKDKLENMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGFKYVAAGFNPTDLKRGIDKAVIAIVSEIKKISKPIMTNKEIAQVGSISANADTDIGDIIARAMDKVGKEGVITVEDGKSLENELDIVEGMQFDRGYLSPYFINNQEKQVVALDNPYILLFDKKISNIRELLPVLEQVAKTNKPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTVIAEEIGLTLEKTTLENLGQAIRVEIGKENTTIIDGNGKKANIEARCAQIRTQIEEATSDYDREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRSRSAIQKGDNPDQDTGIKIVLRAIEEPLRQIVFNAGGEASVVSAKVLAGSGNYGYNAADGTYGDLVSLGVLDPAKVTRSALQNAASVASLILTTDALIAEISEEKTASG................. 532
194 0.000e+00 [KEGG:K04077] chaperonin GroEL;|[COG0459] Chaperonin GroEL (HSP60 family)  ali  63  9MAKILKFDEEARKKLEKGVNILADAVKVTLGPRGRNVVLEKSYGSPLITNDGVSIAKEIELEDPFENMGAQLVKEVATKSNDVAGDGTTTATILAQAIVKEGLKMVSAGANPMFIKKGIDKATKEVIEHLKARSKKIQSNDEIAQVASVSA-GDEEIGKLIAQAMEKVGETGVITVEEAKSLETTLEVVEGMQFDKGYISPYMVTDTERMTAELDNPFILITDKKISSMKDILPVLEETVQASRPVLIIADELEGEALTTLVINKLRGTLNVVAVKAPAFGDRRKAMLEDIAVLTGGEVISEEKGMKLEETTISQLGRAKKVKVTKDMTVVVDGMGTSEDIKGRVNSIKNQIEATTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKDKKLRIEDALNATRAAVEEGIVPGGGTILLEIVKAMENKLEGEEGIGVEIVKKALTSPLRQIAENAGVDGAVVVEKVREMEEGFGFNAATEKYVNMVEAGIIDPAKVTRSAIQNAASVSALILTTEVLVATKKEAKE-------PEMGNPGMMPGMM 547
195 0.000e+00gi|952994872|ref|WP_057953569.1| molecular chaperone GroEL [bacterium L21-Spi-D4]  clstr ali  64  1MAKEIKFDVDARNRIKEGVDKLADTVKVTLGPKGRNVVIEKKFGAPQVTKDGVTVAKEIELSDAYQNVGAQMVKEVASKTNDDAGDGTTTATVLAQSMVTVGLKNVTAGANPMDLKRGIDKAMHKVVEHIRTMSEEVESNERIEQVARISANNDVEIGKLIANAMDKAGKDGVITVEEAKGIETELQTVEGMQFDRGYISPYFVTDTEKMVADLENPYILIHDKKISTMKDLMPVLEPAAQSGRPLLIIAEDVDGEALATLVVNRLRGSLKVAAVKAPGFGDRRKEMLEDIAVLTGGTVISEEKGMKLEGATLEMLGSAEKVTIDKENTTVVNGNGEKEQIDARVKQIKQQIENSTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALSATRAAVEEGIVAGGGVAYIRAIKALEKGDNEDETTGIEIVKRAIEEPLRQIVHNSGKEGAVVVQKVKEGEGDFGYNARLDEYQNLLESGVIDPTKVTRIALENASSIAGMFLTTEAVMVEEKDDE..................... 528
196 0.000e+00gi|491573410|ref|WP_005430990.1| molecular chaperone GroEL [Sutterella wadsworthensis]  clstr ali  58  3.AKQVLFGDDARTKMVRGINILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKFENMGAAMVREVASKTSDNAGDGTTTATVLAQAIVDEGMKFVAAGMNPMDLKRGIDKAVAAAITELKKLSKPTTTNKEIAQVGAISANSDEEIGQIISEAMDKVGKEGVITVEDGKSLKNELEVVEGMQFDRGYLSPYFINQPEKQAAVLENPFILLHDKKISNIRELLPVLEQVAKAARPLIIIAEDIDGEALATLVVNSIRGILKVVAVKAPGFGDRRSAMLEDIAVLTGGTVISSNVGLSLDKATLAQLGSAKKVEVTKENTTIIDGAGDAAAIENRVKNIRTQIEGASSDYDREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRAKLAIKKGDNDEQNAGIRIVLRAMEEPLRQIVANAGDEPSVVVNTVAQGEGNFGYNAQSAKYGDMVEMGVLDPTKVTRTALQNAASVASLILTTDCMVADLPADDKAVPA................ 533
