current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|15644635|ref|NP_206803.1| transcription antitermination protein NusB (HP0001) [Helicobacter pylori 26695], from H.pylori

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MATRTQARGAVVELLYAFESGNEEIKKIASSMLEEKKIKNNQLAFALSLFNGVLEKINEIDALIEPHLKDWDFKRLGSMEKAILRLGAYEIGFTPTQNPIIINECIELGKLYAEPNTPKFLNAILDSLSKKLTQKPLNLast
1 -5.710 VFG001005(gi:31983568) (mxiC) type III secretion system gatekeeper MxiD [TTSS (VF0118)] [Shigella flexneri 2a str. 301]  ali follow..  11  97LKDNLPLDRDFIDRLKRYFKDPSDQVLALRELLNEKDLTAEQVELLTKIINEIIGSEKSVNAGINSAIQAKLFGNKMKLEPQLLRACYRGFIMGNISTTDQYIEWLG---NFGFNHRHTIVNFVEQSLIVDMDSEKPS 232
2 -5.610 VFG002125(gi:15604808) (copN) Type III secretion system effector CopN [TTSS (VF0344)] [Chlamydia trachomatis D/UW-3/CX]  ali follow..  120..DDDSSPDEILDALTSKFSDPTIKDLALDYLIQTAPSDGKLKSTLIQAKHQLMQNPQAIVGGRNVLLASETFASRANTSPSSLR----SLYFQVTSSPSNCANLHQMLASYLPSEKTAVMEFLVNGMVADLKSEGPS 252
3 -5.080 VFG000333(gi:16272494) (lic2A) glycosyltransferase [LOS (VF0044)] [Haemophilus influenzae Rd KW20]  ali follow..  11MENATERRKHITKQFESKKLSFSFFNAYTYQSINQSINQSINQSINQSINQSINQSINQSNSILHNIEESRILTK-GEKGCLISHFLLWNCVNENFEYLKIFEDDVILGENAEV........................ 124
4 -4.960 VFG041235(gi:52840345) (lem1) Dot/Icm type IV secretion system effector Lem1 [Dot/Icm (SS047)] [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  ali follow..  10 1046KRDKQKKSPIICSYLLSYTGKKSVLLHLLQDYFNSFQGMPDYIRPVSQLL--RFFPQRDVSAVIYDALEAEMIKKPQSLDRQILDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVKRGCELLVRDCEDKGVK 1182
5 -4.840 VFG034966(gi:15801937) (nleF) Type III secretion system effector NleF, caspase inhibitor [LEE encoded T3SS (SS020)] [Escherichia coli O157:H7 str. EDL933]  ali follow..  13  41......................................................ELQDKLDVMVSIYSCARNNNELEEIFQELKRNSVFEVRNENT------EVVGALRAGMTIEDRDSYIRDLLHSLKVKIEESRQG 130
6 -4.810 VFG002037(gi:148028) (eltA) heat-labile enterotoxin A prepeptide (from human) [Heat-labile toxin (LT) (VF0210)] [Escherichia coli]  ali follow..  10  21............DKLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNIARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGI.............. 137
7 -4.800 VFG000558(gi:16766203) (invE) type III secretion system gatekeeper invE [TTSS(SPI-1 encode) (VF0116)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  101ISVHGGALEDFLRQARSLFPDPSDLVLVLRELLRRKDLEEIVRKKLESLLKHVEEQTKTLKAGINCALKARLFGKTLSLKPGLLRASYRQFIQSESHEVEIYSDWIA---SYGYQRRLVVLDFIEGSLLTDIDANDAS 237
8 -4.750 VFG045516(gi:52841388) (ravQ) Dot/Icm type IV secretion system effector RavQ [Dot/Icm (VF0156)] [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  ali follow..  11  221...EKACRKKCLEILHEVSLGRINPMEGLTLFLKIKFKEEAASENQSALLQNSLIRKKFISPNLVDLVINGTLSTTFSDSQLLLRMTSEEKALEKGKIKLYLAKIMDIQNEILTSKNGEFVPGL.............. 360
9 -4.590 VFG002462(gi:53722565) (bsaP) Type III secretion system gate keeper protein [Bsa T3SS (VF0428)] [Burkholderia pseudomallei K96243]  ali follow..  101..GGRADLATLLRDARERFRDESDLLLALRELRRRRRLDGESVDALERAIDELLAGDKRIKAGINAALKAKVFGARMQLDARRLRELYRQFLEFDGSHLVIYED---WIEQFGASRRKRILDYVSAALSYDMQSHDPS 235
10 -4.430 VFG000107(gi:15641468) (ctxA) cholera enterotoxin, A subunit [CT (VF0128)] [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  21............DKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNIARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGI.............. 137

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.