current user: public

anford Burnham Prebys Medical Discovery Institute

Query: gi|15644643|ref|NP_206812.1| chaperonin GroEL (HP0010) [Helicobacter pylori 26695], from H.pylori

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .
1 -90.300d3osxa1 c.8.5.1 (A:191-376) automated matches {Xenorhabdus nematophila [TaxId: 628]}  ali model 3D-neighbors follow..  63  1.............................................................................................................................................................................................EGMQFDRGYLSPYFINKPESGSVELENPYILLVDKKISNIRELLPVLEGVAKASKPLVIIAEDVEGEALATLVVNNMRGIVKVASVKAPGFGDRRKAMLQDIATLTNGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIIDGVGEEGAIAARVTQIRQQIEESTSDYDREKLQERVAKLAGGV........................................................................................................................................................................... 186
2 -71.600d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  44  2.AKDVKFGNDAGVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVXVVAGGGVALIRVASKNADQNVGIKVARAMEAPLRQIVLNCGEEPSVVANATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPK........................................................................................................................................................................................................................................................................................................................... 253
3 -38.200d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  46  3......................................................................................................................................................................................................................................................................................................................SDSKAIAQVGTISANSDETV---GKLIAEAMDKVGKEGVITVEDGTGLQDEDVVXERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEE.......................................................................................................................................... 98
4 -19.200d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}  ali model 3D-neighbors follow..  24  13.......GRDAQRLNILAARIIAETVRTTLGPKGMDKMLVDSLGDIVVTNDCATILDKIDL----QHPAAKMMVEVAKTQDKEAGDGTTTAVVIAGELLRKAEELLDQNIHPSIITKGYALAAEKAQEILDEIAIRIELAIRLDEYAKQVGGKEALAIENFADALKIIGLDTVEMLVKVIGLGIGIDVFEGKPADMGIIEPLRVKKQAIKSASEAAIMILRIDDVIAA.............................................................................................................................................................................................................................................................................................................................. 257
5 -6.220d1rp3b_ a.137.11.1 (B:) Anti-sigma factor FlgM {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  15  32.............................................................................................................................................................................................................................................................................................................................IEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIE................................................................................................................................................................................ 84
6 -5.330d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]}  ali model 3D-neighbors follow..  18  1........................................................................................................................................................................................DSCVLRGVMINKDVTHP-------RMRRYIKNPRIVLLDSSLEEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRV-----------RKTDNNRIARACGARIVSDDVGTGAGLLEIKKIGDEYFTFITKACTILLRGA................................................................................................................................................................................................................... 169
7 -5.240d1q3qa2 c.8.5.2 (A:217-369) Thermosome, A-domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}  ali model 3D-neighbors follow..  16  1.............................................................................................................................................................................................RGVVIDKEVVHP-------RMPKRVENAKIALINEALQEEKMLKDMVDHIAQTGANVVFVQKGIDDLAQHYLAKYGIMAVRRV-----------KKSDMEKLAKATGAKIVT-----NVKDLTPEDLGYAEVVKLAGENMIFVEGCKNP................................................................................................................................................................................................................ 153
8 -5.180d1mzka1 b.26.1.2 (A:180-298) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  14  5.........................LEVIAGPIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNE........................................................................................................................................................................................................................................................................................................................................................................................................................ 119
9 -4.820d2o9ux_ d.17.1.1 (X:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}  ali model 3D-neighbors follow..  19  4.............................................................................................................................................EIIDIGPFTQN----LGKFAVDEENKIGQYGRLTFNKVPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVP........................................................................................................................................................................................................................................................................................................................ 94
10 -4.780d2d1pc1 c.114.1.2 (C:1-95) tRNA 2-thiouridine synthesizing protein B, TusB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  8.......................................................................................................................................................................................................SPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAPIKVYALNEDLIARGLTGQISNDII....................................................................................................................................................................................................................................................................................... 75

FFAS is supported by the NIH grant R01-GM087218-01
9 2 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.