197 0.000e+00gi|503985109|ref|WP_014219103.1| molecular chaperone GroEL [Niastella koreensis]  clstr ali  62  1MSKELFFDVTARNQMKKGVDILANAVKVTLGPKGRNVVLEKKFGAPAITKDGVSVAKEIELEDPLENMGAQMVKEVASRTADLAGDGTTTATVLAQAIIHEGLKNVAAGANPMDLKKGIDKGVEAIVKSLREQSQTVGTDSKIRQVATISANNDDNIGELIAQAFGKVSNEGVITVEEAKGTDTTVEVVEGMQFDRGYISPYFVTNTEKMQAELQQPYILIYDKKISAMKDILGILEKTAKTSRPILIIAEDLEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKEMLQDIAILTNGTVISEEQGYTLEKVELEHLGSAETITIDKDNTTIVGGLGKKAAITERINQIKAQMAATTSDYDKEKLQERLAKLSGGVAVLYVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVAYIRAAQKLEEGKNEDETTGIAIVKRAIEEPLRQIVHNSGLEGSIVVQNIKQGTGDYGFNARTEQYENLLAAGVIDPTKVARVALEHAASVAGMLLTTECVIADKPKQETVAA--PSPGMNGMG...... 541
198 0.000e+00gi|736600242|ref|WP_034609007.1| molecular chaperone GroEL [Desulfovibrio aminophilus]  clstr ali  61  3.AKTIHFDEKARSGLRKGVNALAEAVKVTLGPKGRNVVIEKSWGAPIITKDGVTVAKEIDLEDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQAIFNEGLKLVAAGRNPMSVKRGIDKAVEAVNAELDKISTPTRDRKEIAQVGAISANNDATIGQILSEAMDKVGKQGVITVEEAKSMETSLDVVEGMQFDRGYISPYFVTNPEKMACEFEDPYILISEKKISNMKDLLPVLEQVVRQAKPLVIVAEDVDGEALATLVVNKLRGTLKVCALKAPGFGDRRKAMLQDIAVVTGGKVVSEDLGIKLENITIADLGTAKRMVVEKESSTIVDGAGKKDAIQARIAQLEAEIKDTSSDYDREKLQERLAKMVGGVAVIKVGAATETEMKEKKARVEDALNATRAAVEEGIVPGGGTAYVRCVPALEKSVDDDEAAGVDIVRRAIEEPLRQIAGNAGFEGSVVVEKVRSGKGGFGFNAATGQYEDLIKAGIIDPKKVSRVALLNAASVASLLLTTECAVA........................... 522
199 0.000e+00gi|490190088|ref|WP_004088684.1| molecular chaperone GroEL [Xylella fastidiosa]  clstr ali  59  3.AKEIIFSEKARSRMVHGVNLLANAVKATLGPKGRHVVLDKSFGSPIITKDGVSVAKEIELADKFENMGAQMLKEVASKTNDHAGDGTTTATVLAQALIREGCKAVAAGMNPMDLKRGIDKAVIAAVTELKKISKPTSDDKAIAQVATISANSDESIGNIIAEAMKKVGKEGVITIEEGTTLENELDVVEGMQFDRGYSSPYFINNQQSQIVELDNPYILLHDKKISSVRDLLTVLDAVAKESKPLLIVAEEVEGEALATLVVNNIRGIIKVCAVKAPGFGDRRKAMLEDMAVLTGGTVISEEVGLSLEKATTSHLGKAKKVRVSKENTTIIDGMGDNDAINGRVKQIKTQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALLATRAAVEEGVIPGGGVALIRAITAISKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEGKDNFGYNAATGEFGDMVNLGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKDEPTPPAA.............. 535
