current user: public

Query: gi|15644643|ref|NP_206812.1| chaperonin GroEL (HP0010) [Helicobacter pylori 26695], from H.pylori

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .
1 -87.500d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  63  2.......................................................................................................................................................................................LVPRGSEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGV........................................................................................................................................................................... 193
2 -71.300d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  44  2.AKDVKFGNDAGVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVXVVAGGGVALIRVASKNADQNVGIKVARAMEAPLRQIVLNCGEEPSVVANATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPK........................................................................................................................................................................................................................................................................................................................... 253
3 -42.200d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  46  3......................................................................................................................................................................................................................................................................................................................SDSKAIAQVGTISANSDETV---GKLIAEAMDKVGKEGVITVEDGTGLQDEDVVXERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEE.......................................................................................................................................... 98
4 -20.000d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}  ali model 3D-neighbors follow..  19  13.......GRDAQRLNILAARIIAETVRTTLGPKGMDKMLVDSLGDIVVTNDCATILDKIDL----QHPAAKMMVEVAKTQDKEAGDGTTTAVVIAGELLRKAEELLDQNIHPSIITKGYALAAEKAQEILDEIAIEIELAIRLDEYAKQVGGKEALAIENFADALKIIGLDTVEMLVKVISEHKNRGLGIGIDVFEGKPA-------DMLEKGIIEPLRV------------KQAIKSASEAAIMILRIDDVIAAKA................................................................................................................................................................................................................................................................................................. 259
5 -5.970d1rp3b_ a.137.11.1 (B:) Anti-sigma factor FlgM {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  14  32.............................................................................................................................................................................................................................................................................................................................IEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEF............................................................................................................................................................................... 85
6 -5.640d1q3qa2 c.8.5.2 (A:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}  ali model 3D-neighbors follow..  16  1.............................................................................................................................................................................................RGVVIDKEVVHP-------RMPKRVENAKIALINEALQEEKMLKDMVDHIAQTGANVVFVQKGIDDLAQHYLAKYGIMAVRRV-----------KKSDMEKLAKATGAKIVT-----NVKDLTPEDLGYAEVVKLAGENMIFVEGCKN................................................................................................................................................................................................................. 152
7 -5.530d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]}  ali model 3D-neighbors follow..  18  1........................................................................................................................................................................................DSCVLRGVMINKDVTHP-------RMRRYIKNPRIVLLDSSLMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRV-----------RKTDNNRIARACGARIVSDDVGTGAGLLEIKKIGDEYFTFITKACTILLRG.................................................................................................................................................................................................................... 168
8 -5.240d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  14  7........................FLEVIAGPIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQ.......................................................................................................................................................................................................................................................................................................................................................................................................................... 120
9 -5.120d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  12.................................................................................................................................................IIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYE-----IDGRDY-------HFVSSREKMEKDIQAHKFIEAGQYNSHLYGTVQSVREVAEQGKHCIL---DVSANAVRRLQAAHLHPIA--IFIRPRSLENVLEIN---------KRITEEQARKAFDRAT----------KLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL.................................................................................................................................................................................. 199
10 -4.670d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}  ali model 3D-neighbors follow..  14  11......................................................................................................MVLTTNLVYPAVLNAAIDLNLFEIIAKATPPGAFMSPSEIASKLPASTQHSDLP--NRLDRMLRLLASYSVLTSTTRTIEDGGAERVYGLS-----VGKYLVPDES.................................................................................................................................................................................................................................................................................................................................................. 110

FFAS is supported by the NIH grant R01-GM087218-01
6 7 7 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.