200 0.000e+00gi|653047156|ref|WP_027298755.1| molecular chaperone GroEL [Rhodospirillales bacterium URHD0088]  clstr ali  62  3.AKDVKFSTDARDRMLRGVETLANAVRVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTSDLAGDGTTTATILAHAIVREGSKAVAAGMNPMDLKRGIDMAVGAVVADVQSRSRKVSTNAEIAQVGTISANGEGEIGTMIAKAMQKVGNEGVITVEEAKAMETELDVVEGMQFDRGYLSPYFVTNAEKMTAVLENPLILLHEKKLSSLQPLLPILEAVVQSGKPLLIISEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTKGELISEELGIKLENVTMEMLGTAKRIEIDKENTTIIGGAGKKKDIEGRIAQIKAQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGGTEVEVKERKDRVDDAMHATRAAVEEGIVAGGGVALLYATRALGKPANDDQKVGIDIVRRALQVPTRQIASNAGADGSLIVGKLLEQKSDYGFDAQKGEYVDMVKAGIIDPTKVVRVALQDAASVAGLLITTEAMVSEKPEPKP.................... 530
201 0.000e+00gi|647329141|ref|WP_025763885.1| molecular chaperone GroEL [Dyadobacter tibetensis]  clstr ali  62  1MSKKIFFDTDARDRIKRGVDILADAVKVTLGPRGRNVVIDKKFGSPSITKDGVTVAKEIDLKDPIENMGAQLVKEVASKTADSAGDGTTTATVLAQAIYSIGVKNVAAGANPMDLKRGIDKAVQAIVANLETQKKVISTSKEIAQVATISANHDEEIGNMIAQAMEKVGKEGVITVEEARGTETEVKTVEGMQFDRGYLSPYFVTNTEKMEVEMERPYILISEKKVSSMKELLPVLEAVAQTGRPLLILAEDVDGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAIITGGTVISEERGFKLENATLDYLGSCEKAIIDKDNTTLVNGDGKSEDIQGRVNQIKAQIENTTSDYDREKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVEEGIVSGGGVAFIRASSVLNKGSNEDETTGINIIRVALEAPLRTIVSNSGQEPSVVIQKVKEGVGSYGYNAKDNIYTDLLEAGIIDPKKVSRLALENAASIAGLLLTTECVIADEPEENAAPA................. 531
202 0.000e+00gi|817137426|ref|WP_046509755.1| molecular chaperone GroEL [Kiloniella litopenaei]  clstr ali  59  3.AKDVKFGTDARDKMLRGVDVLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVREVASKTNDVAGDGTTTATVLTQGLVREGAKAVAAGMNPMDVKRGMDLAVSTAVEALKASAKQISTTEEVAQVGTISANGEAEIGNMIAEAMERVGKEGVITVEEAKSLATELDVVEGMQFDRGYLSPYFVTNAEKMVADLEAPYILLHEAKLTNLQPMLPLLEAAVQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIKLENVTLDMLGTAKRVNISKEETVVVDGAGDRDQIEGRCAQIRAQAEETSSDYDREKLQERLAKLAGGVAVLRVGGATEVEVKERKDRVEDAMNATRAAVEEGIVSGGGTALLSAVAALKEGENNDQNVGINVVRRALEAPIRQIAENAGYEGSIVVGKITENEAGFGFDAQTGEYKDLFAAGIIDPVKVVRTALQDAGSVSGLMITTEAMVADQPEDKSAAPAMP.............. 536
203 0.000e+00gi|499455427|ref|WP_011142891.1| molecular chaperone GroEL [Gloeobacter violaceus]  clstr ali  58  1MAKMIVFDETARRALERGVNALADAVRVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDPLENTGAQLIREVASKTNDVAGDGTTTATVLAQALIREGLRNVAAGANPMSLKRGMEKTVAKLVQEIAAMAKPVEDNKTIAEVATISSGNDEEIGQMIAEAMDKVGKEGVITVEESKSLVTELDVVEGMQFDKGYVSPYFVTDTERMITDLDEPFILLTDKKISIIQDLIPVLEKVARAGRPLLIISEDLEGEALATLVVNKLRGVLNCVAVKAPGFGDRRKAMLQDIAVLTGGDVISEDIGLKLENVTIDMLGKARKVTITKDKTTIVAGTDNKAAVEKRIAQIHKQMEDTDSDFDREKLQERLAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEGIVPGGGTTLLHLIDAIKAGLADDEKTGADLIARALEAPLRQIADNAGVEGSVIAQKVRELDFNIGYDAMKGEFVDMLAAGVADPAKVVRSALQNAASIAAMVLTTEVLIVDKPEKKKAGAGAP.............. 535
204 0.000e+00gi|83596013|gb|ABC25372.1| chaperonin (groEL) [uncultured marine bacterium Ant29B7]  clstr ali  63  3.AKEITFDVAARNGLRAGVDALANAVKVTLGPKGRNVIIEKSFGSPVVTKDGVTVAREITLENKLENLGAQMLKEVASKTADVAGDGTTTATVLAQAIIKHGHKNVMAGANPMDLKRGIDKAVAVVVKALAKMSIEVESNDKIEQVATVSANNDPSIGKLIAEAMDKVKKEGVITVEESKGTETYVDVVEGMQFDRGYLSPYFTTNTEKMVADLENPYILIYDKKISTMKELLPVLEPVAQSGRPFLIIAEDVDGEALGTLVVNKIRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFKLENATLDMLGTAEKVTLDKDNTTVVNGAGNKDDISGRVGQIKAQIETTTSDYDREKLQERLAKLAGGVAVLYVGAASEVELKEKKDRVDDALSATKAAIEEGIVPGGGVALVRAIESLSKGENADETTGIAIIARAIEEPLRQIVLNAGLEGSVIVSKVREGKGDYGFNAKTDNYCNMHEAGIIDPTKVTRVALENAASVASLLLTTEATIVEIPKPE--PAMPAGPDMGGM....... 541
205 0.000e+00gi|544863901|ref|WP_021277982.1| molecular chaperone GroEL [Bacteriovorax sp. DB6_IX]  clstr ali  65  1MAKELKYSEEARSLILEGVNQLANAVKVTLGPKGRNVVIQKSFGAPHITKDGVSVAKEIELENNFQNMGAQMVKEVAQKTNEDAGDGTTTATVLAQAIYTEGVKLVTAGHNPMDLKRGIDLAVEKVIAELKNVSKQIKTSEEIEQVGTISANNDNEIGKLLAEAMDKVGNEGVITIEESKTAETTLDVVEGMQFDRGYLSPYFVTNPEKMEVSFDNANILITDKKIANMKELLPILEKAVQTSKPLLIIAEDIEGEAITTLVVNKLRGTLNVAAVKAPGFGDRRKEMLKDIAALTGGTVISEELGMSLETADLTHLGAAKKISIDKENTTIVDGAGDKASVDARVSQIKAQIEETSSDYDREKLQERLAKLAGGVAVVNVGAPTETEMKEKKDRVEDALNATRAAVEEGIVVGGGSALVKAANVLEEGSNSEENFGIKIVRRAVEAPLRQIATNAGLEGSVVVNEVKNNKDAFGFNAREEKYEDLVAAGIIDPTKVTRSALQNAASVAGLMLTTETMIADLPKDESAA.................. 531
206 0.000e+00gi|654896620|ref|WP_028348167.1| molecular chaperone GroEL [Bradyrhizobium elkanii]  clstr ali  59  3.AKEVKFSVDAREKMLRGVDILANTVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASRTSDRVGDGTTTATVLAQAIVKEGAKAVAAGVNPMDLKRGIDRAIDALISDIEKNSKKITSNDEIAQVATISANGDAEIGRFLADAMKKVGNDGVITVEEAKSLQTELEVVEGMQFDRGYISPYFVTNAEKMRVELEDSYILIHEKKLSGLQPLLPLLESIVQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTMISEDLGIKLESVTINMLGHAKKVRIEKENTTIVSGGGKKADIEARIAQIKTEIEKTTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVRERKDRVDDALHA