current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: gi|238922464|ref|YP_002935977.1| hypothetical protein (EUBREC_0038) [Eubacterium rectale ATCC 33656], from E.rectale

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
1 6.000e-41gi|212640389|ref|YP_002316909.1| flagellar protein FliS [Anoxybacillus flavithermus WK1]  clstr ali  22  3MNNPYQSYQTNAVQTASPGELTLMLYNGCLKFIAQAKKAIEEKDIEARHTNLLKAQKIIQELMVTLNMEYEVAKSMMTMYDYMYRRLVEANIKSDIAILEEVEGYVKEFRDTWKEVIQINRQRQYAQGGH........................... 132
3 1.000e-40gi|365156907|ref|ZP_09353194.1| flagellar protein FliS [Bacillus smithii 7_3_47FAA]  clstr ali  19  4.NNPYQAYEKNAVSTASPGELTLMLYNGCLKFLLQAKKAIEDKNFEKKNTYIQKAQNIIRELMVTLNMDVELSKNLMAVYDYMNRRLIQANVKNDLEILDEVMEFITELRDTWKQAIQEQRKQQYG............................... 128
5 3.000e-40gi|403383564|ref|ZP_10925621.1| flagellar protein [Kurthia sp. JC30]  clstr ali  21  4.QNAYNAYKQNSVNTASPGELTLMLYNGCIKFIHQAKKSIEAKDIPNRNKYIQKAQAILNELMSTLNMDIPVSQNMFNLYEYMYHQLTQANIKNDVAILDEVEGMAVEFRDTWKQVIQMNRQKQ................................. 126
9 1.000e-39gi|403236265|ref|ZP_10914851.1| flagellar protein FliS [Bacillus sp. 10403023]  clstr ali  18  3LHNPYQTYQDNSVFTATPGELTLMLYNGCLKFMGQAKKSIQEKNIETKHINISKAQNIISELMVTLNMDYEISKEMRRLYDFINRRLIEANIKNDVKLLEEAEDLVIEFRDTWKEVIRLNRAKQ................................. 126
11 2.000e-39gi|138896690|ref|YP_001127143.1| flagellar protein FliS [Geobacillus thermodenitrificans NG80-2]  clstr ali  22  3MNNPYQQYQTNAVQTASPGELTLMLYNGCLKFIKLARQAIETGDVTARNENLIKAQNIILELMKTLKMEYEVAKSMMTMYDYIYRRLIEANVKHDAAILDEVEGYVTEFRDTWKQVIQLNRQRQYAEGGQ........................... 132
13 9.000e-39gi|167039126|ref|YP_001662111.1| flagellar protein FliS [Thermoanaerobacter sp. X514]  clstr ali  23  2MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGTIEKKDYMAANNSIQRAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVTILEEVKGFAIELRDTWSVALNKVREKVYAK.............................. 128
14 1.000e-38gi|20807010|ref|NP_622181.1| flagellar protein [Thermoanaerobacter tengcongensis MB4]  clstr ali  29  8..NPYQQYKENAILTASPEELVLMLYNGIIRFIDEAKTALQKKDYVETNAKIQRAQDIITELMLTLDMNYDISKNLYNLYDYMLRRLIDANVKKDIEILDEVRGFAVDLRDTW--------SLALQKVREKVYA....................... 131
15 2.000e-38gi|404330082|ref|ZP_10970530.1| flagellar protein FliS [Sporolactobacillus vineae DSM 21990 = SL153]  clstr ali  22  3.NNAYKVYQQNSVLTATPGELTLLLFNGCLKFIRQGRGAILNKNYEQKNKVIQKAQAIITELMVSLDSKQPVAKDMMSLYDYIHRRLIEANVKNDITILDEVEKLVADFRDTWKQVIIINRKEQ................................. 125
17 2.000e-38gi|304317595|ref|YP_003852740.1| flagellar protein FliS [Thermoanaerobacterium thermosaccharolyticum DSM 571]  clstr ali  19  1MFDPYLEYKRNSIMTASPEELVMMLYNGIIRFVNEAKQAIDDKNIERAHNSITRAQDIVLELMSTLDMKYDISKNLYSIYDYISRRLIEANLKKDKVALDEVESLISDLKDTWGKAMDKVRAKVYSK.............................. 127
18 3.000e-38gi|218135306|ref|ZP_03464110.1| hypothetical protein BACPEC_03211 [[Bacteroides] pectinophilus ATCC 43243]  clstr ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
20 4.000e-38gi|260437424|ref|ZP_05791240.1| flagellar protein FliS [Butyrivibrio crossotus DSM 2876]  clstr ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGRP................................... 124
23 5.000e-38gi|410458991|ref|ZP_11312745.1| flagellar protein FliS [Bacillus azotoformans LMG 9581]  clstr ali  20  4..NPYQTYQNNAVNTASPGDLTLMLYNGCLKFIKQAKIAIENKDVETKHMNLVKAQNIITELMVTLNTDYEVGKNMMQMYDYMKRRLIEANTKSDIAILNEVEGYVAEFRDTWKEVIRISRQQKYAVGGQ........................... 131
27 8.000e-38gi|393201996|ref|YP_006463838.1| flagellin-specific chaperone FliS [Solibacillus silvestris StLB046]  clstr ali  20  5.TNAFNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQSIADKNIEERNHYIQRSQAIIGELMATLNMDIGISKQMLPLYEYMSRRLTEANIQNDSSIIEEVEGLVTEFRDTWKEVIKITRQQQYGTAGQ........................... 133
28 1.000e-37gi|126652457|ref|ZP_01724629.1| flagellar protein FliS [Bacillus sp. B14905]  clstr ali  20  7...AQNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQAIQEKNIQEKNTNLIKAQAIISELMATLNMDIEISKQMLPLYEYMNHRLVEANIQNDVAVIEEVEGLVTEFRDTWKEVIRINRQQQFGQ.............................. 130
32 3.000e-37gi|238925599|ref|YP_002939116.1| flagellar protein [Eubacterium rectale ATCC 33656]  clstr ali  17  4.SKGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKNDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMR....................................... 120
34 3.000e-37METAHIT unmapped GL0156791 unmapped_[Complete]_[mRNA]_locus=scaffold361806_1:404:778:+  ali  19  4.SNGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
37 7.000e-37gi|291524164|emb|CBK89751.1| flagellar biosynthetic protein FliS [Eubacterium rectale DSM 17629]  clstr ali  18  4.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQ....................................... 120
38 8.000e-37gi|335038978|ref|ZP_08532170.1| flagellar protein FliS [Caldalkalibacillus thermarum TA2.A1]  clstr ali  18  4.RNPYQTYKHNAVQTASPGELTLMLYNGCLNFIKQARQAIEEDNIQERNKYMQKAQDIIRELMVTLNTDYAVAKDMLRMYDYILRRLIEANINNDTAILDEVETYVSQFRDTWKEVLRLNRQKQYG............................... 128
41 1.000e-36gi|398308477|ref|ZP_10511951.1| flagellar protein FliS [Bacillus mojavensis RO-H-1]  clstr ali  19  4.QNPYAAYQQSSVNTATPGELTLMLYNGCLKFIKLACQAIENNDIERKNENLIKAQNIIQELNGTLNRNIELSGSMGAMYDYIYRRLVEANIKSDKSILEEVEGYVTDFRDAWKQAIQIERK................................... 124
42 1.000e-36gi|220927565|ref|YP_002504474.1| flagellar protein FliS [Clostridium cellulolyticum H10]  clstr ali  21  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDDKNIEKANNSIIRAQDIILEFQVTLDMKYEVSNNLYSIYDYMHRRLVQANIKKDKDILEEVLGMAKELRDTWTQAMKIAKR................................... 124
45 2.000e-36gi|302390122|ref|YP_003825943.1| flagellar protein FliS [Thermosediminibacter oceani DSM 16646]  clstr ali  19  1MINAYQQYQQNYILSAPPEKLVVMLCEGALKFARLAKKAIEEKNYAEANNYLIRTQDIIMELNASLDMEYEISKNLRSLYNFIYQRLIEANLKKDGGVVEEIEPLLEDLKDTWQRV......................................... 116
48 3.000e-36gi|125974702|ref|YP_001038612.1| flagellar protein FliS [Clostridium thermocellum ATCC 27405]  clstr ali  26  3LKNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQAQMALNDKNIEKANKSIIRAQDIISEFRCTLDMKYDIAHQLDLLYDYMYRRLVDANIKKDGAIVEEVLGFAKELRDTWEQAMKIAKQQN................................. 126
51 4.000e-36gi|229916641|ref|YP_002885287.1| flagellar protein FliS [Exiguobacterium sp. AT1b]  clstr ali  20  4..NPYAAYQNNAVTTANPQELTLMLYDGALKFMRLAKLAIDQGNPDLKNINIQKTQAIFQELRLTLNKDIAISANLDSLYDYMWRRLVDANVKNDTTILDEVLDFTTELRDTWKEAMKLAKQ................................... 123
53 5.000e-36gi|340355251|ref|ZP_08677943.1| flagellar protein FliS [Sporosarcina newyorkensis 2681]  clstr ali  24  4.NNPYAAYQNNSVTTSTPGELTLMLYNGCLKFIQQGKMALEEGKLEEKNVAIQKAQAIVTELMLTLDTSYPVAENMLVLYEFVNSRLIDGNIKNDPALFDEASGIIKEFRDTWKQVIQVNRSKQYSNVNE........................... 132
54 7.000e-36gi|258513983|ref|YP_003190205.1| flagellar protein FliS [Desulfotomaculum acetoxidans DSM 771]  clstr ali  20  5..NPYQQYQQNSITSAKPGQLTLMLYNGAIKFIKTAILGMEKKDIGTANGAVIRAQEIIRYLDHTLDPQYEISQNLSSLYDYIYRRLVEANINKNAAVLEEVVSMVEELRDTWMSVLKK...................................... 121
55 7.000e-36gi|150388621|ref|YP_001318670.1| flagellar protein FliS [Alkaliphilus metalliredigens QYMF]  clstr ali  18  3MQNPYQQYKQNSVMTASPQELTLMLYNGALKFINVSKKNIDEKNIAKANESIQRVQSIIQELNITLDMNYEVSKNLRSLYTYILERLVDANMQKDMNALEEAAQMITELRDTWKDAMKQARVGN................................. 126
57 9.000e-36gi|114565801|ref|YP_752955.1| flagellin-specific chaperone FliS-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]  clstr ali  23  6..QAYNQYKKSVVETVAPEKLLLMLYDAAIKNINNAKKAIKEKDINRAHEQIMRTEEIIVELMSTLNMEYEISGRLFALYEYFYHRLTQANAQKDIVILDEVEGFLLELRGTWQEAINALKTAPSQDNKVEV......................... 135
59 1.000e-35gi|312109502|ref|YP_003987818.1| flagellar protein FliS [Geobacillus sp. Y4.1MC1]  clstr ali  21  4.QQFHQVYKQNSVSTASPGELTLMLYNGCLKFLNKAKQAMREGNIQERNTNLQKAQRIIQELMATLNQKYEIAKQMMIMYEYMNRRLIEANIKNDISIVEEVEGFVAEFRDTWEEVIRLTRQKQ................................. 126
60 1.000e-35METAHIT unmapped GL0294738 unmapped_[Complete]_[mRNA]_locus=C220145255_1:522:893:-  ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
62 1.000e-35gi|78045039|ref|YP_359833.1| flagellar protein FliS [Carboxydothermus hydrogenoformans Z-2901]  clstr ali  24  1MNNPYAQYQTQNIATAPPEKLLIMLYDGAIKFLKQGLKALDEKKYDDFSYYISRTQDIISELMVTLDMDYEISKNLYQLYDYFMYRLIHGNVKKDRQSIEEVQKHLEELRETWVQAAAAKEKATI................................ 125
63 1.000e-35gi|296134265|ref|YP_003641512.1| flagellar protein FliS [Thermincola potens JR]  clstr ali  23  1MQNPYSQYKQISVQTASPEQLVVMLYDGAIKFLHLAKEAVARKNMEDTNKYIGKTQDIINEFIVSLDMSGEIAHNLYNIYDYWNRRLIQANIKKDPDIIAEVLGQVQELREVWAEAAVKSKEG.................................. 125
66 2.000e-35gi|347750939|ref|YP_004858504.1| flagellar protein FliS [Bacillus coagulans 36D1]  clstr ali  20  4.RNPYQAYQNNSIATASPGELTLMLYNGCLKFIHLAKKAIENKNFEEKNKNIQKAQNIIRELMMTLDTKFEDAEKMLSLYDFILRELIQANVKNDMSKLDTAEELVTGFRDTWKQVIQANRRQTYGQGGK........................... 133
70 2.000e-35gi|52082068|ref|YP_080859.1| flagellar protein FliS [Bacillus licheniformis DSM 13 = ATCC 14580]  clstr ali  22  3LNNPYAAYQQNSINMATPGELTLMLFDGCLKFMKLAKQAIEQEDMETKNTNLVKAQNIIQELNITLDRKVELAASMGAMYEYIHRRLIEANINNDKDIVAEVEGYVKDLRDAWKQALQIERQGRFGSGG............................ 131
71 3.000e-35gi|386715369|ref|YP_006181692.1| flagellar protein [Halobacillus halophilus DSM 2266]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCLKFIKTAKKAIENHDIEKKNTNIQKAQKIIRELMVTMEQDYEVAKDIMPLYDYMNRRLMEANITNDLGILEEVQGLTEEFRDTWKEVILQTRRVQQGQGG............................ 127
75 3.000e-35gi|158321510|ref|YP_001514017.1| flagellar protein FliS [Alkaliphilus oremlandii OhILAs]  clstr ali  19  3MNNPYGQYKQNSVMTASPQELTLMLYNGALKFIGMAKINIQEKDIPKANESIKRAQDIIQELNITLNMDYPISTNLRSMYTYILEKLVDGNIYKEIQYLDEAAEIITELRDTWKEAMKISKGG.................................. 125
76 3.000e-35gi|260892177|ref|YP_003238274.1| flagellar protein FliS [Ammonifex degensii KC4]  clstr ali  19  3...AANKYLEMAVSTAPPERLLLMLYDGAINFLSRAVEAIEARDFAEANRLIIRVEEIVTELKNSLDPQYEISQHLDRLYDYFLSRLFAANVAKDTEVLQEVQKHLRELRDTWAEVISRGANAGSTPPS............................ 128
77 3.000e-35gi|160878471|ref|YP_001557439.1| flagellar protein FliS [Clostridium phytofermentans ISDg]  clstr ali  19  3.QNAASIYQGTKINTASPAELTLMLYEGAIKFCNKALYGLEQNDIAKVNENLLKAQKIVTELRSTLDFKHPIAREFDTVYDYINRRLVDANIKKDTEILEEALDYIRQMRDTWKEVMKKNN.................................... 122
78 3.000e-35gi|403068172|ref|ZP_10909504.1| flagellar protein FliS [Oceanobacillus sp. Ndiop]  clstr ali  20  4.NKAYQTYQNNAVNTASGGELTLMLYNGCMKFIKQAIKDINDSNYEAKNKNIQKAQNIIQELMITLDPEIEISKQILPLYEFMQFQLKEANIKNDVTKLEEVLGFVTEFRDTWKQVMIKNRKQQYAQGAQ........................... 132
79 3.000e-35gi|297618042|ref|YP_003703201.1| flagellar protein FliS [Syntrophothermus lipocalidus DSM 12680]  clstr ali  21  6..NAYQQYRNSTVETASPGALLLMLYDAAIQNLEGAKRAIEGNDMAGAHNYLTRAQDIVLELMSTLNMEYQISKSLWSLYDYLYRQLVQANVKKSVELVEEVYGFMTELRDTWREAVRKAGRTAAVSGGKS.......................... 134
80 4.000e-35gi|294501813|ref|YP_003565513.1| flagellar protein FliS [Bacillus megaterium QM B1551]  clstr ali  17  4.NNPYQAYQQGAVQTASPGELTLMLYNGCLKFIKLARTGIQEKNIELKNTNLLKAQNIIQELMITLDTNVQVAKSMMAMYDYINQRLIEANTKNDTASLDEAEQYVTEFRDTWKQVVQLHRQQVHGSGGQ........................... 132
81 4.000e-35gi|410668533|ref|YP_006920904.1| flagellar protein FliS [Thermacetogenium phaeum DSM 12270]  clstr ali  24  7..NNYDQYRQIAVQTAGPGKLLLMLYDGLTVFLKQAVQAVKDGEFGEAHRCLIRAQDIITELMCTLDMKYEVAKNLFRIYDYLKGRLVEANVKKDSSIIEEVLGLVAELKETWEQIIEPSK.................................... 125
83 4.000e-35gi|291520171|emb|CBK75392.1| flagellar biosynthetic protein FliS [Butyrivibrio fibrisolvens 16/4]  clstr ali  19  5..NGYDAYAKNRILTASPAELTLMLYEGAIKFCNIAIVACENKDIEKAHINIRKTDRIIEEFEITLDDKYPVAKDFHAVYTYLRSCLRHAMIDKDPETLQEVLKHLRTMRDAWKDVMKLTANGKKLD-GQTNIAG...................... 136
84 5.000e-35gi|332983245|ref|YP_004464686.1| flagellar protein FliS [Mahella australiensis 50-1 BON]  clstr ali  19  3LNNPYHQYQQNSIMTASPGDLILMLYDGAIKFIKQAKVYIDEKDMQKANNAILKAEDIVAELMADLDPAYDISHDLYSLYEFINDCLVRANIKKDKVLLDQSLDLISDMRQTWAQVVKQYRQQEYA............................... 128
88 7.000e-35gi|220932539|ref|YP_002509447.1| flagellar protein FliS [Halothermothrix orenii H 168]  clstr ali  17  4..NPYQKYKKTRFETANREKLILMLYEGAIKSLNHAKKGMEEDNIELINESLKKSQDIINELMVSLNPEGEIATNLYSLYDYMQRRLIEANLKKEIEPVKEVKKMVEELHETWKEAMLQVHKTKYAGQKKQ.......................... 133
89 8.000e-35gi|310644318|ref|YP_003949077.1| flagellin-specific chaperone flis [Paenibacillus polymyxa SC2]  clstr ali  20  3.TSPYEKYRQSSVQTSTPSQLVVMLYDGAIRFVKAGLVALDSKDYQKVNLNLGKAQTIISELMSTLDHSYDISKSLFALYEYMNYLLIQANIKKSADPANEALGYLTELRETWVQASKLTAGAADTAIGSN.......................... 132
94 1.000e-34gi|333979237|ref|YP_004517182.1| flagellar protein FliS [Desulfotomaculum kuznetsovii DSM 6115]  clstr ali  19  5.SNPYQQYLQNAVLTADPGRLTLMLYTGAVRFIRQASDCLAARDIPGAHRACLRAQDIIVYLLETVNREMEVGKNLSALYDYMYRRLVEANVKKDAAVLDEVAGLLEELADTWEQALKLKGQQ.................................. 126
95 1.000e-34gi|310659632|ref|YP_003937353.1| flis [Clostridium sticklandii DSM 519]  clstr ali  16  3MNNPYAKYKEQSVTTATPEELTLMLYNGCIKFINLAEVYIEEKDYAKSNLNIQKAQGIIQELNITLNMDYEISQNLRQLYTFVNEKLLDANIKKDKQALFDAKEIVSDLRDTWKEAMALSRKG.................................. 125
96 1.000e-34gi|157693935|ref|YP_001488397.1| flagellar protein FliS [Bacillus pumilus SAFR-032]  clstr ali  18  4.QNPYAAYQKNSIETATPAELTLMLYEGCLKFIRLAKYAIQKEDAETRNVNLKKAQNIIQELNVTLNRSYDVSKSMASMYDYIYRRLIEANFQNDEEMLNEVEQYVTDFRDAWKEVIQNDRKG.................................. 125
97 1.000e-34gi|387928633|ref|ZP_10131311.1| flagellar protein FliS [Bacillus methanolicus PB1]  clstr ali  20  4.QQFHQVYKQNSVSTASPGELTLMLYNGCLKFLAKMKQAIIEKNISERNVNSQKAQRIIQELMVTLNQEYEVAKQMMAMYDYMNRRLIEANVKNDVAIVEEVEGFVTEFRDTWKEVIRLNRQKQ................................. 126
99 2.000e-34gi|225374762|ref|ZP_03751983.1| hypothetical protein ROSEINA2194_00382 [Roseburia inulinivorans DSM 16841]  clstr ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGR.................................... 123
101 2.000e-34gi|83589618|ref|YP_429627.1| flagellar protein FliS [Moorella thermoacetica ATCC 39073]  clstr ali  22  5..NPYQAYQQNQVQTLSQEKLVLMLYDGALRFCRQGLVAMEQKDYAAVSNNLGRAEDILSELMATLNRDGDIAENLYKLYDFMYRHLVQANVKKSVKMIKEVIELLQQLRDTWEEATK....................................... 121
102 2.000e-34gi|240145375|ref|ZP_04743976.1| flagellar protein FliS [Roseburia intestinalis L1-82]  clstr ali  15  4.NKGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVEHIIEEFQSTLNHKYPVAKDFDEVYNYLMMRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
104 3.000e-34gi|345873504|ref|ZP_08825412.1| flagellar protein FliS [Thiorhodococcus drewsii AZ1]  clstr ali  18  4MRRELQQYRQSEATVADPHRLIQMLFEGALERIAVAKGAMEQGNIQLKGNKLTQAISIIGGLRSSLDLGGDLAGNLDALYEYMTRRLLQANIHNDTDALDEVIRLLREIKSAWDGIPDRLRQA.................................. 132
106 3.000e-34gi|408356024|ref|YP_006844555.1| flagellar protein FliS [Amphibacillus xylanus NBRC 15112]  clstr ali  19  3.QQPYQAYINNSVNTASPAELTLMLYNGCLKFIRYGKKGIEEQNMELKNTNIQKAQNIITELMVTLDQSAPIAKDIMPLYDYINQLLIEANIKNDLNSLDEAANLVEEFRDTWKEVIKQTRTREYKQGVQ........................... 131
108 3.000e-34gi|359781444|ref|ZP_09284668.1| flagellar protein FliS [Pseudomonas psychrotolerans L19]  clstr ali  17  7MRQYQQVGLQAQVFEASPHQLIQMLMQGALDRLAKAQGALERGWLPEKGELIGKTVSIVAGLKDVLDFEGEIAVNLDRLYDYMIRRLSEANRNNDPVILEEVSGLIREIKSGWDAIAP....................................... 126
109 3.000e-34gi|363889111|ref|ZP_09316477.1| flagellar protein FliS [Eubacteriaceae bacterium CM5]  clstr ali  18  2LSNPYAKYKENSINTASKEELTLMLYDGCIKFMNLAKIAIEEKNIQKANDNLLKAQAIVTELDITLNMDIEISKNLHSLYDFVQNRLIEANLTKKASFVDEAKLIITDLRDAWKEAINLVRRG.................................. 124
112 3.000e-34gi|374298241|ref|YP_005048432.1| flagellar biosynthetic protein FliS [Clostridium clariflavum DSM 19732]  clstr ali  23  4.NNGYEQYRESSVYTATPEELVLMLYNGLVKFLMQAQMAINKKNIEKANNCIIKAQNILTEFRCTLDMKYDIAHQLDSLYDYMLSRLIDANIKKDNTIIEEILGYARELRNTWEQAMKIAKQQN................................. 126
113 4.000e-34gi|363894340|ref|ZP_09321427.1| flagellar protein FliS [Eubacteriaceae bacterium ACC19a]  clstr ali  17  4..NPYAKYKENSVNTATKEELTLMLYDGCIKFMNLAKIGIEEKNIEKANDNLLKAQAIITELDITLNMDIEISKNMHSLYDFALSRLVDANLKKDASLIDDAKSVIVDLRDAWKEAMNIVKRG.................................. 124
114 4.000e-34gi|350548141|ref|ZP_08917463.1| flagellar protein FliS [Thermobacillus composti KWC4]  clstr ali  20  2LTTPHQIYQQSAVNTSNPLQLIIMLYDGAIKHVKLGIEGIETNDFQKANTHLVKAQSVINELISSLNFQYPIAELLLQIYDYLVRNLIEANVKKQKDPALEVLGHLSNLRDAWQQVAKRGSAAP................................. 125
115 4.000e-34gi|323703161|ref|ZP_08114814.1| flagellar protein FliS [Desulfotomaculum nigrificans DSM 574]  clstr ali  19  4.KNPYQNYQQNAIMSAGPEELTTMLYNRLVKDLKLAREHVENRDIEGAHSSIVHAQDILSHLMHTLDTSYEVGQNLMAMYDYMYRCLVQANLKKDANLIQEVTGYAEEIRDTWIQAVKLAKSSAAMGN............................. 130
117 5.000e-34METAHIT MH0006 GL0273905 [Complete] locus=scaffold319591_1:921:1310:+  ali  18  10....YAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKA..................................... 125
118 5.000e-34gi|253998463|ref|YP_003050526.1| flagellar protein FliS [Methylovorus glucosetrophus SIP3-4]  clstr ali  18  9.NEYSRVGVETGVVSADPHKLVVMLYDGAMTACHTAVMHMEAKDFERKGAMISKAIMIIEGLRLSLDKKGEIATSLDALYGYMSDRLYMANIKNDPSLIQEVIRLLGDLKSAWEAIGTQVAPDNTQFQRVQNYA....................... 144
119 7.000e-34gi|291287362|ref|YP_003504178.1| flagellar protein FliS [Denitrovibrio acetiphilus DSM 12809]  clstr ali  19  1MQSPYKNYIKQEVEGATKGKLVLLMYDGAIKFLRVAVKAVNENNIPDAHNNIMKAQNIIYELMSTLNMEGDVAKNLMRLYDFMIWQLVEANKEKDNTKIESVIKLMSSLREAWKEVVQKEEGSVKQEPEET.......................... 132
120 7.000e-34gi|414154933|ref|ZP_11411250.1| Flagellar protein fliS [Desulfotomaculum hydrothermale Lam5 = DSM 18033]  clstr ali  17  4.KDPYKSYQQNAVLSAAPEELTTMLYQRLVKDLKLARESVEKKDIEAAHRCITHAQDIIAHLLDTLDTSYEVGQNLQLMYDYMNRRLVEANIKKDPEILREIAGYAAELRDTWVQAVKQVKTGVAA............................... 128
121 7.000e-34gi|154687649|ref|YP_001422810.1| flagellar protein FliS [Bacillus amyloliquefaciens FZB42]  clstr ali  15  4.NNPFAAYQQTSVFTAAPEELTLMLYNGCLRFIKLARQAMKQNNLEAKNENIVKAQNIIQELSITLNREIEISEQMSSIYDYIRRRLIDANVQNNGEFLDEAEKLVTEFRDTWKQAMQSERK................................... 124
122 8.000e-34gi|225181618|ref|ZP_03735059.1| flagellar protein FliS [Dethiobacter alkaliphilus AHT 1]  clstr ali  18  2LANPYQKYKQNQVETSSPQQLIIMLYNGAIKFLKLAQMGITEQSIEKAHTNIIKTQDIINELMASLDMQGEVASHLYSLYDYMNSRLLEANLKKDTQILSEVENMLTELRDSWVQALK....................................... 120
126 1.000e-33gi|120555500|ref|YP_959851.1| flagellar protein FliS [Marinobacter aquaeolei VT8]  clstr ali  15  4LQAYQRVNAQTSITDADPHKLIQLLYSGALERINMAKARMQANDIEGKGRLISKAIEIIGGLRSFLDFEGDLAERLEGLYDYMERTLFEANVKNDPAKLDEVAELLRSIKEGWDGIREEVVTQHSQAAG............................ 134
127 1.000e-33gi|146312170|ref|YP_001177244.1| flagellar protein FliS [Enterobacter sp. 638]  clstr ali  16  8.QAYQKVGVESAVLSASPHQLVVMLFDGVHSALVRARLFLEQGDIPAKGEALSKAINIIDGLKAGLNMDGTLPHNLSALYDYMVRRLLHANLRNDVEAIVEVEALLLNISDAWKQINPGFPPTQDQ............................... 135
128 1.000e-33gi|366163991|ref|ZP_09463746.1| flagellar protein FliS [Acetivibrio cellulolyticus CD2]  clstr ali  20  4.NNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQSQMGINEKNIEKANNCIIKAQNIISEFRCTLDMKYEISKQLELIYDYMNRRLIEANIKKDVTIVEEILGYARELRNTWEQAMKIARQQNAG............................... 128
129 1.000e-33gi|427401096|ref|ZP_18892334.1| flagellar protein FliS [Massilia timonae CCUG 45783]  clstr ali  22  11..AYATVGLETGVASASPHKLVVMLYDGVIVALLSAINGIKSSNIATKGASISKAITIIDGLRASLDKKGEIAANLDALYDYMSRRLLEANIKNDAAIVEEIHGLMANLREAWVQIGEQQAAAEPMPPAIQ.......................... 142
131 1.000e-33gi|406980427|gb|EKE02025.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  23  1MNPYLKQYQQTEVQTASPEKLLIMLYDGAIQFLNKAKTGIANKNIEEIHNNIIGAQKIISEFMNTLDMEGEVAQNLYNLYEYLHYRLVQANIKKDNDMVDEVLTHLKDLKQTWEEAIRIAAREKSM............................... 128
132 1.000e-33gi|326202866|ref|ZP_08192733.1| flagellar protein FliS [Clostridium papyrosolvens DSM 2782]  clstr ali  19  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDQRKIERANNSIIRAQDIVREFQVTLDMKYEVSKHLDSIYDYMYRRLIQANIKKDKAILEEMLEMAKDLRDTWTQAMKLAKRQ.................................. 125
134 2.000e-33gi|134300254|ref|YP_001113750.1| flagellar protein FliS [Desulfotomaculum reducens MI-1]  clstr ali  16  4.KNPYSNYQQNAIMSAGPEELTTMLYNRLVKDLKLAQGHIEQKEIQLAHNNITHAQDILDHLMNTLDTSVEVGKNLELMYDYMSRRLVEGNLKKDKEILQEVAGFAEEIRDTWVQAVKQVKTG.................................. 125
135 2.000e-33gi|383755288|ref|YP_005434191.1| putative flagellar protein FliS [Selenomonas ruminantium subsp. lactilytica TAM6421]  clstr ali  21  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMGEGKEAVEAKQYEQANTSLQKAQQIISEFRITLNMDYDISHQLMPLYNYCYDRLVEGNMKSDPALVQEAIDIIKELRDAWMQAMKKARQDGGTRNVQ........................... 131
136 2.000e-33gi|397687783|ref|YP_006525102.1| flagellar protein FliS [Pseudomonas stutzeri DSM 10701]  clstr ali  15  7MKQYQSVNTNAQLVDATPHRLIQMLMEGGLTRLAQAKGAMERNDVALKGTLIGKTIDIVGGLRQGLNLEGEVAANLDSLYIYMTTRLVEANRKNDPTILDEVAGLLREIKSGWDGISQQ...................................... 127
137 2.000e-33gi|220935147|ref|YP_002514046.1| flagellar protein FliS [Thioalkalivibrio sulfidophilus HL-EbGr7]  clstr ali  18  7.HQALNQYRDAEVNEANPHRLIQMLFDGALERIATAKGAMQQGNVAVKGERISKAIGIIDGLRAHLDMEGEVAANLDALYEYMGRRLTEANLRNDPAMLDEVSKLLREVKAGWDAIPAQQAAE.................................. 133
139 2.000e-33gi|313897035|ref|ZP_07830582.1| flagellar protein FliS [Selenomonas sp. oral taxon 137 str. F0430]  clstr ali  20  3.NTAADAYKRQQVMTATPEALTLMLYNGCLKFIKEGVEALAEKHYETANESLQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKSDPAIIAEASDIMTELRDAWAQAMKKAREEKGSQGTEGVYAG...................... 138
140 2.000e-33gi|300311382|ref|YP_003775474.1| flagellin-specific chaperone FliS [Herbaspirillum seropedicae SmR1]  clstr ali  15  10.NAYANIGVETGVLAASPHKLITMLFDGALVAIALGKKYMAEGNIKDKGESITKAILIVDGLRASLNKEGELALNLDSLYEYMSRRLFEANATNNPAILDEVHSLLEDIRSAWEQIGPNGQPASMQAAPAPTAA....................... 145
141 2.000e-33gi|313673156|ref|YP_004051267.1| flagellar protein flis [Calditerrivibrio nitroreducens DSM 19672]  clstr ali  22  3.QQAQKTYLKNEIEGATKGKLVLLLYDGAIKFINMAVKGIEEKNIVAAHENIIKAENILYELLSTLNMEGEIAENLFKLYDFAIWQLVEANKTKDAEKLTPVLGILKTLRDAWKEVVTQEEEKQTVNNQQKV......................... 135
144 3.000e-33gi|28211372|ref|NP_782316.1| flagellar protein fliS [Clostridium tetani E88]  clstr ali  20  4.NNAYNTYKTNSVNYASKEQLLLMVLDGAVKFSKIAKQGIEEKDIVKAHENIIKTQNIFYELMATLDVEGQWAENLMRIYDFIVQKLLEANIKKDVKVMNEIIPLIEDIRDTWHEAYKIAKNA.................................. 127
145 3.000e-33gi|23099955|ref|NP_693421.1| flagellar protein FliS [Oceanobacillus iheyensis HTE831]  clstr ali  22  4.NNAYQVYQNNSVNTASNGELTLMLYNGCMKFIKQAKKDMEADNFAEKNKNIQKAQNIIQELMITLDAKMDISKQILPLYEYMQYQLKEANIHNDTSKLDEVLGFVTEFRDTWKQVIIKNRQQQYNEGAS........................... 132
146 3.000e-33gi|218548538|ref|YP_002382329.1| flagellar protein FliS [Escherichia fergusonii ATCC 35469]  clstr ali  16  8.QAYAQVGVESGVMSASPHQLIEMLFDGAHSALVRARLFMQQGEIVAKGEALSKAINIIDGLKAGLDEEGELARNLSSLYDYMIRRLLQANVRNDVQAIEEVEGLLGNIADAWKQISPKGVSQ.................................. 132
147 4.000e-33gi|172058446|ref|YP_001814906.1| flagellar protein FliS [Exiguobacterium sibiricum 255-15]  clstr ali  22  1MANPYATYQTNSVTTALPQDLTLMLYEGLIKFSMLAKRAIEQGLIEQKNTNIQKAQAIILELQLTLNQSIALSKDLNNLYDYMQGRLIDANVKNDVVAIDEVIGFAEEFRETWKEAMKLARQ................................... 122
148 4.000e-33gi|323490128|ref|ZP_08095348.1| flagellar protein FliS [Planococcus donghaensis MPA1U2]  clstr ali  19  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFMKLAKRAMADKKIEEKNTNIIKAQNIIQELRSTLKADIEMSAGLEQMYEYMYSRLVEANMKNDVSALEEVEELMTDIRNTWKQAMALVKK................................... 124
149 4.000e-33gi|338814362|ref|ZP_08626383.1| flagellar protein FliS [Acetonema longum DSM 6540]  clstr ali  17  7....ANAYKNQQIMTASPEELTLMLYNGALKFMTESVQAIEEKKYEKAHETNIRSQNIIREFMTTLDMQYELSHNLYEIYDYMHRSLIEANLKKDAAKLKEIRDLLRELRDAWAEAMKRARQDRVGAAV............................ 131
150 4.000e-33gi|398833238|ref|ZP_10591375.1| flagellar biosynthetic protein FliS [Herbaspirillum sp. YR522]  clstr ali  14  10.NAYAKVGIETGVLAASPHKLITMLFDGALMAIAMAKKHMAEGDIKHKGESITKAILIIDGLRASLNKDGELALNLDSLYEYMSRRLFEANVNNNGDILTEIHGLLDGIRDAWQQIDPQGGGSAPAAQPA........................... 141
151 5.000e-33gi|113969620|ref|YP_733413.1| flagellar protein FliS [Shewanella sp. MR-4]  clstr ali  17  5MQSYRKVSVESDLGVASPHRIIQMLFAGALERLAQAKCAIEQGNIAQRGLFLGKAIGIVSGLNSSLNMEGDVATNLTRLYDYMLRRMSEANINNDVQAIDEVVAILKTIKEGWDAIPADKHN................................... 128
152 5.000e-33gi|121535523|ref|ZP_01667331.1| flagellar protein FliS [Thermosinus carboxydivorans Nor1]  clstr ali  20  5..NMANAYKTQQIMTAPPEQLTLMLYNGAIKFVDESIQAIEQRDFPKAHASNLRAQDIVRELMVTLDMQYEIAKTWYQLYDYILYRLIQGNIKKDKDQLQEARGMLQEFRDTWVEAMKRARAGQAA............................... 128
153 5.000e-33METAHIT unmapped GL0475776 unmapped_[Complete]_[mRNA]_locus=scaffold485658_1:2:382:-  ali  20  4.SNPYNAYKQNSVKMASKQQLLLMLVDGAVKYTKIARLAIEKKDITRAHNELVRVQDIFTELMVTLDKSGQVYEDLYKVYEYIKSRLIEANIKKDVAIIDEVLPLIENVRDTWYEVSKKSKG................................... 125
154 5.000e-33gi|329298574|ref|ZP_08255910.1| flagellar protein FliS [Plautia stali symbiont]  clstr ali  12  8.QAYAQVGLESAMLSASPHQLVVLLFDGALSAMKKATILMDQGDIPGKGQALSKAINIINGLRTGLNHEGEISANLDNLYEYMTRRLLEANLHNDPAAIAEVERLLSNIADAWKQIGPHAVQEA................................. 133
155 5.000e-33gi|345023056|ref|ZP_08786669.1| flagellar protein FliS [Ornithinibacillus scapharcae TW25]  clstr ali  19  4..NKYQAYQNNAVNTATGGELTLMLYNGCLKFIKQAIKDVQDNNIEAKNTNIQKAQKIIQELMITLDQSVEISKQIMPLYDYMYNRLMEANIKNDINILEEVQGFVVEFRDTWKQVILKTRQKQYAQ.............................. 128
156 6.000e-33gi|392955430|ref|ZP_10320961.1| flagellar protein FliS [Bacillus macauensis ZFHKF-1]  clstr ali  19  4.QNPNLLYQNNAVATASPGDLIVMLYNGCLKFITTAKQAIINHDIPLKNTMIQKAQKIIQELMVTLNPEVMLSESLLSLYDYMHRRLIQANIETNIRYLEEVESYLVDLRDTWKEVVRMQPR................................... 124
158 6.000e-33gi|388257166|ref|ZP_10134346.1| flagellar protein FliS [Cellvibrio sp. BR]  clstr ali  16  10LKQYQKLGIESEVSHASPHRLIQLLFEGALGRLAAAQGAMERGDIAVKGEMLGKAIGIVGGLRSSLDMDGEISERLDQLYEYINLRLLEASAQNDIDKVVEVIQLLKTVKSGWDEIGPQAAKAP................................. 134
160 8.000e-33gi|167623374|ref|YP_001673668.1| flagellar protein FliS [Shewanella halifaxensis HAW-EB4]  clstr ali  14  5LQSYRKVSLESEIAVASPHRIIQMMFDGALQRIAQSRYAIENKDLANKGIFIGKAIGIITGLNNSLNMEGDVSKNLSELYDFMLRQLSEANLNNDVQALDNVSGIIRTIKEGWDAIPSEQH.................................... 127
161 8.000e-33gi|357038972|ref|ZP_09100768.1| flagellar protein FliS [Desulfotomaculum gibsoniae DSM 7213]  clstr ali  14  3LNNPYQRYQQNSVSSAPPQELTNMLYSGGVRFIRQAMQSIEENEMEKAHQELVRAQEIYKHLQDTLNMDIKISNNLYNLYDFMIRQLLQANIKKDIAILHEILGLAEELRNTWKEAMVKARGQ.................................. 125
163 9.000e-33gi|308071099|ref|YP_003872704.1| flagellar protein fliS [Paenibacillus polymyxa E681]  clstr ali  17  3.NTPYQKYRQTQAQTASKPKLLIMLYDGAIRFVRAGIEGIENKDNEKANNNLCKAQAIVHELISALNFEYPISHDLLRIYEYMLHELIEANIHKIAAPAQEVLEHLTDLREAWLEAMKMP..................................... 121
164 9.000e-33gi|157371182|ref|YP_001479171.1| flagellar protein FliS [Serratia proteamaculans 568]  clstr ali  14  8.QAYAQVSLESGVMSASPHQLIVMLFDGALSALLRARILMNQGDIAGKGLALSKAINIIDGLKSGLDHQGEMADNLAALYDYMKRRLMQANLHNDEAAITEVVKLLENIADAWRQIGPNYHPSQDA............................... 135
166 1.000e-32gi|407795332|ref|ZP_11142291.1| flagellar protein FliS [Salimicrobium sp. MJ3]  clstr ali  21  4.....QAYENNTVETASQGELVLKLYNGCIKFIKASGKAMENNDIEKKNLNIQKAQRIVQELIITTDPSYDISQQILPLYEYMNRRLLEANTKNDREILDEVRGLAEEFRDTWKEVLIQTRKAEYSKGG............................ 127
167 1.000e-32gi|156933468|ref|YP_001437384.1| flagellar protein FliS [Cronobacter sakazakii ATCC BAA-894]  clstr ali  16  8.QAYQQVGLESAVMSASPHQLVVMLFDGALSALVRARLFIEQGDTVAKGQALTKAINIIDGLKAGLNMDGDLPRNLASLYEYMVRRLLHANLRNDVDAINEVETLMTNIADAWKQIGP....................................... 127
168 1.000e-32gi|127512292|ref|YP_001093489.1| flagellar protein FliS [Shewanella loihica PV-4]  clstr ali  14  5LQSYRKVSLESEISVASPHRIIQMMFEGALQRLAQSRYAIENNDIENKGIYIGKAIGIITGLNNSLNMEGEIASNLSDLYDFMLRKLSEANMNNDVQAIDDVSEIIRTIKEGWDAIPQNEHHLA................................. 130
170 1.000e-32gi|345879614|ref|ZP_08831237.1| 3-isopropylmalate dehydrogenase [endosymbiont of Riftia pachyptila (vent Ph05)]  clstr ali  18  10.SQYGQVATSSEVAYASPHRLVQMLMEGALDKMAAAKGFIQRKDMGQKSRHISWALSIINGLRGALDLEGDIARNLDDLYEYMGRRLMAANSSNDPEILDEVASLLTEIKLAWDALPDEVKQLPQEKISPAVGA....................... 144
171 1.000e-32gi|227112544|ref|ZP_03826200.1| flagellar protein FliS [Pectobacterium carotovorum subsp. brasiliensis PBR1692]  clstr ali  12  8.QAYAQVGLESSVMSASPHQLIVMLFDGARSAMVRARILMEQGDIQGKGMALSKAINIINGLKTGLDMEGELVENLSALYDYMSQRLLIANLHNDAKAIEEVEALLENIADAWRQIGPNYKPEQE................................ 134
173 1.000e-32gi|374300990|ref|YP_005052629.1| flagellar protein FliS [Desulfovibrio africanus str. Walvis Bay]  clstr ali  19  1MYKAAQKYLATQVTTTDQGQLLIMLYDATIKFLNQAKIKIDEKDYAQKGILISKALDIISELASSLNKDGDIADNLNQVYLYCNTRLLMANLKMDKGIIDEVIKILTGVRDAYAQIIKEGATAPTA............................... 128
174 1.000e-32gi|40889902|pdb|1VH6|A Chain A, Crystal Structure Of A Flagellar Protein  clstr ali model  18  6.QNPYTAYQQNSVNTATPGELTLXLYNGCLKFIRLAAQAIENDDXERKNENLIKAQNIIQELNFTLNRNIELSASXGAXYDYXYRRLVQANIKNDTGXLAEVEGYVTDFRDAWKQAIQSERK................................... 126
175 2.000e-32gi|169831930|ref|YP_001717912.1| flagellar protein FliS [Candidatus Desulforudis audaxviator MP104C]  clstr ali  18  4.TNPFAHYQQNAVLNAGPGQLVLMLFNGILRFVKQADLALENGDLPRAHNALVRAQDIVSYLRETLNTDFKIGQDLDALYDYIYNRLVQANLKKEREMLAEVDRMVRELKEAWSQ-ALKPRSAPEQEPAK........................... 131
178 2.000e-32gi|182412265|ref|YP_001817331.1| flagellar protein FliS [Opitutus terrae PB90-1]  clstr ali  20  6...YVQTYRTNAVLTASPAQLVLMLYDGALKAMSIAREAMERTDIETINHQLQKAQNIVLELQGGLNFEGDFAKTLHRLYDYHYRRLFEANLRKDLAPLIEVEGLLRQLRDAWAEMLTKQEPDKSEQ.............................. 136
179 2.000e-32gi|119469963|ref|ZP_01612768.1| Flagellin-specific chaperone FliS [Alteromonadales bacterium TW-7]  clstr ali  20  7.KNYQKEALKTRVAGADRYEIIQMLMAGAVEKMVLAKVAIEKKHFEAKSEHISKASAIINALRGCLDFDGDVSTNLYSLYTYMDERLLDASIKNDPEIITEVSNLLKEIKSAWDAIPHDVREQTLSENGIDANVG...................... 142
180 2.000e-32gi|291278985|ref|YP_003495820.1| flagellar protein FliS [Deferribacter desulfuricans SSM1]  clstr ali  19  1MKNPIKTYLKNEIEGATKGKLVLLLYDGTIKYMKLACKYIDEKNIPEAHMNIVKAENIIYELMSTLNMEGEIAENLLKLYDFMVYQLIMANKDKDKSKIESVIKLMMVLREGWKQIVEKEEKADTSEVVKK.......................... 133
181 2.000e-32gi|289208620|ref|YP_003460686.1| flagellar protein FliS [Thioalkalivibrio sp. K90mix]  clstr ali  15  6MNRAVNQYRQAEAQVADPHRLIQMLFEGALERIAVAKGAMQQGNVAVKGERIGKAIDIVESLRAMLDHKHELAANLDALYAYMTRRLLEGNAQNDPAALDEVAKLLREIKAGWDDIPPEERQ................................... 133
183 2.000e-32gi|242238978|ref|YP_002987159.1| flagellar protein FliS [Dickeya dadantii Ech703]  clstr ali  14  9.QAYAQVGLESGVMSASPHKLITMLFDGAISALVRADIFMEQGDTVAKGNAITKAVRIIDGLLASLDMEGEISTNLAQLYDYMIRQLLNANLRNDRELLQEITELLRGIADAWKQVDP....................................... 128
185 2.000e-32gi|395232235|ref|ZP_10410486.1| flagellar protein FliS [Enterobacter sp. Ag1]  clstr ali  15  8.QAYQQVGLESAVMSASPHQLVVMLFDGALSALVRARLFLEQEQIPQKGEALSKAINIIDGLKAGLNMDGDLPANLANLYDYMVRRLLHANLRNDVEAIAEVERLLANIADAWKQIGPTSP.................................... 130
186 2.000e-32gi|306820104|ref|ZP_07453752.1| flagellar protein FliS [Eubacterium yurii subsp. margaretiae ATCC 43715]  clstr ali  13  5.SNPYQRYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDAWREAMIIVRKGQ................................. 127
188 3.000e-32gi|261821176|ref|YP_003259282.1| flagellar protein FliS [Pectobacterium wasabiae WPP163]  clstr ali  14  8.QAYAQVGVESAVMSANPHQLIVMLFDGAKSSMVRARILLEQGDIPGKGAALSKAINIINGLKVGLDMEGELSENLSALYDYMTQRLMIANLHNDMKVIEEVETLLENIASAWRQIGPNYHPSQE................................ 134
189 3.000e-32gi|114046850|ref|YP_737400.1| flagellar protein FliS [Shewanella sp. MR-7]  clstr ali  13  5LQSYRKVSLESQIADASPHRITQMLFNGALERIAQSKIAMEQCDIASKGLLIGKAIGIILGLKNTLDAGGDIATNLANLYDFMVQRLTDANVQNDPVALDDVAGLLREIKEAWDAIPADKHN................................... 128
190 3.000e-32gi|404492717|ref|YP_006716823.1| flagellin export facilitator protein FliS [Pelobacter carbinolicus DSM 2380]  clstr ali  19  1MNPYLNQYKNNQISSASPEQIMIMLYDGAIRFLTQAMQGIEDGNIELKNHGIQKAMAIVMEFRNTLDHNGKIAADLDSLYDYMIREMIQANINLDRSKLEAVHTMLSDLRDTWKEAIVIARSE--SQAKAVANAGY..................... 136
193 3.000e-32gi|335042235|ref|ZP_08535262.1| flagellar biosynthesis protein FliS [Methylophaga aminisulfidivorans MP]  clstr ali  14  10MEGYGRGAIESEVNYASPYRIIQMLMEGALARVATAKGCIARNEIAEKGHQISWCIRIVEGLKTSLDAEGEIAVNLDSLYDYITRRLLEANVSNDVAILDEVTKLLEEIKAGWDGIPPE...................................... 130
194 3.000e-32gi|326792648|ref|YP_004310469.1| flagellar protein FliS [Clostridium lentocellum DSM 5427]  clstr ali  17  6....YQKYQQNSVLTASPQELTLMLYNGAIKSCNQGIEAIEEGKIEKAHQYITKTQDIILELKCTLDDKYPISKNFEELYDYIMMLLVDANITKNGERLLEAKAFITDFRDLWKEAMKASKS................................... 123
195 3.000e-32gi|344344303|ref|ZP_08775167.1| flagellar protein FliS [Marichromatium purpuratum 984]  clstr ali  18  4MRKELNQYRQAEVAVASPHRLIQMLFEGAVERIAVARGAMTHGNLQTKGEQLSKAINIIESLRAVLDHDGELAENLDALYSYMSRRLLEGNARNEPEALDEVSDLLRTIKSGWDEVPE....................................... 127
197 3.000e-32gi|345299804|ref|YP_004829162.1| flagellar protein FliS [Enterobacter asburiae LF7a]  clstr ali  16  9..SYQKVGVESAVMSASPHQLIVMLFDGALSALVRARLFLEQGDLVSKGEALSKAIGIIDGLKAGLDMEGDLSNNLASLYDYMVRRLLLANMHNDVETIIEVEGLLNNIADAWKQIGETASTHQDMR.............................. 136
200 3.000e-32gi|406886603|gb|EKD33600.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  17  2..NAYSQYHQNQILSASPEQILLMLYDGAIRFTRQAIYGIEEDNLTLFHNGIRKSMAIITEFSNSLDHGGEIAENLDALYNFMIRELTLANLHKDIEKLRIVEKLLVDLRATWEEAVEINKGE.................................. 124
201 3.000e-32gi|348029800|ref|YP_004872486.1| flagellar protein FliS [Glaciecola nitratireducens FR1064]  clstr ali  17  7.NAYKKGNLKQDIATADPHRLTLMLMQGALDRMAYAKGCMERKDFAGKSEHLSRVSAILLNLRDTLDLDGEVAQNLYALYEFMVQRLLDANMQNSLQIMDEVINLLLPIKTAWASIPEDAKQEAYEIQRQKRQS....................... 141
202 4.000e-32gi|338731716|ref|YP_004661108.1| flagellar protein FliS [Thermotoga thermarum DSM 5069]  clstr ali  21  1MKDY---YLENAIKTASPAKLVEMLYERAIELLKEAKAAIEQKDYVLSNEKISKVQEIITELNVSLDMEGEIAQSLRALYNYMYKTLIEANLKKDIQKLDEVLYFVEQLLDAWKVAMKTAKPPSIQDRQ............................ 128
204 4.000e-32gi|157145276|ref|YP_001452595.1| flagellar protein FliS [Citrobacter koseri ATCC BAA-895]  clstr ali  15  9..SYQKVGVESAVMSADPHQLIVMLFDGALSALVRARLFLEQGELLSKGEALSKAINIIDGLKAGLNMEGDLSRNLASLYDYMIRRLLLANLHNDVEAIIEVEGLLTNIADAWKQIG........................................ 126
205 4.000e-32gi|407794780|ref|ZP_11141802.1| flagellin-specific chaperone FliS [Idiomarina xiamenensis 10-D-4]  clstr ali  17  6LKGYTQDSLRSRVAGADPYQLVQLLMAGALENMSYAKGAIQRKDLEKKSVHLSKASAIIESLRSSLNMEGEVSENLDNLYLYMYDRLTEASLKNDVEIIDEVAKLLKQIKSAWDAIPMTEREVAMTQMQQQASGA...................... 142
206 4.000e-32gi|381160364|ref|ZP_09869596.1| flagellar biosynthetic protein FliS [Thiorhodovibrio sp. 970]  clstr ali  16  6MKKSTDQYRQSEISVASPHRIIQLLFEGALERIAVGKGAMLQGNIAKKGEQISKAINIIDGLRGVLDHEGELAERLDALYEYMSYQLLQANLRDNPDALDEVTKLLREVKSGWDEIPEELRNSA................................. 135
207 4.000e-32gi|312793845|ref|YP_004026768.1| flagellar protein flis [Caldicellulosiruptor kristjanssonii 177R1B]  clstr ali  17  27...AAARYQEEVIMTKPPEELTLMLYDGCIRFIKLAMQAIDEKKLDKANENIIKAENIITELMSTLDMSYEISKNLMSLYDFVYRWLIQANLKKDKKYLEEALEIVQDLRNTWAEAIKIARQQ.................................. 146
208 4.000e-32gi|311070039|ref|YP_003974962.1| flagellar protein FliS [Bacillus atrophaeus 1942]  clstr ali  18  4.QNPYTAYQQNSINTATPGELTLMLYNGCLKFIKLANQAIHLGDMESKNVNLIKAQNIIQELNITLNRDIELSGSMGAMYEYIHRKLVEANIQSDKDILAEIEGYITDFRDAWKQAIQIERK................................... 124
209 4.000e-32gi|407682869|ref|YP_006798043.1| flagellar protein FliS [Alteromonas macleodii str. `English Channel 673`]  clstr ali  15  7.NAYKKGNLKQDVANADPHKLTLMLLQGALDRIAYAKGAMERKELQEKATFISKATAIIIHLRDTLDVKGEVAENMFALYEFMIEKLNEAHVNNDIKLLDEVSSLLSPIRDAWVQIPQEAKEEAFRAQRESKQA....................... 141
211 4.000e-32gi|407472784|ref|YP_006787184.1| flagellar protein FliS [Clostridium acidurici 9a]  clstr ali  19  4.NNPYNQYKQNSVTTASPEELTLMLYNGAIKFVNIAKIEMEAKNIERTNEAIVRSQDIIRELNGSLNMNYPISENLRTLYTFILEKLIDANIQKDIKIIEEILPIIEEMRDTWKLVIEEVKRQKFAQGA............................ 131
213 4.000e-32gi|410463863|ref|ZP_11317348.1| flagellar biosynthetic protein FliS [Desulfovibrio magneticus str. Maddingley MBC34]  clstr ali  26  1MQSAVKNYLQTQVSTTTQGDLVIMLYDAALKFLHRAKERIAEKNYAQKGILISKALDILSELQGSLNKGGDLAERLQKLYFYCSSRLLTANLKMDVTKIDEVVGILNGLREAFVEANAMVATKAVTEATQNTRIGITAAP................. 143
214 5.000e-32gi|389815090|ref|ZP_10206449.1| flagellar protein FliS [Planococcus antarcticus DSM 14505]  clstr ali  15  5..NPYQTYQQNSVMTASPQELTLMLYSGSVKFIKIAKRAMNDKNFQEKNTNIIKAQNIILELRSTLNSDIDMSTGLEQMYEYMYSRLLEANMKNDLEALEEVETLMTDMRNTWKQAMALARK................................... 124
215 5.000e-32gi|392427067|ref|YP_006468061.1| flagellar biosynthetic protein FliS [Desulfosporosinus acidiphilus SJ4]  clstr ali  16  6.TNPYSAYRQTSVATASPDKLLLMLFDGAIRFLIQARVAMEEKNHEATNKWLQKLQDIFMELNLSLDMQGEVSVNLRKLYEFYQNEVLMANVEKSVERLQPVEDFLRSFRETWAEAARIVNQQH................................. 129
216 5.000e-32gi|114319865|ref|YP_741548.1| flagellar protein FliS [Alkalilimnicola ehrlichii MLHE-1]  clstr ali  22  6MNSGIDQYQQSGAAYADPHRLIEMLLDGGIDRLAQAKGALHQGDRALKSQLIGKAIAIIDGLRGGLDRKGELAQNLDELYDYMQRRLVSANARNDEAILDEVSKLLNEIRDAWQAIPAELRDKEAAERAA........................... 141
217 5.000e-32gi|16765299|ref|NP_460914.1| flagellar protein FliS [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  clstr ali  16  8.KAYAQVSVESAVMSASPHQLIEMLFDGANSALVRARLFLEQGDVVAKGEALSKAINIIDGLKAGLDQEGEIATNLSELYDYMIRRLLQANLRNDAQAIEEVEGLLSNIAEAWKQISPKA..................................... 129
220 5.000e-32gi|284041504|ref|YP_003391844.1| flagellar protein FliS [Conexibacter woesei DSM 14684]  clstr ali  18  10.....QAYRESAVLTAPPERLVVMLYDGAGRFLHQAVVTMRAGDIQTCHERLRRAEAIIDHLLETLDMQGEVAQQLESIYIFCQRLIAEARIRLDPEKLEQVRGLLAELREAWDQIGTAGSGSQAAPA............................. 133
221 5.000e-32gi|374340392|ref|YP_005097128.1| flagellar biosynthetic protein FliS [Marinitoga piezophila KA3]  clstr ali  16  13..NANDRYLESMVKTASPAKLVELLYVNAIERLNRAIKYIRDKKLPEAHNQIVRVEDIVMELNLSLDMEGEISKNLRALYSYMYRRLLEANLKKDTEILEEVKGLLNTLLEAWREAMKQAGDVIKQQVNQQPKKGL..................... 148
222 6.000e-32gi|339007021|ref|ZP_08639596.1| flagellar protein FliS [Brevibacillus laterosporus LMG 15441]  clstr ali  19  1MNQAAQIYQQNQVKTASPGELTLMLYNGGIRFSKEAKIALEKQDVQKAHQSIIKVQDIIRELMVTLDQNVAISEQFMLMYDYMYNRTIEANLKKDGAIITEVEEFFVQFRDTWKQAILIARRQPEGNQ............................. 129
224 7.000e-32gi|269836587|ref|YP_003318815.1| flagellar protein FliS [Sphaerobacter thermophilus DSM 20745]  clstr ali  24  1MINPYDQYRRIATETADPVELVLMLYRGAIRNLEVAEAALERRDSSQAHESLVKTQNIVAELMGTLNLDGELAHNLHRLYDYMQRRLLLANLRKDAAPAAEVRGMLTDLLATWEELAQRYRAARAVQPA............................ 130
225 7.000e-32gi|295697373|ref|YP_003590611.1| flagellar protein FliS [Kyrpidia tusciae DSM 2912]  clstr ali  23  4MDRASVAYRNTAVQTAAPDRLLLMLYDGLIQFLEAAKRALVEGRRADAHAFLLRSQDILRELTVTLKMDYEISHSLAALYDYYHRRLVEANVTKDPVPVEEVLEQVRELREAWANAALALRQASV................................ 128
227 7.000e-32gi|148380692|ref|YP_001255233.1| flagellar protein FliS [Clostridium botulinum A str. ATCC 3502]  clstr ali  19  8..NAYNTYKNNSVNFASKDQLLLMLMDGAVKFSKIARQAIADKDVPKAHENLVKTQDIFYELMATLDVNGQWTKNLLSLYDFIVRKLAEANMKKDVKIIDEAIPLIEEIRDIWNEAYKLSKASN................................. 131
230 9.000e-32gi|147678430|ref|YP_001212645.1| flagellin-specific chaperone FliS [Pelotomaculum thermopropionicum SI]  clstr ali  18  6....YSQYSLNAVMTASPGELTLMLFNGAVRFIRQGLNFAEEKNIEGAHNAIIRAQEIIQHLNGTLNMDYEVSKNLAMLYDYIVRRLTEANIKKDGQILKEALDLVEDLRNTWAEALKLAGPASAA............................... 127
231 1.000e-31gi|226314903|ref|YP_002774799.1| flagellar protein FliS [Brevibacillus brevis NBRC 100599]  clstr ali  20  2LQNAAQTYQSNQVTTANPADLTLMLYNGALKFIKQAKVALEEKDVIKSHEASLKVQNILYELISTLKSDYEISKEFAKLYEYMLQRTIEANMHKDVNILLEVEDLFIQFRDTWKEAMLLAKKQ.................................. 124
232 1.000e-31JCVI_PEP_1096699505893 /source_dna_id=JCVI_ORF_1096699505892 /offset=0 /translation_table=11 /length=168 /full_length=168  ali  13  33.NAYARVGVETGVMGASPHRLIVMLYQGARQAIAQARMHVQQGNVPARGEAIGKAIQIVEGLQLSLNLEGEIAERLDALYTYMSRRLLEANIKQSEAMLVEVDGLLATLEEAWIGIAPEIARMAAQPAAES.......................... 165
233 1.000e-31gi|192360151|ref|YP_001982181.1| flagellar protein FliS [Cellvibrio japonicus Ueda107]  clstr ali  17  10LKQYRKLGIESEVSNASPHRLIQLLFEGALGRLAAAQGALQRGDLAIKGENLSKAIGIIAGLRSSLDMDGDLSENLDKLYEYMNFRLLEASTQNDGDKIAEVIQLLKTLKSGWDEINPQ...................................... 129
234 1.000e-31gi|261409636|ref|YP_003245877.1| flagellar protein FliS [Paenibacillus sp. Y412MC10]  clstr ali  20  7..QAQYNYLHTKIQTSSPGQLTLMLYTGCIKYLKLAVQSIEIHDMEGKHLNFVKAQNIIDELQSTLNMEYEISKQLYSLYTYINEKLFEANVKLDVKSAEDCIQLLTELRDTWAEALK....................................... 122
235 1.000e-31gi|352085374|ref|ZP_08952994.1| flagellar protein FliS [Rhodanobacter sp. 2APBS1]  clstr ali  21  9......AYQQVRVESADPHGLITLLMDGALERLVKARAHMLRGEVAAKGEAISRCIEIIGGLRGSLDPKADLVGRLDSLYDYMSRRLLQANLRDDASLIDEVSNLLQPIRDSWVQIAPAASQ................................... 130
239 1.000e-31Oral.Meta HOMD ppse_c_8_312 Pseudomonas pseudoalcaligenes KF707 [99469 - 99846] ORF  ali  16  7LKQYQSVNTNAQIMDASPHRLIQMLMEGGLTRLAQARGAIERGQLAQKGELIGKAIAIIGGLRNSLDFEGEIAPNLDALYDYMVSRLVEANLKSDAALVDEVSGLLRNVKTGWDGIAQ....................................... 126
240 1.000e-31JCVI_PEP_1096685282695 /source_dna_id=JCVI_ORF_1096685282694 /offset=0 /translation_table=11 /length=145 /full_length=145  ali  17  7LRQYQNVGVKSSVTEADPHTLVRMLFDGALERLSIARGAMERGDAARKGEAISRAVAIIDTLRVSLDLDAELAANLQALYEYMTSRLVEANRSGRTELLLEVADLIRELREAWVAIPETYRTPAQGGLAPLVQ........................ 141
241 1.000e-31gi|304407686|ref|ZP_07389337.1| flagellar protein FliS [Paenibacillus curdlanolyticus YK9]  clstr ali  18  1MLQAQANYANTQIQTASPGELTLLLYNGCIKFIKKALQSMENQNVHGKHENFIKAQNIIDELQSTLNMEYELSNGLFQLYTYIQEKLSFANVKMDRAAAEECIQLISELRDTWLEALKSLKRG.................................. 123
243 2.000e-31gi|114562355|ref|YP_749868.1| flagellar protein FliS [Shewanella frigidimarina NCIMB 400]  clstr ali  13  5LQSYRKVSLESEIAVASPHRIIQMMFEGALQRIAQAKYAIQQKNPAQKGENIGKAVSIIAGLSGSLNMDADVSANLDSLYEYMLRRLSEANVANDIEMLEEVSALVRTIKEGWDTIPQDMHE................................... 128
244 2.000e-31gi|300854143|ref|YP_003779127.1| flagellar protein FliS [Clostridium ljungdahlii DSM 13528]  clstr ali  22  5..NAYKTYKTNSVNYASKEQLLLMLVDGAVKFSKIGRQAIVDKDIKKAHENIIKAENIFNELIISLDVSGKWGQSLMSLYDFIVRRLIDANMKKDVKVIDEVIPLIEDVRNTWEEAYKISKG................................... 126
245 2.000e-31gi|78356166|ref|YP_387615.1| flagellar protein FliS [Desulfovibrio alaskensis G20]  clstr ali  23  1MQKAAHAYFQTQVSTTSQGQLLLMLYDGAIKFLNQAKDKIAQRDYAAKGILISKALDVINELDGSLNPEQELAENLHKLYFYCSTRLLNANLKMDVTLIDEVIRILSGLRSAYAQIMDTPEAIEAQKQ............................. 130
247 2.000e-31gi|377577499|ref|ZP_09806481.1| flagellar chaperone FliS [Escherichia hermannii NBRC 105704]  clstr ali  16  8.NAYARIGVESAVMSASPHQLIVLLFDGAMSALVRARLFMQQGETVAKGEALSKAINIIDGLKAGLDREGDLATNLSSLYDYMVRRLLQANLRNDSQAIEEVEGLLSNLADAWKQVSPQPAHAQE................................ 134
248 2.000e-31gi|317050913|ref|YP_004112029.1| flagellar protein FliS [Desulfurispirillum indicum S5]  clstr ali  18  6...PYSAYKQNEIQGASQGKLIILMYDGAIRFLKQACVYIEKKDINGAHENIMRAENILAELMNTLNMDGEVADNLLRLYEFMLWHLIQANKDKDQQKVEEVISMLADLRGAWNQIVHGQAGE.................................. 126
250 2.000e-31gi|126665051|ref|ZP_01736034.1| flagellar protein FliS [Marinobacter sp. ELB17]  clstr ali  17  4LKAYQQINTQTSITDADPHRLIQLLYNGALERINMAKARMQAKDFEGKGKLISKAIEIIGGLRSFLDFEGELSARLEGLYDYMERTLFEANAKNDVAKLDEVAKLLHAVKDGWDGIRGEAVATAQA............................... 131
251 2.000e-31gi|395763571|ref|ZP_10444240.1| FliS flagellar protein [Janthinobacterium sp. PAMC 25724]  clstr ali  20  10.QSYAKVGLETGIGAASPHKLIAMLYDGALVAVLSAQMHMKAGNIPEKGKSISRAMQLIDGLRASLDKNGEIAENLDALYEYMGARLLTANLKNDLSILDEVQRLLTELRDTWNAIG........................................ 128
252 2.000e-31gi|385332109|ref|YP_005886060.1| flagellar protein FliS [Marinobacter adhaerens HP15]  clstr ali  15  4LQAYQRVNNQTSTIDADPHRLIQLLYNGAIERINMAKARMQAKDAAGKGQLIGKAIDIIGGLRSFLDFEGELAPRLEALYDYMERTLLQASAKNDVEKLDEVLSLLHSIKEGWDGIREEAVGQQRA............................... 131
254 3.000e-31gi|392963501|ref|ZP_10328927.1| flagellar protein FliS [Pelosinus fermentans DSM 17108]  clstr ali  16  4..NPYDHYKRVQVETASQGRLILMLYAGALKNLRNAQNYIQQKDVSGAHRMLMKTQDIIKELNITLNMNGEISNNLRNLYLYMLQRLVEANVNKDAEKIEEVIELLTTLKEAWDAVILKNKP................................... 124
255 3.000e-31gi|237653552|ref|YP_002889866.1| flagellar protein FliS [Thauera sp. MZ1T]  clstr ali  17  11..AYAKVSVETGVNTADPHKLILMLFDGALLQVRTAGIAIGNQDIPGKGTAISKAIEIINGLKVSLDMNGELAQRLAALYDYMSERLLYANLHNSQPALDEVAGLLATLREAWAEIRSQVQPSAA................................ 136
257 3.000e-31gi|387131272|ref|YP_006294162.1| flagellar biosynthesis protein FliS [Methylophaga sp. JAM7]  clstr ali  16  13MQQYRQNHIHGGVETATPHRLVQMLMEGVLEKLLAAKGFMASGQVAKKGEHISWAISIIDSLRACLNTEGDVAINLGRLYDYMEARLLEANLKNDATMIDEVASLMIEIKSGWDAIPAEFHGEP................................. 138
258 3.000e-31gi|332798841|ref|YP_004460340.1| flagellar protein FliS [Tepidanaerobacter acetatoxydans Re1]  clstr ali  15  4.SNAYEQYRYNSIMSASPERLMIMLFEGAIKFVKLARKNIAEDDIASANYNISRAQDIIAELECSLDMSYDLSENLMEIYGFLYGQLVDANVKKDINTLDIVESMLSELKDTWGEACLKLKKNA................................. 126
259 3.000e-31JCVI_PEP_1096677042133 /source_dna_id=JCVI_ORF_1096677042132 /offset=0 /translation_table=11 /length=142 /full_length=142  ali  19  12.NAYRNVDVSTSVPYADSVQLIQLLFNGLMTALADAEGHFERSDIAGKNAAISRATKIIVGLQGSLDFEKELARNLADLYDYCTRRLLKANLRNDVEGVREVKGLLGEINGAWEILPMLLNDAPVAQAS............................ 141
260 3.000e-31Oral.Meta HOMD ctes_c_1_18427 Comamonas testosteroni KF-1 [5088853 - 5089284] flagellar protein FliS  ali  21  17MSAYRQVGVQSMVDSASPQQLIKMLFDGLLASIHAARGAIERGDISEKVRHIGKAVRILQELLGALDREGELAGNLASLYEYCTTRLTLANARNDASMVDEVAGLVSTVAQGWNEITNAPAPAAA................................ 144
261 4.000e-31gi|254239464|ref|ZP_04932786.1| hypothetical protein PA2G_00077 [Pseudomonas aeruginosa 2192]  clstr ali  16  7MRQYQNVSTQAQAIDASPHRLIQMLMEGGLTRMAQARGALERGEVALKGELIGKAIAIVGGLREGLDFEGELAANLDRLYAYMSMRLTEANLKNDAGKLEEVSELLRNIKSGWDAIAP....................................... 126
262 4.000e-31gi|119477941|ref|ZP_01618041.1| flagellar protein FliS [marine gamma proteobacterium HTCC2143]  clstr ali  17  6LAQYQQVNTHCGVEGASPHRLIQMLMEGVLQRLAEAKGAMQRNVIADKGEAIGKAITILSGLDDSLNKDGEMAANLDDLYGYMQRRLLEANLHNDEGIIDEVVGLMKTIKSGWDTIAPEVA.................................... 128
263 4.000e-31JCVI_PEP_1096671475945 /source_dna_id=JCVI_ORF_1096671475944 /offset=0 /translation_table=11 /length=151 /full_length=151  ali  16  32MKQYQTVNVNAQVSEADPHRLIQMLMEGGLQRIAQAKGAMQHGHVALKGERIGKALGIIGGLREALDQGGELAVNLDRLYAFMQDRLTQANLKNDVSMLDEVADLLREVKAGWDGIRQ....................................... 151
264 4.000e-31gi|163750555|ref|ZP_02157793.1| flagellar protein FliS [Shewanella benthica KT99]  clstr ali  14  5LQSYRKVSLDNEIGVASPHRIIQMMFEGALQRIAQSRYAIENADIANKGVNIGKAIGIISGLNSSLNMEGEMVNNVSDLYDFMLRRLSEANISNDIKALDDVSEILKTIKEGWDAIPAEDH.................................... 127
268 5.000e-31gi|357011482|ref|ZP_09076481.1| flagellar protein FliS [Paenibacillus elgii B69]  clstr ali  20  3.QQAQQLYLRTQVSTAAPGELTLLLYNGCIKFMKQAHEALVTKNYNEKNVNLKKAQDIIDELMITLNMDYEISKNLKMLYVFIKEQLFEANFKLNVECLETSISLVTELRDTWVEALKILKNKATT............................... 127
269 5.000e-31gi|256830154|ref|YP_003158882.1| flagellar protein FliS [Desulfomicrobium baculatum DSM 4028]  clstr ali  23  1MHKAANAYMQTKVTTTTPGHLVVLLYDGAITFLEQSKEEILAKNYAKKGILISQALDIIAELDGSLDKGGEIAQNLHKLYMYCNTRLLQANLKMDTGIVDEVIGILSAFRSAFSEISNNQAYQAPPKAAS........................... 132
270 5.000e-31gi|398988576|ref|ZP_10692431.1| flagellar biosynthetic protein FliS [Pseudomonas sp. GM24]  clstr ali  16  7LRQYQKVGAHAQTSEASPHRLVQMLMEGGLARIAQAKGAIERKDIPSKCTSISKAIGIVSGLREGLDLENDTLADLDGLYIYMMKRLAEANISSDPRILDEVAGLLSTVKEGWDAIAPVPAPQ.................................. 131
271 5.000e-31gi|269103178|ref|ZP_06155875.1| flagellar biosynthesis protein FliS [Photobacterium damselae subsp. damselae CIP 102761]  clstr ali  15  5LQAYKKVSVNAQLASASPHRIIQMLYAGAIERLIQGKAAMEQGNIAMKCERLSKALDIIMSLRDCLSMEGDVANNLDSLYDYMIRQVSTANAENQPEPIDEVITMLREIKSAWDQIPSEYH.................................... 127
272 5.000e-31gi|421077392|ref|ZP_15538363.1| flagellar protein FliS [Pelosinus fermentans JBW45]  clstr ali  18  3.NNPYAQYKRMQVETASQGRLIIMLYDGALKNLRNAQHCITSKDINGAHRMLIKAQDIIKELNFTLNMSGEISNNLRNLYLYMLQRLVEANMAKDNTKIEEVVELLSTLKGAWDAVILKNKS................................... 124
274 6.000e-31gi|257457534|ref|ZP_05622701.1| flagellar protein FliS [Treponema vincentii ATCC 35580]  clstr ali  18  5.SQALTAYKETRVKTASPGSLIIMLYDEGIKNITLALEGMEAENIERIHQYILKAQDIITELMASLNMDGEIAENLLSLYSFFNQQLFQANMQKDPQPLITVRAMMEELREAWHHVVNSTAAAAEIKPVAS.......................... 141
275 6.000e-31gi|407686776|ref|YP_006801949.1| flagellar protein FliS [Alteromonas macleodii str. `Balearic Sea AD45`]  clstr ali  15  7.NAYRKGNLKQDVANADPHKLTLMLLQGALDRIAYAKGAMERKELVVKADYISKASAIIMHLRDTLDLEGEVAENMFALYNYMVERLNDAHFNNNLNMLDEVSSLLTPIRDAWVQIPEDAKQEAYEAQRQNRQA....................... 141
276 6.000e-31gi|119775437|ref|YP_928177.1| flagellar protein FliS [Shewanella amazonensis SB2B]  clstr ali  14  5LQSYRKVSLESEIAVASPHRIIQMMFAGALERLAQSRYAIEQNDLTNKGIFINKAIGIITGLSNSLNMEGEIAQNLGDLYDFMLRKISEANLNNDPQAIDDVMGLLRTLKEGWDAIPADQHN................................... 128
278 6.000e-31gi|421052275|ref|ZP_15515266.1| flagellar protein FliS [Pelosinus fermentans B4]  clstr ali  15  3.NNPYAHYKRMQVETASQGRLIIMLYDGALKNLRNAQHCIQHKDINGAHHMLMKTQDIIRELNITLNMNGEISQNLRNLYLYMLQRLVEANVTKNNGKVKEVIELLSTLKEAWDTIILKNK.................................... 123
279 7.000e-31gi|255523741|ref|ZP_05390707.1| flagellar protein FliS [Clostridium carboxidivorans P7]  clstr ali  20  4.QNAYKTYKTNSINYASREQLLLMLVDGAVKFSKIGRQAIIDKDVKKAHENIVKTQNIFFELMATLDINGDWAKSLMNVYDFIARRLIDANMKKDLAIMDELIPLIENIKDTWEQAYKLSKGG.................................. 127
280 7.000e-31gi|354598046|ref|ZP_09016063.1| flagellar protein FliS [Brenneria sp. EniD312]  clstr ali  15  8.QAYARVGLESGVMSASPHQLIVMLLDGAKSAMVRARILMQQGDIANKGIALSKAIDIINGLKAGLDVEGELAENLSALYDYMAQRLMIANLHNDVKVIEEVEALLENIADAWRQIGPNYQPAQEA............................... 135
282 8.000e-31JCVI_PEP_1096666787793 /source_dna_id=JCVI_ORF_1096666787792 /offset=0 /translation_table=11 /length=138 /full_length=138  ali  22  6....YNRYKENRVMLSSPGEILLALYDGAIKFCRQARIAIEGNDPGTKGQKIGSVMAILTELSATLDFEKELCENLSRLYDYFIDRLQVAGRDMDVEPLDEVTAHLERLRDTWAEAVRIAETEQEEQPVAS-NAG...................... 137
283 9.000e-31gi|269139478|ref|YP_003296179.1| flagellar protein [Edwardsiella tarda EIB202]  clstr ali  13  8.QAYAKVGLESGAMSASPHQLIVMLFDGAHSALVRAALHIDAGQIPLKGQALSKAINIIDGLKAGLDLDGEVAQNLSALYDYMVQRLLQANLHNDADAVRHVTELLDNIADAWRQIGPHSATTQ................................. 133
284 9.000e-31gi|167464308|ref|ZP_02329397.1| flagellar protein FliS [Paenibacillus larvae subsp. larvae BRL-230010]  clstr ali  14  4..SPYQKYQQTKAQTASPAQLLLMLYDGAIRFVKLGIEGIQEHNMEKTNTNLCKAQSILHEMIASLNFNYEISNNLLRIYEYMLHQLIQSNVNKSAKPAEEVLSQLMELKEAWTEAGKQAAG................................... 123
285 9.000e-31gi|170755818|ref|YP_001782340.1| flagellar protein FliS [Clostridium botulinum B1 str. Okra]  clstr ali  19  5..NAYNTYKNNSVNFASKDQLLLMLMDGAVKFSKIGKQSILDKDIVKAHENLVKTQDIFYELMATLDVNGSWGKQLMSIYEFIVRRLGEANIKKDTEIMDEVIPLIEDIRDIWYEAEKLSKQ................................... 126
286 1.000e-30gi|397906572|ref|ZP_10507369.1| Flagellar biosynthesis protein FliS [Caloramator australicus RC3]  clstr ali  20  5..NALNAYQQNSIFTASKEKLLLMLYDGLVKFIKLAIVGIEEKDIKKAHENFIKAQNIILEFMATLNMEGEIAKSLMLLYDYMYRRLVEANTKKDKAIAEEVLGFAEELKETFEEAYRRLKK................................... 126
287 1.000e-30gi|22126350|ref|NP_669773.1| flagellar protein FliS [Yersinia pestis KIM10+]  clstr ali  13  8.QAYAQVGLESGVMSASPHQLIVMLFDGAQSALIRARILMSQGNIPAKGAAISKAIDIINNGLSALDKGGEMAENLSALYDYMSRRLLYANLHNDEQAINEVSALLENIADAWRQIGPNYQP................................... 131
288 1.000e-30gi|94314174|ref|YP_587383.1| flagellar protein potentiates polymerization, flagellar protein FliS [Cupriavidus metallidurans CH34]  clstr ali  18  9.NAYAQVGVETGAMSASPHQLIVMLYDGARAAIARAKFHLAAGDIAAKGNAISKSIDIIDGLRAVLDHNGDVAADLERLYDYMSRQLMLANLRNDEALLDQVDSLLQDLSSAWAQIGNPAANGALAAQPIAANS....................... 144
291 1.000e-30gi|194365668|ref|YP_002028278.1| flagellar protein FliS [Stenotrophomonas maltophilia R551-3]  clstr ali  17  11..QYRQVGVTSAVADADPHKLVAMLLAGALERVRRALASLERGDQAGKGKAIGEVCAIVGHLNGSLDHEGEIAGNLSALYDYVLQRLTEANLHNDRAALDESLQLLGEIDSAWNAIPHEQRRPAAVAP............................. 138
292 1.000e-30gi|302878306|ref|YP_003846870.1| flagellar protein FliS [Gallionella capsiferriformans ES-2]  clstr ali  19  3MTAAISAYNESGVTAADPHKLISMLYQGALLAIANAKNGVLRGDIPAKGKAISHAMLIIDGLNASLNKDGELAHNLSSLYDYMIKRLLAANLNNDMEALDEVAVLLGGLKEAWDSIRQVAIAPPPAPNGQPEQ........................ 142
293 1.000e-30gi|390949189|ref|YP_006412948.1| flagellar biosynthetic protein FliS [Thiocystis violascens DSM 198]  clstr ali  17  8LNQYRQAGHMAEASVANPHRLIQMLFEGALERIAVARGAMEQGNIRVKGEKVSQAIAIIDGLRASLDHGKDLSEKLDALYEYMNRRLLEGNARNDLDALDEVSRLLREIKSGWDAIPEMLRRA.................................. 132
294 1.000e-30gi|407940856|ref|YP_006856497.1| flagellar protein FliS [Acidovorax sp. KKS102]  clstr ali  17  11.SAYRQVGVQSGVDSASPHMLIKMLFDGLIQSLNAARGALQRGDIAEKGRQIGKAVRILEELKGGLNLGGEIARNLAALYDYCVNRLSMANVHNDLALVEEVVSLITPVAQSWNEIGPNGAP................................... 134
295 1.000e-30gi|183220858|ref|YP_001838854.1| flagellar protein FliS [Leptospira biflexa serovar Patoc strain `Patoc 1 (Paris)`]  clstr ali  17  10..SAYNEYKANEISTVSQIKLIVMLFDGAIRFLGVAKDNMTPRKYDVVNANIIKTQDIITELLLSLNMEKEVANNLLSLYIYLKKRLLEANMRKDKAIIEECIKILGELKHSWEDLEKKEPQAPSQSAGS........................... 139
296 1.000e-30gi|386287372|ref|ZP_10064545.1| flagellar protein FliS [gamma proteobacterium BDW918]  clstr ali  15  10.QAYASVGAQSSVAAASPHRLIQLLMDGALDRLAVAKGHMQRKDVQRKIVTIDRIMSIVDGLRMSLDHNTEMSENLENLYDYMNRRLLLANINNDEGALDEVASLLKELKEAWDAIPSEVSG................................... 132
297 1.000e-30gi|78485789|ref|YP_391714.1| flagellar protein FliS [Thiomicrospira crunogena XCL-2]  clstr ali  19  11.QQYANNYVETAVSEATPHKLVEMLYDGLVKHLTLSKVFIEQQKYEQKSEHINKSLAILNSLRDGVDLEGEVAENLFGLYDYCYRTMIEVSAKNDTALIDEVIEHIKTLNDAWKAMPEEIKRSSKDQ.............................. 138
298 1.000e-30gi|374621977|ref|ZP_09694505.1| flagellar protein FliS [Ectothiorhodospira sp. PHS-1]  clstr ali  20  6MHKGINQYQQIGAADADRHRLIEMLMDGGMDRLAQARGAVIRGDRPAKIKFIGKAFDIIGGLRGGLDLEGDIARNLDELYDYMQRRLVSANARDDVTVLDEVSTLLGEIREAWKEIPKEARLNPEAAARS........................... 140
299 1.000e-30gi|401675786|ref|ZP_10807773.1| lagellar protein FliS [Enterobacter sp. SST3]  clstr ali  17  8.QAYQQVGLESAVMNASPHELIVMLFDGALSALVRARLFLESGQIAQKGETLSKAIAIIDGLKAGLNMESELPGNLAALYDYMVRRLLYANLRNDIDAIVEVEGLLNNIADAWKQIGPNASS................................... 131
300 1.000e-30gi|167770227|ref|ZP_02442280.1| hypothetical protein ANACOL_01570 [Anaerotruncus colihominis DSM 17241]  clstr ali  22  4..NPYQQYQRQSVMTMTQGEMLTKLYDEVIKQMSGAKICLTEKDLSGVNNALQKAQRILFYLKSTLDFKYEISGNLDALYDFFIERTVQANLKKDAAMLDEIIPMIEDLRDTFVQADRNARSK.................................. 124
301 1.000e-30gi|392307818|ref|ZP_10270352.1| Flagellin-specific chaperone FliS [Pseudoalteromonas citrea NCIMB 1889]  clstr ali  24  7.KNYQKEALKTRVAGADRYEIIQMLMSGAIEKMVFAKVAIDKKNLEAKAEHISKASAIIEALRGCLDFEGEVTENLYSLYSYMIDRLLDASLKNDSSIVEEVSMLLKEIKSAWDAIPYSIREKTLGDNGSDANAG...................... 142
302 1.000e-30gi|192361805|ref|YP_001982179.1| flagellar protein FliS [Cellvibrio japonicus Ueda107]  clstr ali  14  8.QHYASVKVHSGVDAASPHRLIQMLFEGALERIAQAKGAMQQNQLARKGELLGKAINIVGGLQGSLNEGGDLAANLDSLYDYVIRRLTQANYENNPDYLDECTGLLSEIKAGWDAIGTASTVQATQS.............................. 135
304 2.000e-30gi|317153902|ref|YP_004121950.1| flagellar protein FliS [Desulfovibrio aespoeensis Aspo-2]  clstr ali  21  1MTNPARAYLATQVETTTQGELLIMLYEAAIKFLKRAKVEIDNKDYAKKGIYISKAMAIIHELAESLNKEGDITPRLNQLYMFCTSQLIKANIRLDNKMVDDVIKILDGLRSAYAQIVPGHDGKKTPAQAAT.......................... 133
305 2.000e-30gi|302669855|ref|YP_003829815.1| flagellar protein FliS1 [Butyrivibrio proteoclasticus B316]  clstr ali  20  20.QRAYAQYKNNKVMSASGPELTLMLYDGAIKFLNIADFAIEKNDIYKAHENIVKTEKIIDYLRNTLDMKYAVAQDFENMYSYIARRLVEANIGKDREIIAEVNKHMHAIRDNWIEVMKANH.................................... 139
306 2.000e-30gi|332533162|ref|ZP_08409031.1| flagellar biosynthetic protein FliS [Pseudoalteromonas haloplanktis ANT/505]  clstr ali  22  7.KNYQKEALKTRVAGADRYEIIQMLMAGAIEKMVLAKVAIDKKHLEAKSEHLSKASAILAALRDCLDFEGEVTENLFSLYSYMIERLIDASIHNDVKIVDEVSNLLKEIKSAWDAIPAEVRNQTFAENSAHAS........................ 140
307 2.000e-30gi|253575870|ref|ZP_04853204.1| flagellar protein FliS [Paenibacillus sp. oral taxon 786 str. D14]  clstr ali  20  7..SAYQSYQKNKYETASPHRLILMLYNGAVQYAMRAQRAIQSGDVKETNQYIQKTQAILYELISSLNEKGELARNLKNLYLYIIDRLIQANIKKNPDYIEEIIGHLNELKSAWEQIGKEV..................................... 126
308 2.000e-30gi|224825762|ref|ZP_03698866.1| flagellar protein FliS [Pseudogulbenkiania ferrooxidans 2002]  clstr ali  22  7.RSYHSVNLEAQTATASPVQLVLVLFDGLLEELARARGHLEGQRFEQKGDSITKCINILNGLSSALDFEGEVVTDLARLYDYCAFRLYHASVELDVAALDEVVGLLGTLKGGWMGVRDQHEAA.................................. 130
310 2.000e-30gi|365873562|ref|ZP_09413095.1| flagellar biosynthetic protein FliS [Thermanaerovibrio velox DSM 12556]  clstr ali  21  7.RKAQDMYRANQVQTATREQLLLLTYDIGIRACHGAIEAMGRSDIEGANDNLKRAQAVVRELMVTLNLEGEVARSLMGLYDFFYNRLVEANVKKDPSLVREVLGMLEELRKTWAEAIEKLKSEQSPPAQ............................ 136
312 2.000e-30JCVI_PEP_1096671972595 /source_dna_id=JCVI_ORF_1096671972594 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  16  26LASYGEVSTQAGTAYADSVQLIQMLFDGLLDSLAAAEGQIERNEIQEKCNSLNRATRILVGLQGSLDHEGDIASNLADLYDYCIRRLMKANLKNDVAAIQEVKGLMAEIRDAWSQLPGLLQQQAV................................ 152
314 2.000e-30METAHIT O2 GL0005926 [Complete] locus=scaffold25661_1:1374:1757:-  ali  18  5..........SDVASADPHRLILLLFEGAAAALNHALFCMEEGDIPGKGQSISKAISIIDGLLASLDVKGELAERLYALYEYMVNRLLWANLKNDKTVLQEVQYLLEEIHSAWRAIKPNA..................................... 117
315 2.000e-30gi|82702469|ref|YP_412035.1| flagellar protein FliS [Nitrosospira multiformis ATCC 25196]  clstr ali  20  10.NAYARVGLETGVIAASPHKLVLMLFEGARIALASALTHTRSGQIAARGEAISKAIAIINGLQASLDIKGELAQQLNALYEYMGRRLLQANVHDKPEYIEEVSGLLGELHEAWEAIGSFTQSGGEGEMISSV......................... 143
316 2.000e-30gi|332526958|ref|ZP_08403047.1| flagellar protein FliS [Rubrivivax benzoatilyticus JA2]  clstr ali  18  16.HAYHRVGAETAISTASPHQLVALLYQGFQDAIAQARGAMRAGEIERKNRAIKHALSIVDELRACLDLEGQLAKDLHALYGYIELRLTHANLRNDEAVLDECQRLMQPLQDAWNAIGDKVGGQP................................. 141
318 2.000e-30gi|317492400|ref|ZP_07950829.1| flagellar protein FliS [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  10  8.QAYADVGLESGVMSASPHQLIVMLFDGAHSALIRARLHMQAGQTQLKGQSITKAINIIDGLKAGLNLEGELAENLAALYDYMVKRLLHANLHNDEATLQHVTDLLDNIADAWRQIGPQSQ.................................... 130
319 2.000e-30gi|337744472|ref|YP_004638634.1| flagellar protein FliS [Paenibacillus mucilaginosus KNP414]  clstr ali  18  2LQAQQNKYLSTSVQTASPAHLLMMLYDGAIRFCRAGIEAMKQNRYEEVNRNLVKAQDIVRELMVTLDPKQPISADLTRLYDYFIFRLVEANMKKQSEPAEEVLEYLVSLKETW............................................ 114
320 2.000e-30gi|384083242|ref|ZP_09994417.1| flagellar protein FliS [gamma proteobacterium HIMB30]  clstr ali  17  16LASYGEVEVQSGTAYADSVQLIQMLFDGLIDSLAAAEGQIERNEIQAKGESLSRATRIVLGLQGSLDMEGEIAGNLADLYDYCTRRLMHANLKNDLEAVREVKKLMGEIRDAWAQVPDLIDGQSVANVG............................ 146
321 2.000e-30gi|153954732|ref|YP_001395497.1| hypothetical protein CKL_2114 [Clostridium kluyveri DSM 555]  clstr ali  17  5..NAYNAYKTNSINYASKEQLLLMLVDGAVKFVKIGRQAIVDKNIKEAHENIIKAENIFYELMATLDVSGDWGQSLMSVYDFIVRRLVYANIKKDVKIIDEVIPLIENVKDAWNKAYK....................................... 122
322 2.000e-30gi|91792677|ref|YP_562328.1| flagellar protein FliS [Shewanella denitrificans OS217]  clstr ali  14  5LQSYRKVSLDNEISIASPHRVVQLMFAGGLERLAQSRYAIENKDMANKGIFIGKAIGIINGLNNSLDMNGEIAKNLSDLYDFMLRKITEANINNDVKAIDDVCDILREIKEAWDAIPQDKH.................................... 127
323 2.000e-30gi|373849707|ref|ZP_09592508.1| flagellar protein FliS [Opitutaceae bacterium TAV5]  clstr ali  21  5..NYARIYRQQSVLTASPGQLVVMLYDGALRFMALARESFDVRRIEQIHTSLLRAQAILKELQATLNHEGEIAANLERLYDYYIRRLEEANRRKDEAPVIEVERLVGHLRDGWAEMLRTANPA.................................. 132
325 3.000e-30gi|119898997|ref|YP_934210.1| flagellar protein FliS [Azoarcus sp. BH72]  clstr ali  21  20.........ETSVEAASPHKLILMLYDGALLSLRSASVAMQNKDIPAKGMAISKAIDIINGLKVSLDLNGELAARLDALYEYMGDRLLYANLHNNQPALDEVCTLLASLREAWQAIADQVTPA.................................. 136
326 3.000e-30gi|229827767|ref|ZP_04453836.1| hypothetical protein GCWU000182_03159 [Abiotrophia defectiva ATCC 49176]  clstr ali  17  3MTNAASLYQGAAINTASPAELTLMLYNGAIKFCNLALIGMEEEDIMKAHNNLMKAQRIIRELQATLNFKYEVSKDFDLIYTRILNSLLAANIKKDTDKLNEALEDIRGIRDVWTQVMKVAK.................................... 123
327 3.000e-30gi|334129537|ref|ZP_08503341.1| Flagellar protein [Methyloversatilis universalis FAM5]  clstr ali  17  11..AYSQAGVEARVASADPHQLILMLYDGALMAIATASHQMDIGDVAGKGQSISRAIDIINGLKVSLDMEGELSQRMYSLYEYMCMRLLHANSQNDRSALTEVSALLGELRSAWEEIRQKLAQGAP................................ 136
330 3.000e-30gi|288554131|ref|YP_003426066.1| flagellar protein FliS [Bacillus pseudofirmus OF4]  clstr ali  16  3.TAMQSAYKQNAMKTASPGELTLMLYNGCLKFIKQTRLAMEENDLEKRNLNSTKAQNIIRELMVTLKTDNEVGQNMMRMYDFILSRLIEANVKNDANALTEAEGLVVEFRDTWKEVIQLDRKQ.................................. 124
331 3.000e-30gi|375310922|ref|ZP_09776186.1| flagellar protein fliS [Paenibacillus sp. Aloe-11]  clstr ali  25  16..............TASKPKLLIMLYDGAIRFTRAGIDGILDEDYGKANYNLCKSQAIIHELISALNFDYPIAQDLLRIYEYMLHCLIEANVHKDVSKAREVEGHLTDLREAWVEVSKLPSS................................... 123
332 4.000e-30gi|300722635|ref|YP_003711925.1| flagellar repressor [Xenorhabdus nematophila ATCC 19061]  clstr ali  14  10...YAQVDLESEIMNASPYQLIQILFNGALSALRRAIILMQQGNIPEKGLAISKAINIIDGLKEGLDFEGEIAQNLSDLYEYMNRRLFHANLRNDEKAITEVINLLTEISDSWRQIGPHYNASQ................................. 133
333 4.000e-30gi|160902932|ref|YP_001568513.1| flagellar protein FliS [Petrotoga mobilis SJ95]  clstr ali  16  12........FENSIKTASPAKLVELLYQNSIERINKAIKAIENKNFSEANKQIIRVEDIVTELNVSLNLEGEIAKNLRALYNYMYQRLLESNTKKDTEILKEVRSFLQELLDTWKEILKKEVKTSRELNAKSV......................... 137
334 4.000e-30gi|296101719|ref|YP_003611865.1| lagellar protein FliS [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  16  8.RAYQQVGLESAVLSASPHQLVVMLFDGALSALVRARLFLDEGKITEKGEALSKAINIIDGLKAGLNMESELPGNLAALYEYMVRRLLHSNLRNDVEAIVEVEALLNNIADAWKQIGPNGPSSQ................................. 133
335 4.000e-30gi|88704294|ref|ZP_01102008.1| Flagellar protein FliS [Congregibacter litoralis KT71]  clstr ali  16  7LNAYKNVGVQSAVDDASPHHLIAMLMDGALDRIASAKGAMERGDTAVQGALLGKAITIIDNMRASLDHEGELAGKLADLYDYMERRLLEAGTTGDPAMLDEVSSLLRDIKSGWDQIPEALR.................................... 129
336 5.000e-30gi|317130290|ref|YP_004096572.1| flagellar protein FliS [Bacillus cellulosilyticus DSM 2522]  clstr ali  17  5.NNPYANYKQKAAETKTPGELTLMLYEGCLKFIKQAGKAMDEENYQDKNTNLIKAQNIVKELMVTLKTDTEVAIGMLQMYDFILSRLTDANINNDVDALKEAEEFVVEFRDTWKQVIQIDRKQ.................................. 126
337 5.000e-30gi|146282229|ref|YP_001172382.1| flagellar protein FliS [Pseudomonas stutzeri A1501]  clstr ali  15  7MKQYQQVGVQAQVNDADPHRLIQMLMQGGLDRIAQAKGAMEREAFAEKGVLIGKALGIVGGLRDALDKGGELAENLDRLYEYMTMRLFEANKENDIGKLNEVGRLLGEIKLAWDQIAPK...................................... 127
339 5.000e-30gi|288870653|ref|ZP_06114857.2| flagellar protein FliS [Clostridium hathewayi DSM 13479]  clstr ali  18  1MQNPYARYKEQSVMTMTQGDMINLLFDEVINRLNKGLVSLEQNDYEGSNAHFKKAQAIVAHLSSTLDHQYEVAGGLASLYEYFNYQILQANIKKSPEPVEEVLPMIAELKEAFSQADKQVRMGHTG............................... 126
340 5.000e-30gi|406940601|gb|EKD73316.1| hypothetical protein ACD_45C00364G0003 [uncultured bacterium]  clstr ali  14  5MNRAASAYVESAVISADPHRLILMLFDGAKSAISTARLQMENNEIAEKGRNISKAIDIINGLKASLNVEGDLAQNLLALYDYMCNRLLWANQKNDLAALDEVTMLLNEIREAWAEISPNKLAAQSSEAAA........................... 141
341 5.000e-30gi|406838084|ref|ZP_11097678.1| flagellin-specific chaperone [Lactobacillus vini DSM 20605]  clstr ali  16  8.....NDYLRTQVMSASPVKIIVMLYEGAIKNMKIAKLAIEEKDIVRAHQNLRRAQDIIKELKSSLNVEGDVPEHLVRLYEYSNNQLVTANLTKSTEPIDNVIHILSELLDSWKKLAENN..................................... 124
343 6.000e-30JCVI_PEP_1096685901743 /source_dna_id=JCVI_ORF_1096685901742 /offset=0 /translation_table=11 /length=134 /full_length=134  ali  14  5MKQYARIGTQASIQDASPHRLIQMLFRGALDRMASARGAMENGDVARKGELIGKAISIVGGLRDAIEDGGALAQNLDALYEYISNRLVVANLQNDLDVLQECMDLLTPIATAWDEIAPERVSDAPARA............................. 133
345 6.000e-30gi|383317297|ref|YP_005378139.1| flagellar biosynthetic protein FliS [Frateuria aurantia DSM 6220]  clstr ali  17  20...........SIEDADPHRLTGLLFDGFVDCINRARGHMGRGEIPEKGRQITRAIAMAEELQRALDPSSPLPERLGALYTYIQRRLLEANLHNDPAALDECLRLIQPIREAWATIRPQYLAERQQSTEQGA......................... 143
347 6.000e-30gi|109899387|ref|YP_662642.1| flagellar protein FliS [Pseudoalteromonas atlantica T6c]  clstr ali  17  7.NAYKKGNLKQEIAQADPHKLTLMLMQGALDRMAYAKGCMERKEYAEKAQHIGRCTAILINLRDTLDLNAEVAENLFSLYDYMVQRLTDATVQNNLQIMDEVIGLMLPIKTAWSQIPDDAKQDAYEAQRQKRQA....................... 141
351 7.000e-30gi|359414450|ref|ZP_09206915.1| flagellar protein FliS [Clostridium sp. DL-VIII]  clstr ali  18  3.SNGYNVYKNNSVNYASREQLLLMLVEGAVKFCKIARQAIIDKDIKKAHDSLIRTQDIFSELMVSLDTTGDWAVQLFNVYAFIKKGLVEANISKNIEIVDEILPLVEDINETWKEAYKIAKK................................... 124
352 7.000e-30gi|407801412|ref|ZP_11148256.1| flagellar protein FliS [Alcanivorax sp. W11-5]  clstr ali  14  16..AYARVGVESGVMSASPHQLITMLFDGVAAALGTARLHMRQGNASGKGESISKALDIINGLLAALDREGELSERLGWLYQYISRQLLVANLHNDEARLDEAARLLDDIGSAWRQIDPRSQGA.................................. 139
353 7.000e-30gi|399520608|ref|ZP_10761380.1| Flagellar protein fliS [Pseudomonas pseudoalcaligenes CECT 5344]  clstr ali  15  7LRQYQQVSTQSQLAEASPHRLIQMLFEGALDRLAQAQGALARGQVAEKGLLIGKVIGIVGGLREGLDKGGELAQHLDGLYEYMIRQLAQANLKNDEAILRQVAQLLRELKEGWDGIA........................................ 125
354 7.000e-30gi|419953737|ref|ZP_14469880.1| flagellar protein FliS [Pseudomonas stutzeri TS44]  clstr ali  17  7MRQYQQVGVKAQVTEADPHRLIQMLMQGGLDRIAQARGAMEREAYAEKGVLIGKAINIIGGLRDVLDKEGELATNLERLYEYMTMRLLEASRHNDVSKLDEVAKLLGEVKSGWDGIA........................................ 125
355 7.000e-30gi|325289241|ref|YP_004265422.1| flagellar protein FliS [Syntrophobotulus glycolicus DSM 8271]  clstr ali  17  6.KQYRQNYLQAAVFTASPEKLTLLLYTHLVQALRQAGQAMEKKDPEKTHHWILKAKKILLYLENTLDQKYEISASLSQLYTCMYRLLTGANVKKDREALEQVLHLAGELRDTWAQASELAGGGRPAN.............................. 131
356 7.000e-30gi|121997305|ref|YP_001002092.1| flagellar protein FliS [Halorhodospira halophila SL1]  clstr ali  18  6.NQYQQVGTYSSAAYADPYRLVQLLMDGFLDRVAQARGAMERQEIAVKGELISKAISILDGLRSGLDHEAEIAGNLEELYTYMQRRLVEANAQNEVQYLDEVASLMREIKSAWDAIPPEVR.................................... 127
357 7.000e-30gi|88813196|ref|ZP_01128436.1| flagellar protein FliS [Nitrococcus mobilis Nb-231]  clstr ali  15  11....YQQVGNQSVTYADPWQLIGMLFDGALDRVAQARHAMQIGQIAVKGERIGKAISILEGLRGSLNHELDFAGNLDALYEYMQRRLLEASLHNAEQALDEVARLLRELKSGWDAIPQEARDVGRHQAEQ........................... 138
358 7.000e-30gi|257092971|ref|YP_003166612.1| flagellar protein FliS [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]  clstr ali  14  10.SAYQKVGVDAAVEVADPHRLILLLFAGAQAAIGKARAAMQQRQIAVKGEAISKAIDIINGLKVSLDLEGEIAERLDALYDYLVLRLLRANVDNDPGALEEVAGLLEEIHSAWRQIPHDALPQPGA............................... 137
360 8.000e-30gi|372273170|ref|ZP_09509218.1| flagellar protein FliS [Marinobacterium stanieri S30]  clstr ali  13  6LNQYKSVDLNTAVEAASPHQLISMLFRGALEALAKAAGAIERKDIQLRTQQINKASEIIVTLKGSLNLEGEVAENLDGLYDYMLRTLMQANRENDAAKAKEVSELIVTISDGWSQIPAEEHQ................................... 129
361 8.000e-30gi|300114788|ref|YP_003761363.1| flagellar protein FliS [Nitrosococcus watsonii C-113]  clstr ali  12  7LQQYRQIGAQSAVIAADPHRLIQMLLEGALEKITVARGAIARHDITQKGVNIGGAIDIVSGLQVSLNREAEIADDLDRLYDYIVGRLLEANLRNDAAILEEVAYLLGEIKQGWEAISPVNSPMPA................................ 133
362 1.000e-29gi|157961184|ref|YP_001501218.1| flagellar protein FliS [Shewanella pealeana ATCC 700345]  clstr ali  11  5LQSYRKVSLDSSIAVASPHKVIQMMFAGALERLAQGRYAIEQNNLELKGVSLGKAVSIVAGLNSSLNMEGDVAGNLSALYDFMLQRITDANINNDTKAIDDATDILRVIKEAWDAIPSELHELSSQN.............................. 133
363 1.000e-29gi|331269285|ref|YP_004395777.1| flagellar protein FliS [Clostridium botulinum BKT015925]  clstr ali  16  9.NNAYKAYKNNSVNYASKEQLLLMLLDGAVKFAKMGRQAIIDKKIQKAHESLTRTQDIFYELMASLDIGAEWAKNLMGIYEFITKRLADANMKKDIEVMNEVVPLIEDVRDTWYEAEKLSRGQ.................................. 132
364 1.000e-29gi|167628873|ref|YP_001679372.1| flagellar protein flis [Heliobacterium modesticaldum Ice1]  clstr ali  13  9....ADAYMTQKIMTSPPEELTTLLYDGALRFIKKGIVAIDEKNMLEAHQRIIRAQDIVIELMETLNMSQEISSQLMALYDFVLYCLVEGNVKKDKTHLNHAQELLQDMRDTWVEAIKQSRIQKTSPAPVNA......................... 136
365 1.000e-29gi|358636451|dbj|BAL23748.1| flagellar protein [Azoarcus sp. KH32C]  clstr ali  17  11..AYAKVGIETSVMTADPHQLILMLFDGALMSIATAGASMELKDIPAKGEAISKAIEIINGLRASLDQEGELAARLAALYEYMGERLLYANLYNSRPALDEVSNLLHTLREAWAGIAPNA..................................... 131
366 1.000e-29gi|74317611|ref|YP_315351.1| flagellar protein FliS [Thiobacillus denitrificans ATCC 25259]  clstr ali  18  10.RAYVNVGLETGVSVASPHQLIVMLYEGAELSIRMAIKHLNEGDIAKKCAALSKASHILDGLRASLDLKGEIAQQLDSLYEYMNQRLMLANINNQTAPLEEVLGLLRELHEAWRQI......................................... 127
367 1.000e-29gi|271500089|ref|YP_003333114.1| flagellar protein FliS [Dickeya dadantii Ech586]  clstr ali  15  10.QAYAQVSVESAVMSANPHQLIVMLFDGTKSALVRARILLEQNDVVGKGNALSKAIDIINGLKLGLDMEGELAENLADLYDYMVRRLLHANINNDLQAIMEVEALLDNIADAWKQIGP....................................... 129
368 1.000e-29JCVI_PEP_1096683815699 /source_dna_id=JCVI_ORF_1096683815698 /offset=0 /translation_table=11 /length=140 /full_length=140  ali  13  7LQSYRKVSLESEITVASPHRIIQLMFAGALQRLAQSRYAIEQNDLVNKGIYINKAVGIIIGLSNSLNMDGQIAKNLSDLYDFMLRKISEANLNNDVKAIDDVCDILRTIKEGWDAIPVDKHN................................... 130
369 1.000e-29gi|347734071|ref|ZP_08867123.1| flagellar protein FliS [Desulfovibrio sp. A2]  clstr ali  23  1MQKAAQAYLQTQVTTTTQGELLLLLYDGAIKFLTQAKDKIAERDYAGKGILISKALDIVNELDASLNMEGELAQNLHKLYFYCSTRLLNANLKMDVSFIDEVIKILSGLRGAYGQIVNTPEAMAIG............................... 128
371 1.000e-29gi|374336608|ref|YP_005093295.1| protein LafC [Oceanimonas sp. GK1]  clstr ali  16  11...YQHTHTDARAAQASPRELVLMLMDGLMDEIARAEGHILAGRIEQKGKSIAKAIDIIGGLDSSLDMNGELALNLHALYDFCGRQLFSASVNNDAALLAPVNKVLADLRDGWQGLGSEVPA................................... 131
372 1.000e-29METAHIT V1 GL0008968 [Complete] locus=scaffold60350_3:3608:3985:+  ali  17  14...........KVLTASPAELTLLLYEGAIKFCNIAMMGIEEKNIQKTHDNIKKAQAIIEELQATLNHSYKVAEDFDNVYRYIYSLLTDANIHKDKETLEKALNEIRGMRDTWKQVMKSAKS................................... 124
373 1.000e-29gi|354558062|ref|ZP_08977319.1| flagellar protein FliS [Desulfitobacterium metallireducens DSM 15288]  clstr ali  17  4.SQIANAYKNQQVMTASPEQLTLLLYNGALRFLNESILAMEQGDFQKSHNANMRAQAIVREFMHTLDMKFEISKDLARLYEYTEYCLIQGNIKKDVEQLKHAKDVLEDLREGWTGAMQQTH.................................... 123
375 1.000e-29gi|374701804|ref|ZP_09708674.1| flagellar protein FliS [Pseudomonas sp. S9]  clstr ali  12  7MKQYQAVNTQVQAVDASPHRLIQMLMEGGLTRIAQARGAMERGQLALKGELIGKAIGIVGGLRDGLDLQGELAANLDSLYEYMSARLFEANVKNQAEPLEEVASLLRNIKSGWDAIG........................................ 125
376 2.000e-29gi|358066056|ref|ZP_09152590.1| flagellar protein FliS [Clostridium hathewayi WAL-18680]  clstr ali  16  1MQNPYEKYKEQSVMTMTQGDMLNLLFDEVINRLNKGLACLAVKDYEGCNTYFQKSQIIVRHLSDTLDHQYDVAEGLDSLYEYFFHQILQANIKKTPEPVEEILPMIAELKEAFAQADRQVRVEHTG............................... 126
377 2.000e-29gi|300870582|ref|YP_003785453.1| putative flagellar protein FliS [Brachyspira pilosicoli 95/1000]  clstr ali  19  4.NNGYQKYKKIDVSTASQNRLVIMLYDGAIKFLENACNAIDKKHTEEAHNNIMKAQEIIYELLSSLNYDKEIAERLASIYTYMNQRLTEANISKTKPPILEVIKYLKELKGAWEGVEQKLSSNNADNN............................. 132
379 2.000e-29gi|374601556|ref|ZP_09674556.1| Hpt protein [Paenibacillus dendritiformis C454]  clstr ali  15  5MTAGYQAYQKNKYETASPHKLILMLYYGALKYMNQAETALAEGNPLLAHQHILKVQDIIYELIACLNEGGEVAQNLKNLYLYVIDQLVQSNIQKSAQPLAEAKIVIQSIKDAWETIGKDVTAGQ................................. 130
380 2.000e-29JCVI_PEP_1096698119303 /source_dna_id=JCVI_ORF_1096698119302 /offset=0 /translation_table=11 /length=154 /full_length=154  ali  20  17MKAYGKVEVQSKVNSANNVQLIQMLLDGFIETINKAEVQIQKNDIEGKAKSLIKASNIIMGLQTSLDIEGEIAKNLNELYTYISRRVFEIDLQNDVKIISEVRDLINSIRDAWKQVPDLLPAK.................................. 141
381 2.000e-29gi|148266103|ref|YP_001232809.1| flagellar protein FliS [Geobacter uraniireducens Rf4]  clstr ali  16  1MANPYTQYQTMQVGSASPEKILIMLYEGAINFTRIAADRMRNNDIAGKGKYIGKALAIVTELMNTLNHDGEIAINLERLYMYLISEFTEANLNNSAASLENAINVLTILKDGWNDAILQARKERAAGQA............................ 131
382 2.000e-29gi|71906420|ref|YP_284007.1| flagellar protein FliS [Dechloromonas aromatica RCB]  clstr ali  20  11..AYAQVSLESAVRSADPHRLVLLLFEGAATAMSMAKLHMQSNQIAERGANISKAIDIINGLRASLNIEGELAERLAALYDYIVQRLLWANMKVDVAALDECMGLLGEIHSAWAEIAPGKESAA................................. 135
383 2.000e-29gi|358448795|ref|ZP_09159290.1| flagellar protein FliS [Marinobacter manganoxydans MnI7-9]  clstr ali  14  4LQAYQRVNTQTSITDADPHRLIQLLYNGAIERINMAKSRIQAKDYGGKAQLINKAIEIIGGLRSFLDFGGDLAARLEALYDYMERSLLEASAKNDLAKLDEVLTLLRSVKEGWDGIREEAIGQQAA............................... 131
384 2.000e-29gi|429215682|ref|ZP_19206841.1| flagellar protein FliS [Pseudomonas sp. M1]  clstr ali  23  5MNEGYDSYREARAAAASPYELVLVLFDGLLDELARARGHIEAKRFQHKGRSLDKCMNILNGLSSALDYEGQVVQDLARLYDYCIYRLSDVSVNLSLEGLDEVAGLLGTLREGWAGV......................................... 126
385 2.000e-29gi|399888798|ref|ZP_10774675.1| flagellar protein FliS [Clostridium arbusti SL206]  clstr ali  21  5..NAYNTYKNNSVNFASKEQLLLMLLDGSVKFAKKAREALLDKDVKESHKYLVKTQDIFYELMTSLDIKGNWGQSLMALYNFIVKRLSDANIKKDVEILDEVIPFIEQVRDMWGEAYKVSKGKA................................. 128
386 2.000e-29gi|261340324|ref|ZP_05968182.1| flagellar protein FliS [Enterobacter cancerogenus ATCC 35316]  clstr ali  14  8.QSYQNIGVESAVMNASPHQLIVMLFDGAHSALVRARLFLDAGQLAEKGLALSKAINIIDGLKAALNMEGELSDNLASLYEYMVRRLLIANLHNDVEAIVEVENLLNNIADAWKQIGPNASS................................... 131
387 2.000e-29gi|313143123|ref|ZP_07805316.1| flagellin FlaA and FlaB chaperone protein FliS [Helicobacter cinaedi CCUG 18818]  clstr ali  17  4.NNAYNLYQQNSVSVESPVKLIEMLYEGILRFCAQAKRHMEAEDIEKKIYYINRTTDIFTELLNTLDYEGEVASYLTGLYTHQIKLLTQANVANDTAKIDIVINVAKGLLEAWREINQDE..................................... 124
388 2.000e-29gi|410457077|ref|ZP_11310918.1| flagellar protein FliS [Bacillus bataviensis LMG 21833]  clstr ali  17  3LNNPYQAYENNQVLFAKGEELTLLLYKGAIKFIEQAKLAMAKDDWTRTNNRIIRAQNIISELMVTLNMDFEISQSLVLLYDYMKQRLIEANIKKEAELLTEVQGMLAELLGTWTEAMNAARP................................... 124
389 3.000e-29gi|407716660|ref|YP_006837940.1| fliS protein [Cycloclasticus sp. P1]  clstr ali  14  7LKQYQQTSVHGGVMDASPHKLIQMLLDGALSRILSAKSALKQQNVAKKGEQIGSAISIIEGLRASLDFKGEISKNLDALYEYINHVLLQANIKNDAALLDEAGKLLSQIKMGWDAISPDAAQ................................... 130
391 3.000e-29gi|288574781|ref|ZP_06393138.1| flagellar protein FliS [Dethiosulfovibrio peptidovorans DSM 11002]  clstr ali  20  6.QNAQLAYQVTRIRTASREQLLLITYDIAIRFCLSAESAIAKGDTEESHENLLRAQNAIRELMVSLNVQGSVAENLMGLYDFMHRSLVEANVEKSEEKVAMVRSMLEELRDTWQEALEKIKKEAISNNQEE.......................... 137
392 3.000e-29gi|239628953|ref|ZP_04671984.1| flagellar protein FliS [Clostridiales bacterium 1_7_47_FAA]  clstr ali  19  1MQNPYAKYKQQSVMTMTQGDMINLLYDEIINRLNKGLLGLEVRDFEASNTHFKKAQAIISHLESTLDGQYPVSQNLSSLYEYFNYQIIQANIKKNPDPVREVLPMIMELKEAFAQADKQVR.................................... 121
394 3.000e-29gi|376298239|ref|YP_005169469.1| flagellar protein FliS [Desulfovibrio desulfuricans ND132]  clstr ali  21  1MANPAKAYLATQIETTTQGELLLMLYEAAIKFLKQAKREIDNRDYAKKGIYISKAMAIIHELSESLNKEGEITPKLGQLYMFCTTQLVKANIRLDNRMIDDVIKILDGLRSAYAQIVPIHDGKAA................................ 127
395 3.000e-29gi|398865362|ref|ZP_10620882.1| flagellar biosynthetic protein FliS [Pseudomonas sp. GM78]  clstr ali  16  7LRQYQKVNSHAQISEASPHRLVQMLMEGGLDRMAQAKGALERGDIAHKGLMIGKAVDIIGGLREGIDKEDESLQQLDSLYGYMIQRLTNANLKNDPQIIDEVMGLLVTVKSGWDAIADQQA.................................... 131
396 3.000e-29gi|187934296|ref|YP_001885015.1| flagellar protein FliS [Clostridium botulinum B str. Eklund 17B]  clstr ali  14  3.SNGYTTYKTNSVNYASKDQLLLMLIDGAVKFAKIARQAITDKNIKKAHENIIKTEDIFTELRASIDTSGEWAQNMFNVYGFINEKLFEANIKKSVEVMNEVIPLIEEVRDIWHEAEKRAKRA.................................. 125
398 3.000e-29gi|160939633|ref|ZP_02086981.1| hypothetical protein CLOBOL_04525 [Clostridium bolteae ATCC BAA-613]  clstr ali  19  1MQNPYAKYKQQSIMTMTQGDMINLLFDETINRLNKGLAGLEAGDCEATNTHFKKAQAIISHLASTLDPQYPVSKGLSSLYEYFNYQIIQANVRKNPETVNEILPMIEELKEAFAQADKQVR.................................... 121
399 3.000e-29gi|148270696|ref|YP_001245156.1| flagellar protein FliS [Thermotoga petrophila RKU-1]  clstr ali  18  4.....NTYLEKMVMTASPAKLVQMLYEKAIEVLKEAENLLADKKFVEFNEKVTRAQDIITELNLSLDMEGTIAQNLRALYNYMFQRLVEGNVKKDVEKIKEVRGMLEELLEVWKEAMKKAGNVTPPEKKQ........................... 130
400 3.000e-29gi|218887995|ref|YP_002437316.1| flagellar protein FliS [Desulfovibrio vulgaris str. `Miyazaki F`]  clstr ali  22  1MQKAAHAYLQTQVTTTTQGELLLLLYDGAIKFLNQAKEKIAERDYAGKGILISKALDIVNELDASLNLEGELAENLHKLYFYCSTRLLNANLKMDVTFIDEVIKILSGLRGAYGQIVNTPEAMAVG............................... 128
401 4.000e-29METAHIT V1 GL0071771 [Complete] locus=scaffold34227_6:482:811:+  ali  21  1.............MTASPAQLTLMLYDGAIKFTNIAIEAIENKNYEKANTYIQKTHRIIDEFRSTLNFKYPVAQEFENVYVMISEKLVYANMKKDVEVLQDVLKHLRSMRETWEEVMRLAKR................................... 109
402 4.000e-29gi|339499089|ref|YP_004697124.1| flagellar protein FliS [Spirochaeta caldaria DSM 7334]  clstr ali  22  5..NALSAYRETRVRTASQGQLIIMLYDEAIKQLDQGIELLDPSRIEPIHKALVKAQDIITELMVSLDFDGDIAKNLFSLYTWFNRELLEANLAKDVERIKAVRTMMHELRVAWQEVVTKTATEHKGNPSAGIN........................ 145
403 4.000e-29gi|325288771|ref|YP_004264952.1| flagellar protein FliS [Syntrophobotulus glycolicus DSM 8271]  clstr ali  15  12..NPQQAYRQTAVGTASPEKLLIMLYSGAVKYLHLGKKAIEEKKYETANEILVRVQDMIIELNTTLNMEGEIAKNLRLLYDFYEDEVMKANLKKDAELLVPVIHFFESFRDVWIEAAKRARSEA................................. 135
404 4.000e-29gi|399020815|ref|ZP_10722939.1| flagellar biosynthetic protein FliS [Herbaspirillum sp. CF444]  clstr ali  13  5MQRGANAYANIGVETASPHKLITMLFDGALVAIAMGQKYMSAGDIKKKGESITQAILIIEGLRASLNKNGEIALNLDALYEYMGRRLFAANVENSQDILEEVHGLLDGLRDAWEAIGPNGTNQA................................. 135
405 4.000e-29gi|357404117|ref|YP_004916041.1| B-type flagellar protein fliS [Methylomicrobium alcaliphilum 20Z]  clstr ali  18  19.NKYAAVQNEAALEDASPHKLIQMLMSGFLMRVNAAKGAIDRGDFEGKSEQISKAIAIVGGLTDGLNAEGEIAENLSNLYSYINNRLFQASSENDIAILDEVAGLMRELKEAWDAIPE....................................... 137
407 4.000e-29gi|157364845|ref|YP_001471612.1| flagellar protein FliS [Thermotoga lettingae TMO]  clstr ali  19  2....KDSYIENSVKTASPAKLVEMLYEKGIEVLKDAKGFFKENNFIAANEKIKRAQDIITELNISLDMEGEIAKSLRSLYNYMYRTLIESNLKKDIQKLDEVIYYFEQLLDVWKTAMKSTTVKP................................. 123
408 4.000e-29gi|15895474|ref|NP_348823.1| flagellar protein FliS [Clostridium acetobutylicum ATCC 824]  clstr ali  19  4.SNAYKTYKNNSVTYASKEQLLLMLVDGAVKFAKIARNSMEAKDIKKTHEYLIRVEDIFTELMACLDLSGDWGEDLFKLYSFISSQLVKANLKKDINILDETMPLIIEVRDMWYEAYKLSKR................................... 126
410 4.000e-29gi|387128217|ref|YP_006296822.1| flagellar biosynthesis protein FliS [Methylophaga sp. JAM1]  clstr ali  15  16.........ESEVNFASPYRIIQMLMEGALSKIATAKGCIARNDIAEKSRQITWGMNIIQGLRTSLDKGGEVAANLDALYEYMGRRLLEANVSNDVAILDEVSSLLMEVKAGWDNIPADYH.................................... 129
411 4.000e-29gi|392540591|ref|ZP_10287728.1| Flagellin-specific chaperone FliS [Pseudoalteromonas piscicida JCM 20779]  clstr ali  21  7.KNYQREALKTRVAGADRYEIIQMLMAGAVEKMVLAKVSIEKRHLEAKAEHISKASAIIEALRGSLDFEGEVTENLYALYSYMLDRLLDASMQNDPAIVDEVSNLLKEIKSAWDAIPIDVRKQTLDANGADANVG...................... 142
412 4.000e-29JCVI_PEP_1096694283831 /source_dna_id=JCVI_ORF_1096694283830 /offset=0 /translation_table=11 /length=147 /full_length=147  ali  21  15.QSYGDVKVSSGVASANNVQLIQMLFDGLLESLSTARGHIQHKNITEKSKAIARATRIVIGLQGALDFEGDLANNLNELYSYVTRRLFHANAHNDLAVLDEIHGLMREIRDAWEGMPSLVPASN................................. 139
413 5.000e-29gi|226944515|ref|YP_002799588.1| flagellar protein FliS [Azotobacter vinelandii DJ]  clstr ali  17  5.SAYARVGVESGVMSASPHQLIVMLFDGVQAAIRTARLHMQAGNVAEKGKAISKALDIVNGLSAALDHEGELAGRLEQLYAYVSRLLLRANLHDDERSLDEAAALLEEIGSAWREIGPQAGGG.................................. 129
414 5.000e-29gi|238796923|ref|ZP_04640427.1| hypothetical protein ymoll0001_33330 [Yersinia mollaretii ATCC 43969]  clstr ali  17  8.KAYARIDLESQLAGASPHQLISMLFDSALNAVLRAKIYFENGNIPKRGEMISKAINIIDGLRTSLDHDKDIAQDLESLYDYMSRTLLQANLRNSPSDLASVCEILTNLATTWKEIEPKEKQAN................................. 133
415 5.000e-29gi|262273516|ref|ZP_06051330.1| flagellar biosynthesis protein FliS [Grimontia hollisae CIP 101886]  clstr ali  13  9..AYQHSKNHAQAASASPHRLIQMLLEGLLENLSRARGYMERGQVSDKGMTISKCLDILNGLSVVLDAEGEVTQELYRLYDYCGRRLFEANLKNDLAGIDEVVNLITQILEGWVVLKPE...................................... 127
416 5.000e-29gi|384107713|ref|ZP_10008611.1| flagellar biosynthetic protein FliS [Treponema sp. JC4]  clstr ali  21  4.QNAYSAYQKNNVTTASQGRLVVLLYEGAVKNLSGAIKLFEAQNIEQFGKFIQKAQAIITELQVSLDMDGDIAKNLMALYIYFNQQLLDGSIKKDKAKLEEVHKMLNDLLESWRTVANSTANAPAAQVR............................ 139
417 5.000e-29gi|89899444|ref|YP_521915.1| flagellar protein FliS [Rhodoferax ferrireducens T118]  clstr ali  18  24.SAYQRVSVETAVSQASPHQLVAMLLDGLLKNVGAARAALKRGDIAAKGEKINKAVRIIDELKPALNLGGDIAANLNGLYGYCAIRLTEANLRNDDAALADVLRVIEPLADGWKQIGGQASSA.................................. 148
421 6.000e-29gi|285018199|ref|YP_003375910.1| flagellin-specific chaperone flis protein [Xanthomonas albilineans GPE PC73]  clstr ali  17  11..QYRKMSISTSITDANPHKLVAMLFDGVCQRIRQAQASMAQGDQARKGKAIGQACAIVSHLNGSLDHQGEIANNLSALYDYVMRRLTEANLHNDESALIESLELLSEISGAWNAIPVQQRELTEAAVA............................ 139
422 7.000e-29gi|307717954|ref|YP_003873486.1| flagellar protein FliS [Spirochaeta thermophila DSM 6192]  clstr ali  18  4.QNAINAYKQTSIKTASQGKLIVMLYDGAIRNIDTAIELLEQGQLDRVHNAVIKAQDIVAELASSLDLDGDLAKNLLSLYLFFDEQLMEANIRKDPELLRKVRDMLASLREAWAQIAHMAPEAQV................................ 131
423 7.000e-29gi|150020455|ref|YP_001305809.1| flagellar protein FliS [Thermosipho melanesiensis BI429]  clstr ali  15  3.......YTEQMVKTASPAKLIEMLYQRAIELLDMSVESINKKDFINANEYIKKCQDIITELNLSLDMEGDIAKNLRSLYNYMFKVLVDANIKKDTSKIKEVREYLSELLETWREAMKNVGNTANQ............................... 123
424 7.000e-29METAHIT unmapped GL0525228 unmapped_[Complete]_[mRNA]_locus=scaffold343203_3:1155:1532:+  ali  19  4..NPYQKYQQQSVMTMTPGEMLTRLFDELIKQLSAFKEFNSQKDYAQANDALQRAQRILRHLDATLDRQYEVSHGLSALYDYFIRRTVEANLRKDDAPIDEILPMVTELRDSFIQADRLAR.................................... 122
426 8.000e-29gi|399911272|ref|ZP_10779586.1| flagellar protein FliS [Halomonas sp. KM-1]  clstr ali  16  20......VGVESGVMSASPHQLIVMLFDGALGAIRAARIHMQAGNTAEKGKSISKALDIVNGLLAALDTEGEIAERLGSLYDYIGRLLLAANLHNDQESLDQAEKLLDDIASAWREIGSAGAQG.................................. 139
427 8.000e-29gi|372488441|ref|YP_005028006.1| flagellar biosynthetic protein FliS [Dechlorosoma suillum PS]  clstr ali  18  7.RAYAQVKVETAVSTANPVQLVVLLYEGAISAIASAKGEMERRNIAQKAQFINKAIDIIEGLRNALEFGGDIAVSLNDLYLYMVQRLSTANLKNDPAILDEVTALLRELLGAWEVLAKGTADG.................................. 130
428 8.000e-29gi|325923284|ref|ZP_08184957.1| flagellar biosynthetic protein FliS [Xanthomonas gardneri ATCC 19865]  clstr ali  16  49..QYRKVGVSTSVTEADPHKLVSLLFAGACQRIRLAQACLAQGDQARKGKAIGEACAIVGHLNGSLDHEGEIAGNLSALYDYVMQRLTAANLHNDETALTEALELLSEIDSAWNSIPLNQRGIAA................................ 173
429 8.000e-29gi|90411018|ref|ZP_01219032.1| flagellar protein FliS [Photobacterium profundum 3TCK]  clstr ali  7LQAYKRVSVDSQLTSASPHRVIQMLMAGAIERLIQGKASMEQGNIAVKGERLGKALDIIISLRSCLSMEGDIASNLDALYDFMIQQIYKANQENIPEPIDDVIDMLREIKSAWEQIPTEFHN................................... 130
430 8.000e-29gi|116626485|ref|YP_828641.1| flagellar protein FliS [Candidatus Solibacter usitatus Ellin6076]  clstr ali  17  4.NNGHDAYLESRVTSADPVELVNLLYQGCMVAVREARYHLAEGRIAERSREINKAFEILVELDLSLDHGGEISQRLAQLYAYMRQRLLDANMQQSDPPLTEVLGLLATLAEAWAGVRTPAAAAQ................................. 128
431 9.000e-29gi|429214660|ref|ZP_19205823.1| flagellar protein FliS [Pseudomonas sp. M1]  clstr ali  12  7LRQYQNVGVQAQLHEASPHRLIQMLMEGGLSRIAQARGAMQRGQMAEKGQLIGKAVAIIGGLRDGLNLEGDYAERLNALYIYMGRRLLEANRQNDEHMLDEVANLLRSIKEGWDGIPQ....................................... 126
432 9.000e-29gi|403382585|ref|ZP_10924642.1| flagellar protein FliS [Paenibacillus sp. JC66]  clstr ali  15  8....RNKYLETSVQTATPAQLLIMLCDGAIRFCRAGIEGIHENNYEKANLNLCKVQNIISELSASLDRNIEVSQELSQLYEYFNYRLIEANTKKAAEPAEEVLGYLVEFKETWVE.......................................... 118
433 9.000e-29gi|373859206|ref|ZP_09601937.1| flagellar protein FliS [Bacillus sp. 1NLA3E]  clstr ali  17  4LRNPYQTYQKQAVTTSKPEDLTLMLYEGLVKFIRLSKQSLQNKKYEECHRYNLRAQDILSELIVTLKKGYSVSEPLLSVYDYMKTRLIEANIKKSLEILTEVEGFAVEYVETWTVAMKQAK.................................... 124
435 1.000e-28gi|319944158|ref|ZP_08018434.1| flagellar biosynthetis protein FliS [Lautropia mirabilis ATCC 51599]  clstr ali  18  12..AYHAVEIESAVHHTDPHRLVEMLFDGAVTAVMKAGMALKQGNFAAKGESTSKAIRIIDELKASLDPSGSISTNLGMLYDYMTQTLLQANLHNELEKYEEVERLLKDLRDAWQAIRPQVVKSPL................................ 136
436 1.000e-28gi|83647501|ref|YP_435936.1| flagellar protein FliS [Hahella chejuensis KCTC 2396]  clstr ali  15  4LHQYQSVNRQTSIVDADGHKLIQLLFDGALERITMAKGQILAKNFEGKNRLIGKAVEIIGGLREFLDKDGDIAERLDALYEYMERRLFEANLQNDAMILDEVAGLLKQVKNGWDGIRQEA..................................... 125
437 1.000e-28JCVI_PEP_1096689583747 /source_dna_id=JCVI_ORF_1096689583746 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  15  7.NAYKKGNIKQDISQADPHRLTLMLMQGALDRLAYAKGCIDRRDLAGKSEHLSKATAILLNLRDTIDLESEVGGNLFALYDYMLERITDANVQNDLQIMDEVITLLLPIKNAWASIPEEAKQEAYEAQRLKRQ........................ 140
438 1.000e-28gi|89094871|ref|ZP_01167803.1| hypothetical protein MED92_17052 [Neptuniibacter caesariensis]  clstr ali  18  8LKQYQSVDLRATVETASPHKLISMLLDGALGALAKAKGSIERESIEERTQHLNKASEIVVGLRGSLDLEGEVATNLDALYDYMLRAIMQANRDSDAEKVQEVMNLMLEIKQGWSEMPNDIQ.................................... 130
439 1.000e-28gi|307546939|ref|YP_003899418.1| flagellar protein FliS [Halomonas elongata DSM 2581]  clstr ali  16  9..AYAKVGVESGVMSASSHQLIVMLFDGARTAMRAARIHMNEGHVAEKGASISKALDIVNGLLAALDGEGEVAGNLASLYEYIARRLLAANARNDVEALDEAERLLDDIASAWRDIEPQVAG................................... 131
440 1.000e-28gi|56964837|ref|YP_176568.1| flagellar protein FliS [Bacillus clausii KSM-K16]  clstr ali  14  8......VYKQQSVQTASPGELTLMLYNGCLKQIRLGKLAAENGEIEQANTAIGKAEAIIRELMVTLKTDSEVGANMMRMYEYILHQLIKGNIEKSPEALEEAETYVAEFRNTWKQVIQLERQNRFQGGQAK.......................... 132
442 1.000e-28gi|380511128|ref|ZP_09854535.1| flagellar protein FliS [Xanthomonas sacchari NCPPB 4393]  clstr ali  15  6.RQYAEQYRKMGISTADPHKLVAMLFAGACQRIRQAQACLAQGDQARKGKAIGEACAIVGHLNGSLDHEGEIAGNLSALYDYVMHRLTEANLHNDDAALTEALELLSEIDAAWAAIPAQQRELATANAS............................ 139
443 1.000e-28JCVI_PEP_1096679227517 /source_dna_id=JCVI_ORF_1096679227516 /offset=0 /translation_table=11 /length=131 /full_length=131  ali  17  1MRNPYQTYKKTAVQSASREKLLLLMYEGAIRYVKQAIIAVQKDDIAGRGQNIGAAFDVIMELNNTLDHKGEVAQNLEQLYMFMTDQLVQANVKGDEKKLQDVLNLLNTLYSGWKEAVEKLKR................................... 124
444 1.000e-28gi|217077457|ref|YP_002335175.1| flagellar protein FliS [Thermosipho africanus TCF52B]  clstr ali  15  3.......YTEQMVKTASPAKLIEMLYQRAVELLDMAERDVKNKEYVKANEEIQKCQDIITELNLSLDLEGEIAKNLRALYTYMFKTLVEANTKKDVEKIREVRGYLSELLETWREAMKNVGNTA................................. 121
445 1.000e-28gi|91776335|ref|YP_546091.1| flagellar protein FliS [Methylobacillus flagellatus KT]  clstr ali  16  9.NAYAKVGVETGVVAASPARLIVMLYEGAIAACNLAIKHIRERDYAGKSADLTKAISIINGLRASLDSKGEIAESLDALYVYMSKRLYLANSQSDIAAVEEVVRLLNELNEAWSALASQSAGAVPRQEPQQ.......................... 141
446 1.000e-28gi|225621524|ref|YP_002722783.1| flagellar protein FliS [Brachyspira hyodysenteriae WA1]  clstr ali  17  4.NNGYEKYKKVDVSTASQNRLIVMLYDGAIKFLETACAAMDKKHTEEAHNNIVKAQEIIYELLSSLNYEGDIAHRLASIYTYMNQKLTEGNISKTKPPLLEVIRYLKELKTAWEGVEEQMSKANTENKT............................ 133
447 1.000e-28gi|92114154|ref|YP_574082.1| flagellar protein FliS [Chromohalobacter salexigens DSM 3043]  clstr ali  18  8.QAYARVGVESGVMSASPHRLIVMLFDGAQAAIRAAKLHMEDGNIAAKGQSISKAMDIVNGLAAALDREGELAERLESLYDYVVRLLMKANRHNDQAALDEAARLLDDIGSAWREIGPQVDGA.................................. 132
448 2.000e-28gi|325982829|ref|YP_004295231.1| flagellar protein FliS [Nitrosomonas sp. AL212]  clstr ali  15  11...YQRVGIETGVESADPHKLILMLFEGTQEALAKTRMHMQRNEIAEKGQMISKAITIIDELSACLDMKGDLAIKLQALYNYMTHQLLVANIQNNIEILDEVNKLLSELYSAWKEIGESNQAKTTIKA............................. 138
449 2.000e-28gi|374583107|ref|ZP_09656201.1| flagellar biosynthetic protein FliS [Desulfosporosinus youngiae DSM 17734]  clstr ali  19  1MNPAANAYKNQQIMTSSPEQLTLLLYNGAIRFLTESILAMEQGDMPKSHKANLRVQEIVTEFVRTLDMSYEMSKTWAQLYEYTEYCLIQGNIKKDVSLLQQAKGMLTELRDTWAEAMKKTH.................................... 122
450 2.000e-28gi|338999107|ref|ZP_08637761.1| flagellar protein FliS [Halomonas sp. TD01]  clstr ali  14  15.KAYARVGVESGVMSADPHQLIVMLFDGAQASIRAARIHMQAGHTAEKGKSISKALDIINGLTASLDQEGDIAERLASLYDYISRLLLAANLRNDEDSLNQAERLLEDIASAWREIGQQQSA................................... 138
452 2.000e-28gi|377822034|ref|YP_004978405.1| flagellar protein FliS [Burkholderia sp. YI23]  clstr ali  14  10.SAYARVGVQTGVMGASPHRLIVMLYQGARQAIAQARMHLQQKNVSARGMAVGKAISIIEGLQQALNKDGEIAERLDALYTYMSRRLLEANLKQDESMLVEVDNLLATLEEAWVGIGPEVAQMTAAPV............................. 139
453 2.000e-28gi|420248252|ref|ZP_14751611.1| flagellar biosynthetic protein FliS [Burkholderia sp. BT03]  clstr ali  16  10.NAYARVGVETGAMGASPHRLIVMLYQGARKAIAQARMHIQRGDVKQRGLAIGKAIEIIDGLQLALDLEGEIAARLDALYSYMTRRLLEANIKQSDAMLVEIDGLLATLEEAWIGIAPEIARMAMQSSAES.......................... 142
454 2.000e-28gi|345861685|ref|ZP_08813940.1| flagellar protein FliS [Desulfosporosinus sp. OT]  clstr ali  18  1MMNAQNVYKNQQVMTSSPAQLTLLLYNGALRFLSECILATEQGNIEKAHHANQRVQAIVHEFVVTLDMSYEISKNWARLYEYTEHCLIQGNIKRDVQQLQQAKNVLQELREAWVGAMEQTH.................................... 123
456 2.000e-28gi|253990090|ref|YP_003041446.1| flagellar protein flis [Photorhabdus asymbiotica]  clstr ali  10  10...YAQIDVESEIMNASPYQLIQILFNGALSALRRAIILMEQGNIAEKGAAISKAINIIDGLKQGLNNEGELAHNLASLYDYMTQRLLQANLRNDETAITEVIKLLTEISEAWRQIGPHYNASQ................................. 133
458 2.000e-28gi|402574289|ref|YP_006623632.1| flagellar biosynthetic protein FliS [Desulfosporosinus meridiei DSM 13257]  clstr ali  18  3.QQMANAYKNQQILTSTPEQLTLLLYNGALRFMTESILAMEQGDTQKSHNANMRVQDIVREFMHTLDMSYELSKTWAQLYEYIEHCLIQGNMKKDVAQLQQAKGMLLELRDTWVEAMKQTH.................................... 122
459 2.000e-28gi|421747105|ref|ZP_16184850.1| flagellar protein FliS [Cupriavidus necator HPC(L)]  clstr ali  19  8.NAYARVGVQTGAMSASPHKLIAMLYDGARSAIARAKFHLDAGDVQARGQAISKAIDIVDGLRAVLDHDGEIAANLEALYDYMTRRLLLANVRSDVTLLNEVDALLENLATAWAQIGEPEAG................................... 131
460 2.000e-28gi|225851149|ref|YP_002731383.1| flagellar protein FliS [Persephonella marina EX-H1]  clstr ali  15  1MTNPYDIYIKTDIETASPLKQIIMLYDKAIVSLKQAVEDIKNNRIKDKVENIHKATDIILALDAALDLEGEIAKNLKDLYNFAYNKLLEAHAKNDTELINDIIEILETLRSAWEEIESK...................................... 121
463 2.000e-28gi|89075508|ref|ZP_01161919.1| putative polar flagellar protein FlaJ [Photobacterium sp. SKA34]  clstr ali  13  5LQAYKKVSVNAQLASASPHRVIQMLYAGAIERLIQGKAAMDQGNIAVKCERLSKALDIVLSLRDCLSMEGDIAKNLDALYEFMASEISRANAENQTKPIDDVIGMLREIKSAWDQIPTEYH.................................... 127
464 2.000e-28gi|89895746|ref|YP_519233.1| hypothetical protein DSY3000 [Desulfitobacterium hafniense Y51]  clstr ali  21  20.SQMAAAYKNQQIMTASPEQLTLLLYNGALRFLNESIQALESGDKEKSHNANLRVQAIVHELMGTLDMNYEISQNWAALYEYIEHCLIEGNIQKDVQQLYNAKEILEDMRNTWQEAMKLAQQAKVA............................... 144
465 3.000e-28gi|398793063|ref|ZP_10553553.1| flagellar biosynthetic protein FliS [Pantoea sp. YR343]  clstr ali  16  8.QAYAKIGVESSVMSANQQQLITLLFDGAISALVRARLFMQDNNIQGKGNSISKAINIIEGLKQGLDEQDDLTDNLLGLYSYMVRRLVQANLRNDVEALEEVEGLLRNIADAWKEVVQPQH.................................... 130
466 3.000e-28gi|168334407|ref|ZP_02692586.1| flagellar protein FliS [Epulopiscium sp. `N.t. morphotype B`]  clstr ali  18  3.KQAYXSYRNNAIMTASPAELTLMLYNGAIKFCTMTIESIEKKELSNAHKYNVRVQDIIIELKITXDKKYEIAEEMDRLYTYILKILREGNIEKNVDKINEAKGLITVFRDTWREVMNKGP.................................... 122
467 3.000e-28gi|148546731|ref|YP_001266833.1| flagellar protein FliS [Pseudomonas putida F1]  clstr ali  13  7LRQYQKVNGVAQTSEASPHRLVQMLMQGGLDRMAQAKGAIARNDIAQRGILLGKAIDIIGGLREGLDLEGDNLAELDSLYIYMSRRLTEANLKGDPTIIDEVARLLITVKEGWDAIGDQSSA................................... 130
468 3.000e-28gi|304398831|ref|ZP_07380701.1| flagellar protein FliS [Pantoea sp. aB]  clstr ali  17  8.KAYAKIGVESAVMSASQQQLVAMLFDGALSAIIRARLFMQDGNIAGKGSSISKAINIIEGLKESLSRGDELADNLRNLYDYMTRRLVHANMHNDVAAVEEVEGLLRNIADAWKEVVQPNPVQ.................................. 132
469 3.000e-28gi|407790052|ref|ZP_11137149.1| flagellar protein FliS [Gallaecimonas xiamenensis 3-C-1]  clstr ali  18  5MKQYQGADRNARLLNANPHQVILMLMDGVLEKIAVAKGCLERNDIPGKSQAIDKAIGLISGLQGVLDTESEASKNFSAFYDVMTQGLIEASAGRDVEQLDHLIKLFLPLRDAWRDMPEAQKQEGLNLIQQKA......................... 138
471 3.000e-28gi|209695744|ref|YP_002263674.1| flagellar protein FliS [Aliivibrio salmonicida LFI1238]  clstr ali  12  5LQAYKKVSIDSQLSAASPHKVIQMLMAGAIERLIQGKAAMQQGNTAVKGERLGKALDIVISLRSCLSMDGDIASNLDSLYDFMIRQISQANQNNEAQPIDDVVEMLREIKSAWDQIPAEFHNLTADQVG............................ 135
472 3.000e-28gi|388256969|ref|ZP_10134149.1| flagellar protein FliS [Cellvibrio sp. BR]  clstr ali  21  1MNNPYSVDLEAKAATASPYELVLVLFDGLLDELARTRGHIEAKRYQEKGRSLEKCLNILNGLNSALDYDGEVVQGLSRLYDYCIYRLSDVSVSLSLEGLEEVVHLLGVIREGWDGVNAQRR.................................... 133
473 3.000e-28gi|168333366|ref|ZP_02691646.1| hypothetical protein Epulo_00784 [Epulopiscium sp. `N.t. morphotype B`]  clstr ali  27  5..........AQVAAANEIELLCLTYDLFLE-----KXGALAANNTASIPYKKDALKVLTVLXGNLDMSVALSHDLFDLYIFIQKLVIEGDY-------ADAAEIMSHIRDGYVAIKNLNLDKPTTQNAENIYAGFTYGRSSINEFVVGNDNRGYI. 139
475 4.000e-28Oral.Meta HOMD tden_c_1_9212 Treponema denticola ATCC 35405, DSM 14222 [137600 - 137151] flagellar protein FliS  ali  18  9.SQAAAAYKETSVKTASPGSLILMLYTEGIKEINLAISKMRAKDIEAINNHIIKAQEIITELMAALDMDGEIAANLLSIYSYFNQQLLTANLKKDYKPLLDVSSMMQELYDVWKQILESQPVPQRSEVSVGVN........................ 147
476 4.000e-28gi|395796582|ref|ZP_10475877.1| flagellar protein FliS [Pseudomonas sp. Ag1]  clstr ali  18  7LRQYQKVNTHAQISEASPHRLVQLLMEGALDRMAQAKGAMARGDIAQKGLMLGKAVDILVGLRDGLNPEDPIAQQLDNLYAFMTMRLLEANRQNDAAMIDEVAGLMITLKEGWDGIATEVQ.................................... 131
477 4.000e-28gi|34498448|ref|NP_902663.1| flagellar protein FliS [Chromobacterium violaceum ATCC 12472]  clstr ali  22  7.RSYHAVNLEAQTGAASQIELVLVLFDGLLEEIARARGHLQHQRFEQKGESISKCINILNGLSSALDFEGEVVTNLARLYDYCAHRLYQASVELDAAALDEAEKLLVTLKGGWVGVRDQNAAA.................................. 130
478 4.000e-28gi|308273223|emb|CBX29826.1| hypothetical protein N47_F15210 [uncultured Desulfobacterium sp.]  clstr ali  22  3.NNGIQTYRKTTVITADPGKLVLMCYEGAIDQLKIAKQKYKENNYESKCKALQKAMNFIDELLCSLNFEGAIAKNLAELYKYMNTKILQADINKDIGGFDEVIGILSELLSAWEEIINGQRKK.................................. 126
479 4.000e-28gi|218778500|ref|YP_002429818.1| flagellar protein FliS [Desulfatibacillum alkenivorans AK-01]  clstr ali  21  8......AYKKTNVETADPKKLVIMCYDGAIFNLKMAKERYLEHNYEAKSAALSKAMLIIGELNSALDMEGDIAKNLKAIYDYVVRRLTEGDIHRDLTAFDEAITILEELGSAWKEI......................................... 119
480 4.000e-28gi|299856693|pdb|3IQC|A Chain A, Crystal Structure Of Flis From H. Pylori  clstr ali model  20  10..NAYQAYQHNRVSVESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREI......................................... 125
481 4.000e-28JCVI_PEP_1096694903219 /source_dna_id=JCVI_ORF_1096694903218 /offset=0 /translation_table=11 /length=143 /full_length=143  ali  17  18MNQYKTVGLKSGVDTASPHQLIDMLLKGAMGKISEAKAAMAGGQIALKGEAVGKAIAIVEYLRVSLDPGIDAAEQLGELYRYIETRLLAANLKNDAEALDEAQALLRELSAGWAGIPDEYRTE.................................. 142
482 4.000e-28gi|423096632|ref|ZP_17084428.1| flagellar protein FliS [Pseudomonas fluorescens Q2-87]  clstr ali  19  7LRQYQKVNSHAQISEANPHRLVQMLMEGGLDRMAQAKGALERGDIALKGLMLGKAVDIIIGLRDGLNPEKASLQQLDNLYAYMMTRLMEANRNNDVAIIDEVSGLLETLKSGWDAIADHA..................................... 130
483 5.000e-28gi|410728916|ref|ZP_11367004.1| flagellar biosynthetic protein FliS [Clostridium sp. Maddingley MBC34-26]  clstr ali  17  4..NGYNVYKNNSVNYASKEQLLLMLTEGAVKFAKIARQAITDKDIQKAHNTLIRLQDIFTELMISLDRQGDWTEDLFSVYDFIKRKLVDINLTKNLEVLDEIIPLIEDVNSMWQDAYKQ...................................... 121
484 5.000e-28gi|381151651|ref|ZP_09863520.1| flagellar biosynthetic protein FliS [Methylomicrobium album BG8]  clstr ali  13  7MNQYKEVRVQSLVMDATPHRLIQMLMEGVLEKIALAKGNILRKEIAQKGENIGKAITIVGGLQASLDKEGELAENLNSLYGYMSQRLLMANLQSDEAILDEIADLMLEIKAGWDAIP........................................ 125
485 5.000e-28gi|288941670|ref|YP_003443910.1| flagellar protein FliS [Allochromatium vinosum DSM 180]  clstr ali  17  4MRRELNQYRQAEIAVADPHRLTQMLFEGALERLAVARGAMAQGNAPLKGQKIGQAMEIIGELRGALDLEGELAANLDSLYDYMIRRLVTGNARNAPEMLEEISILLREIKAGWDAIPEQMRKA.................................. 132
486 5.000e-28gi|154249506|ref|YP_001410331.1| flagellar protein FliS [Fervidobacterium nodosum Rt17-B1]  clstr ali  17  3.......YLEQMVMTASPAKLIELLIEKAISVLEEAKVFIDEKDYVKANEKIVRAQDIVMELNLALDLEGDIAKSLRALYNYMYRTLVEANIKKDKDMIDDVKTLLSDLLSTWREAMKLAGSTASQ............................... 123
487 5.000e-28gi|388569291|ref|ZP_10155694.1| flagellar protein FliS [Hydrogenophaga sp. PBC]  clstr ali  15  13...YKRVAVETGVQAADSHRLVGMLFDGLLQAVAAARGAMERGDLVVKGEQIGKAVRIVEELKAGLDPGGEMAQNLRALYAYSVRRLTEANLRNDPSALAEVATLIEPVAQAWQDIRGQALQGA................................. 135
488 5.000e-28gi|402299793|ref|ZP_10819366.1| flagellar protein FliS [Bacillus alcalophilus ATCC 27647]  clstr ali  19  5..QMQATYKQNALKTASPGELTLMLYNGCLKFMKQAEKAMGAEQTEARNTAITKAQNIIRELMVTLKTDSELGVNMMRMYDFTLNRLVDANVKNDLQALKEAEDIVVQFRDTWKEVIQLDRKQ.................................. 125
489 5.000e-28gi|335419810|ref|ZP_08550856.1| flagellar protein potentiates polymerization, flagellar protein FliS [Salinisphaera shabanensis E1L3A]  clstr ali  16  6.NRAASAYKETAAMSASPHQLIVLLFDGARSALGRAQWAISQSDQAGKGQALSKAIDIIEGLRAALDIEGEIAERLDALYDYMTRTLIRANIKSDTALIAQVDTLLDDIGSAWKQIG-NVPSMPSVAAPQPVSS....................... 144
490 6.000e-28gi|254973896|ref|ZP_05270368.1| flagellar protein FliS [Clostridium difficile QCD-66c26]  clstr ali  16  5..NPYNSYKQNAVFMASKEQLLLMLVDGAVKYTKIARAAILDKNTQKAHRELVRVQDIFTELMVTLDQNGQWAKDMYKVYDFVRYELSRANIRKDIQVIDNVLPVIEQIKDTWHEADKKSKEE.................................. 126
492 6.000e-28gi|119503656|ref|ZP_01625739.1| flagellar protein FliS [marine gamma proteobacterium HTCC2080]  clstr ali  18  7MQAYQSTNAHASVMDASPHKLIALILNRVLERISRAKLAVEQGDAAARGQAISKSIEAVGSLQSWLDMEGEVADNLNGLYDYIVRRLLEANTINDLSALEEVSELLSEIKSGWDGIAPGAAR................................... 130
493 6.000e-28gi|385799443|ref|YP_005835847.1| flagellar protein FliS [Halanaerobium praevalens DSM 2228]  clstr ali  21  6....ADQYKQMQIKTASPGKLLLMLYQGGLKFMKLAKKNIKAGKIEESHKNIIKAQNIILELQGTLDKKGEIAIQLENLYDYIYRELLQANLNKNTKHLDNVIPLVEELFLTYKEIIVNKGSKDTKKVKAEV......................... 135
495 6.000e-28gi|197285481|ref|YP_002151353.1| flagellar protein FliS [Proteus mirabilis HI4320]  clstr ali  10  10...YAQIDVESEILNASPYQLIQILFNGALSALRRALILMEQGNIAGKGENISKAINIINGLKQGLDKEKELAENLALLYDYMITQLLDANLKNNPEKIHEVIKLLTEISDAWQQIGTQINS................................... 131
496 6.000e-28METAHIT MH0048 GL0081966 [Complete] locus=scaffold22624_1:954:1265:-  ali  31  3..................................................NIGKAKQFVDDLSSSLDMRFKISYELQRLYSFIRGRLIIAEGRENAEYLDVCIEMLEKLRSAFEKVAESDHSGNVIQGSQKVYAGLTYGPGSLNEVV.......... 100
498 7.000e-28gi|409426495|ref|ZP_11261046.1| flagellar protein FliS [Pseudomonas sp. HYS]  clstr ali  13  7LRQYQKVNGVAQTSVASPHRLVQMLMQGGLDRIAQAKGAMARNDVAQRGILIGKAIGIVGGLREGLDLENDSLTDLDNLYSYMSKRLVEANVQNDPEILNEVARLLITVKEGWDAIGEQPAD................................... 130
500 7.000e-28gi|34556599|ref|NP_906414.1| flagellar protein FliS [Wolinella succinogenes DSM 1740]  clstr ali  16  4.NAAYSSYQQNSITVESPAKLIEMLYEGILRFTALAKRAMDEEDIEKKIYYVNRTTDIFTELLNSLDYKGDVAHYLTGLYTHQIKLLTQANVENNKEKIDIVIKVTRGLLEAWKEIHQNELAKGV................................ 129
502 8.000e-28gi|300717215|ref|YP_003742018.1| flagellin-specific chaperone [Erwinia billingiae Eb661]  clstr ali  16  8.KAYAKIGVESAVMSATPDQLVTMLFDGALSALVRARLFLLDGNIAGKGESLSKAINIINGLKQGLDKGDELADNLASLYRYMVHRLLKANLHNDAEAILEVETLLRNIADAWKEVSATNA.................................... 130
503 9.000e-28gi|383791876|ref|YP_005476450.1| flagellar biosynthetic protein FliS [Spirochaeta africana DSM 8902]  clstr ali  20  5.RNALNAYKETRVRTASRGQLIVMLYDEAIRQIDAAMELLEGDRYDTVNEALTKAKDCITELMVSVDFEGEIAQNLFSLYSYFGRQILEANINKDVKLLRPVRRQLHTLREAWSEIAGRSQDGAAPSGGINV......................... 139
504 9.000e-28gi|328958288|ref|YP_004375674.1| flagellar protein FliS [Carnobacterium sp. 17-4]  clstr ali  19  5.KNGSAIYKENQILNASPKKLIVLLYEGCIKNLKLAEIHITEKNIEKTNQVLIKAQDILAELMNTLDFEGEVAENLYRMYEYLTSELVKANISKNIEDVQRSRKLIEELRDTWIEI......................................... 121
505 9.000e-28gi|308048747|ref|YP_003912313.1| flagellar protein FliS [Ferrimonas balearica DSM 9799]  clstr ali  15  5LKAYNKVNISSQAAEASPHKVVQLLLGGSIDKLLQAKLAIEQNATAKKGELIGRTVEIVAHLQAALDFEGEIAQNLSAMYDYMVRRLVDANQNNDVDALMEVIDLLRTVKSGWDAIPVEHH.................................... 127
507 9.000e-28gi|339488670|ref|YP_004703198.1| flagellar protein FliS [Pseudomonas putida S16]  clstr ali  16  7LRQYQKVNTHAQISEATPHRLVQLLMEGSLDRMAQAKGAIARGDVAQKGVMLGKAIDIIGGLREGLDKEKEELDRLDSLYDYMARRLTQANLHSDPAIIDEVAQLMITVKSGWDAIASAEQ.................................... 131
508 1.000e-27gi|71281914|ref|YP_268238.1| flagellar protein FliS [Colwellia psychrerythraea 34H]  clstr ali  18  7..KKYQQTTKSTAQQASPYQLVAMLFQKLLGNIATAKGAISQSNFEKKGTELSNAIAIIGVLEGSLDFKGEVSENLAALYRFCSEQLLVASTNNDPAKLEEVIQILLPIKAGWDSIPLETQGQ.................................. 129
509 1.000e-27gi|85058034|ref|YP_453736.1| flagellar protein FliS [Sodalis glossinidius str. `morsitans`]  clstr ali  17  8.NAYQQISLQTSIAGATPHQLIVMLFDGAHGALARAGIWMARGNIARRGEEISRAIAIIEGLLATLDYEKTLAEDLASLYRYMIRTLLQANLHNDPEAIKYVDALLKNVSSAWKEITP....................................... 127
510 1.000e-27gi|302874582|ref|YP_003843215.1| flagellar protein FliS [Clostridium cellulovorans 743B]  clstr ali  21  4LTNGYTAYKNNSVNFASKEQLLLMLLDGAVKFSKMSRQAIVDKDIKKAHENLMKVQDIFIELRVTLDINGEWARNLAKVYDFIIENLRKVNFKKDIELLDETMPIIEDIRNMWNEAYKISKR................................... 127
511 1.000e-27gi|302037658|ref|YP_003797980.1| flagellin-specific chaperone FliS [Candidatus Nitrospira defluvii]  clstr ali  17  5...AANAYQQTQVMTANRVQLIVLLYDSAIQSMELAREAILTNNYKDKARFLDRSIAIVGELSSVLDFEGEIAVSLHRLYDYMVQQCIQANLRHNGKHLDGPVRCLTTLREGWQVVARQEAVAHVGS.............................. 130
512 1.000e-27gi|54307280|ref|YP_128300.1| LafC [Photobacterium profundum SS9]  clstr ali  12  9..AYQHSQNHAQAAAASPHRLIQMLLEGLLDNLSRARGFMERGQVADKGMMISKCLDILNGLSSVLDEEGDVTVELFRLYDYCGRRLFEANINDELEGIDEVTRLITDILEGWVVLKPN...................................... 127
513 1.000e-27gi|319787109|ref|YP_004146584.1| flagellar protein FliS [Pseudoxanthomonas suwonensis 11-1]  clstr ali  17  11..QYRRTAISARVAEADPHQLVAMLFEGATQRIRRAQACLDQGEIALKGKAIGEACAIIGHLNGSLDHEGQLATNLSSLYDYLIRRLTEANLHNDRAALSESLDLLGEVEAAWNSIPQAQRSA.................................. 133
514 1.000e-27gi|423692790|ref|ZP_17667310.1| flagellar protein FliS [Pseudomonas fluorescens SS101]  clstr ali  14  7LRQYQKVNSHAQVSEASPHRLIQMLLEGGLDRLAQAKGAMSRGDTAQKCVLITKAIDIITGLRQGLDEEKAAIQQLDSLYEYMNTRLVQANARNDADAIDEVARLLITVKTGWDAIAPQ...................................... 129
515 1.000e-27JCVI_PEP_1096695473091 /source_dna_id=JCVI_ORF_1096695473090 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  22  16....ARSYKAQSVQTASPGKLVLMLFDGYLRFTTAAKRAFEEEEFTKRNENLIRAQNIVTELQASLDMSGDLPGTLYRLYDYVMHNLQQANLKKEEKPIDEADKVIGELREAWAEMLAQNPENAPS............................... 143
516 1.000e-27JCVI_PEP_1096694126453 /source_dna_id=JCVI_ORF_1096694126452 /offset=0 /translation_table=11 /length=129 /full_length=129  ali  17  7LKAYQNVAVESNAAYADGVQLVQMLFDGLMESIDKAHGHIERGEITEKNETISRAQKIIFGLQMSLDMEGDLSRNLNDLYEYSVRRLLHAHSRNDVEALEEVKSLITEVSSAWSMLP........................................ 125
517 1.000e-27gi|221635627|ref|YP_002523503.1| flagellar protein FliS [Thermomicrobium roseum DSM 5159]  clstr ali  22  4..NPYQRYRQVTVETASVAELMVLLYRRAIQVLDEAEEAIHSRDVPRAHARLVFAQEIVAELMASLNLEGELAQQLLAIYDYLQRRLVEANVRKDPAIVAEVRAFLSSLLEAWEEVAARER.................................... 123
518 1.000e-27gi|374997315|ref|YP_004972814.1| flagellar biosynthetic protein FliS [Desulfosporosinus orientis DSM 765]  clstr ali  18  4.SQMADVYKKQQIMTSSPQQLTLLLYNGALKFLNESILAMEQGDKQKSHNANLRVQAIVSEFVLTLDMKYEISITWAQLYEYVEHCLIQGNLNQDVNLLKQAKEVLQELRDAWAGAMKQTRLAPVA............................... 128
519 1.000e-27gi|73538917|ref|YP_299284.1| flagellar protein FliS [Ralstonia eutropha JMP134]  clstr ali  18  8.NAYAQVGVQTGAMSASPIKLITMLYDGARAAIARAKFHLENGEIVARGNAISKAIDIVDGLRAVLDHEGEISANLESLYEYMVRRLMLANLHSDGDMLDEVDRLLESLASAWAQIDETSQQA.................................. 132
520 1.000e-27gi|42522204|ref|NP_967584.1| flagellar protein FliS [Bdellovibrio bacteriovorus HD100]  clstr ali  16  3.KNAYQKYKTTSVQSASREKILLMLYEGAIKFTKLAIKAAEEKKIADRGMNIGRAFDIIMELNNTLDHKGDVANQLEQLYMFMMEQYTKANITGSPEPLKENLKLLNTLYDGWVQAVEKLKQETNNSPDKKA......................... 135
521 1.000e-27gi|146305228|ref|YP_001185693.1| flagellar protein FliS [Pseudomonas mendocina ymp]  clstr ali  26  12..SYRTVDLEARAAAASPYELVLVLFDGLLDELARARGHIEAKRYQQKGQSLEKCLNILGGLNSALDYEGELVQGLARLYDYCIYRLSDVSVSLSLEGLDEVVGLLGVLREGWEGV......................................... 127
523 1.000e-27JCVI_PEP_1096689193629 /source_dna_id=JCVI_ORF_1096689193628 /offset=0 /translation_table=11 /length=120 /full_length=120  ali  13  6.........QSNVDSASPVQLITMLFNGALERINTARYHMERGEVAEQGETIGKIIDIVASLDAYLDHDGDLSKNLESLYDYIVRQLFDANRKSDLSILDEVASLLMEVRAGWVESTKNQ..................................... 118
524 1.000e-27gi|167034931|ref|YP_001670162.1| flagellar protein FliS [Pseudomonas putida GB-1]  clstr ali  13  7LRQYQKVNSHAQISEATPHRLVQMLMEGGLDRMAQAKGAMARGDIAEKGLMLGKAIDIIIGLRDGLQPEKEYVEKLDALYVYMTNRLMQANVDNDAGIIDEVAQLLITVKSGWDGIADAQPA................................... 132
526 1.000e-27gi|71735540|ref|YP_275547.1| flagellar protein FliS [Pseudomonas syringae pv. phaseolicola 1448A]  clstr ali  14  7LRQYQKIGSQAQTSEASPHRLVQMLMEGGLDRIAQAKGAMARKDVASKGVFISKAIGIVGGLREGLDLDNAPSEALDSLYHYMMTRLAEANARNDQKMLDEVAGLLITVKEGWDAIGTAQAQQ.................................. 132
527 2.000e-27gi|90408889|ref|ZP_01217027.1| hypothetical protein PCNPT3_11968 [Psychromonas sp. CNPT3]  clstr ali  20  1MRLSLKKYQNTSVEQADPHALISLIMQHILGNLAAAKGAIDRKDIENKNKLLGKVIGLIGELQDSLDMEGDISRHLYDLYSYMISQVTQANMKNDTSPLTEVGSLINEIKSAWDAIPPDVRRQ.................................. 128
528 2.000e-27gi|332297150|ref|YP_004439072.1| flagellar protein FliS [Treponema brennaborense DSM 12168]  clstr ali  19  4.SQAYSAYRETGVKTASQGKLVVMLYDEAVKQLNFALAHIGAQHIEAFNKNILKTQEIITELMVALDMEGDISKNLMSLYIFFNKELLNANISRDKKKIGFVCDMMSQLRDAWSVASASAGATPAPAV............................. 138
529 2.000e-27gi|311279125|ref|YP_003941356.1| flagellar protein FliS [Enterobacter cloacae SCF1]  clstr ali  17  8.QAYAKIGVESAVMSASQQQLVTMLFDGALSALVRARLFMQDGNTEGKGLSLSKAINIINGLKVGLDEDDELTQNMIALYSYMVRRLLHANLHNDVSAIEEVEHLLRNIADAWKEVANTPN.................................... 130
530 2.000e-27gi|260222444|emb|CBA32014.1| Flagellar protein fliS [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  17  11.SAYKRVGIETSVDNADPHKLVVLLFDALNQALGGARLAIQNGDVPAKCKHINHAVRIFEELIAPLNLQGELAANLHALYTYCVQRLTVANIKSDAGIIEEVQRVMEPVSSGWKQINGNGPA................................... 134
531 2.000e-27gi|146307853|ref|YP_001188318.1| flagellar protein FliS [Pseudomonas mendocina ymp]  clstr ali  14  7LRQYQTVNNQAQAAEASPHRLIQMLMEGGLSRIAQARGAMEREQTALKGELIGKSIAIIAGLRESLDHQGELAGNLDSLYEYMIARLTEANVSNEPALLEEVSELLRNVKQGWDAIAQ....................................... 126
532 2.000e-27gi|220903806|ref|YP_002479118.1| flagellar protein FliS [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]  clstr ali  18  1MNKAAHAYFQTKIGTTDQGQLLLMLYDGALKYIQQARTKMIAKDFAGKGIMISKVIDIVNELAASLNMDGSLAVNLNNLYLLCTARLLRANLKMDMESLDSVESILSGLRGAYAQIIETPEARKAA............................... 128
533 2.000e-27gi|149189852|ref|ZP_01868132.1| LafC [Vibrio shilonii AK1]  clstr ali  19  9..SYQQVDLDAQAAAANPHQLVVMLIDGLLNEIERVRGHIGAGRLAEKGDGISKCMNILVGLDSALDDEGEIAENLHQLYDFCQIELYQASIHNDVEKLASVERVMGNIREGWLNFGNQA..................................... 128
534 2.000e-27gi|333996085|ref|YP_004528698.1| flagellar protein FliS [Treponema azotonutricium ZAS-9]  clstr ali  19  4.TNALSAYRETRVKTASQGQLIIMLYDEAVKHLDRGLELLDPGKIEQVNKSILKAQEIITELMVSLDFEGDIAKNLFSLYTWFNQELLEANIKQDLRRITVIRNMLSELRGAWSEIASKNPAEAAGKAVSGIN........................ 145
535 2.000e-27JCVI_PEP_1096695500083 /source_dna_id=JCVI_ORF_1096695500082 /offset=0 /translation_table=11 /length=135 /full_length=135  ali  15  11LTAYTQTNIDSIVHEATPHKLIEMLFKGAKDALAQAMGAIEQKDFEAKGKKISKATEIILNLQTYLDKEGEVAENLNELYTYMAKVLIDANRTNDLEKLREILGLLDTVANGWASMSEEFKR................................... 134
536 2.000e-27gi|345892252|ref|ZP_08843075.1| hypothetical protein HMPREF1022_01735 [Desulfovibrio sp. 6_1_46AFAA]  clstr ali  18  1MNKAAQAYFQTKVSTTDQGQLLIMLYDGALNYLQQARDKMLARDFAGKGILISKVIDIVNELSASLNMDGSLAVNLNNLYILCTARLLQANLKMNVESLDSVVHILSGLRGAYAQIIETP..................................... 122
538 2.000e-27gi|90415358|ref|ZP_01223292.1| hypothetical protein GB2207_08581 [gamma proteobacterium HTCC2207]  clstr ali  14  9.NAYQNTQVSSAVDYADGIQLIQMLFDGLIDALSCAEGEIERKNIPEKTISINRATGIIYGLQDSLDFENDLARNLSELYEYMGRRMTFANAHNDINAIREVRGLANEIRGAWKLLPSLLKQEHVAKAS............................ 138
539 2.000e-27gi|403740638|ref|ZP_10952691.1| flagellar protein FliS [Austwickia chelonae NBRC 105200]  clstr ali  19  1MTTAAQRYAQDTVSTASPAKLLVMLYDRLSKDLLNAEQAVVAGDIPGAHAAIVHAQEIITELAVTLDVSWEGGEKLLAVYEFCLQELFQANVHKDAARVHSVREIIEPLRDSWKQAAAQTGEKP................................. 128
540 2.000e-27gi|261855242|ref|YP_003262525.1| flagellar protein FliS [Halothiobacillus neapolitanus c2]  clstr ali  21  8.QNYRQIDLVAEVEQASPHRLVAMLFEGFLTHVAKAKVATQTMDYEAKARNVQLAMDILVGLKGGLDASPELAERLFELYDYCERRLLDASARRDISGFEEVDMLIRQIKEAWDAIEPQVATGQAVKMAATA......................... 140
541 2.000e-27gi|386018823|ref|YP_005936847.1| flagellar protein FliS [Pseudomonas stutzeri DSM 4166]  clstr ali  24  11..SYRSVDLEARAASASPYELVLVLMDGLLDELARARGHIEHKRYQQKGASLEKCMNILNGLNGALDEEGEVVQGLARLYEYCIYRLSDVSVTLSLDGLDEVVNLLGTLREGWEGVSAARK.................................... 131
542 3.000e-27gi|238782813|ref|ZP_04626842.1| hypothetical protein yberc0001_34410 [Yersinia bercovieri ATCC 43970]  clstr ali  15  8.KAYARVGLESQLAGASPHQLISMLLDGALNAVLRAKIYFENGNIAKRGEMISKAINIIDGLRASLNHEKNIAQDLERLYDYMSRTLLQANLHNSPSELTSISEILTNLANTWKEIEPKESQK.................................. 132
543 3.000e-27gi|383757545|ref|YP_005436530.1| flagellar protein FliS [Rubrivivax gelatinosus IL144]  clstr ali  17  16.NAYRHIGTETGVSGATPHRLVAMLFEGYMDAVAQARGGMRAGNVERKSRGIQRALRIVGELRENLDMKGRLAQDLNDLYGYLELRLTQANIRNDEAILDECQRLMQPLQDAWNAIGETV..................................... 137
544 3.000e-27JCVI_PEP_1096671015811 /source_dna_id=JCVI_ORF_1096671015810 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  16  1MSYGIKAYKSVGIAVADPHRIIQLLMQGSLENMAKAKGAMERKDFAEKSRTVSKAMSIISALQNSLDMGGEVSENLWSLYDFMVNHLMHASRENSTVKVDDVIEIMIKIKSGWDAIPVADRQHGFQLLAEKEQ........................ 139
545 3.000e-27gi|121596097|ref|YP_987993.1| flagellar protein FliS [Acidovorax sp. JS42]  clstr ali  18  12..AYRQVGVQSVVESASPHMLIQMLFDGLMQSLNAARGALQRGEIEEKGHQLGKAARILDELKAGLNQGGELASNLGALYDYCANRLMLANVRNDLALIEEVVRLIAPVAQSWGQIGAGSAAPA................................. 136
548 3.000e-27JCVI_PEP_1096687394299 /source_dna_id=JCVI_ORF_1096687394298 /offset=0 /translation_table=11 /length=170 /full_length=170  ali  21  43LNSYRWVGKEAAIEFADNHALVKMLFSGAVDAMSQAERYFALGEIAERGKAISKSQKILFGLRSTLDHGGELARNLDSLYDYCIRQLTAAHASNEVAKVSEAKALMVQIREAWE-IMPLNRAAPVQ............................... 169
549 4.000e-27gi|374382266|ref|ZP_09639850.1| flagellar protein FliS [Desulfitobacterium dichloroeliminans LMG P-21439]  clstr ali  20  6.SQMAAAYKNQQIMTASPEQLTLLLYNGALRFLAESILALEKGEMEKSHKANLRVQAIVREFMVTLDMNYELSQNWAALYEYIENCLIEGNIKKDVQQLNNAKTILEEMRNTWQEAMKQAQQSKLA............................... 130
550 4.000e-27gi|359689665|ref|ZP_09259666.1| endoflagellar biosynthesis chaperone [Leptospira licerasiae serovar Varillal str. MMD0835]  clstr ali  16  13......QYKSNEISTVSQGRLIVMLYEGAIRFLNVAIENNTPRKYDVVNNNILKAQEIVTELMLALNMEGEVANNLLGIYVYIKKRLLEANMKKDSEILSEIIKYLEDLKLAWEEIEKKEKASSVVPMPS........................... 138
551 4.000e-27gi|388548006|ref|ZP_10151263.1| flagellar protein FliS [Pseudomonas sp. M47T1]  clstr ali  17  7LRQYQKVSSVAQTSEASPHRLVQMLMEGGLDRLAQAKGALSRGQIAQKGLMLSKAIEIIGGLRTGLDPEGDPAQDLDALYAYMMQRLGEANRKNDSEMIDEVAKLLITVKSGWDAIA........................................ 128
552 4.000e-27gi|182418284|ref|ZP_02949579.1| flagellar protein FliS [Clostridium butyricum 5521]  clstr ali  17  3.SNGYNVYKTNSVNYASKDQMLLMLVDGAVKFTKIGRQAILDKDIQKSHNSLMRVQDIFTELIVSLDVEKEWAKPLRDIYFFINEKLAEANMKKDIKTLDEALDLIEGVRDLWHETYKKAKN................................... 124
553 5.000e-27gi|255618265|ref|XP_002539918.1| B-type flagellar protein fliS, putative [Ricinus communis]  clstr ali  20  103.SSYHATSLDAQTSRASPIELVLVLTDGLLDELARARAHIVAKRYEQRAHSINKCVDIINGLSSSLDFEGQVVANLANLYEFCVTHLHGAGIKQDPAMVDEVVRIMTTIRQGWAGV......................................... 219
554 5.000e-27gi|344940994|ref|ZP_08780282.1| flagellar protein FliS [Methylobacter tundripaludum SV96]  clstr ali  18  11.NQYANVHNESGLADASPHYLIQMLMDGFLARVNAAKGAMDRSDLELKSVYISRAVAIVGGLNEAVDLEGEIAANLSRLYNYMTTRLLQASRENDEAILDEVASLMREIKGAWDAI......................................... 127
555 5.000e-27gi|336315376|ref|ZP_08570287.1| flagellar biosynthetic protein FliS [Rheinheimera sp. A13L]  clstr ali  15  1MSYGIKAYKSVGVAVADPHRIIQLLMQGSLENMAKAKGAMERKDFAEKSRTVSKAMSIISALQHSLDMDGEVSQNLWSLYDFMVNHLMQASRESNPAKVDDVIDIMIKIKSGWDAIPVEDRQKGFQ............................... 132
556 5.000e-27JCVI_PEP_1096666000179 /source_dna_id=JCVI_ORF_1096666000178 /offset=0 /translation_table=11 /length=145 /full_length=145  ali  20  9...AYKATKTQAIDEASPHQLVAMLLDGALQRIAEARGAIERGEVATKSEAIGKAIAILDSLRVTLDHEGELAGNLSGLYDYMTRRLLEANATKDIKMLTEVADLVKEIKAAWSQVPPELHR................................... 141
558 5.000e-27gi|317048587|ref|YP_004116235.1| flagellar protein FliS [Pantoea sp. At-9b]  clstr ali  17  8.QAYAKIGVESAVMSASQKQLVVMLFDGALSALVRARLFLQDGNIEGKGLSLSKAINIINGLKQGLAEGDELTENLLGLYAYMVRRLLQANLRNDVEAIEEVEGLLRNIADAWKEVAQPQH.................................... 130
559 5.000e-27gi|124268049|ref|YP_001022053.1| flagellar protein [Methylibium petroleiphilum PM1]  clstr ali  18  18.QAYNLVGVETGIGGASPHQLVAMLFTGLLDAVARARGALRDGQIERKAHELSRAVRIVEELKGGLSPGGALTEQLSSLYSYVSTRLMQANLRNDDAALAECVSLIEPLRDAWSTIRAQSDVPAV................................ 143
560 5.000e-27JCVI_PEP_1096676562491 /source_dna_id=JCVI_ORF_1096676562490 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  24  34.........QTKADTADSHELVKLLFQGLTDRVAAARNALEREDRMERANCVTRAQKILFGLRQTLDFEGELARNLDSLYDYCTRRLTEGHAREDDTIFQEVHELMVQIRDAWNVMPVKGPS................................... 148
562 6.000e-27gi|157373196|ref|YP_001471796.1| flagellar protein FliS [Shewanella sediminis HAW-EB3]  clstr ali  17  9.NAYKQTSLDARAAAANPHEMVRMLLDGLLDEIERASGFMQRRSFEDKGKSINKCLNIVHGLGSMLDLEGEVASGLNRLYDYCSRQLVTASVENNTQALEPITKVISNVREGWANL......................................... 125
563 6.000e-27METAHIT MH0006 GL0190942 [Lack 3`-end] locus=scaffold20321_5:3:233:-  ali  64  1MDNELKQDLTRRLSQCNRGGLILVMYDIYFAYSDDAKKALEMGDDQAFKKGIENAQAGLDELIGALDFKYPITDQLF................................................................................ 77
564 7.000e-27gi|374996687|ref|YP_004972186.1| flagellar biosynthetic protein FliS [Desulfosporosinus orientis DSM 765]  clstr ali  15  4.KQYKEAYLESIVFTASPEKLTLMLYSHLVMLIRQAQAGLEEKDFIKSHNNIVKAKKLIINFENTLDRNYKIADDLLAVYEYLYKRLTEANLKKDWHILEEILSHALVLRDTWAEAVKIIKEQNKQ............................... 128
565 7.000e-27gi|340786160|ref|YP_004751625.1| flagellar biosynthesis protein [Collimonas fungivorans Ter331]  clstr ali  18  16.RAYARIGIESAVMSASPQQLLTMLFDGAKAAISMARHHMASGDVVAKGNAISKAVSIIDGLKASLDAEAELAANLSALYDYINQRLLYANLRNDPALLEEADRLLENIASAWREISDGSNGA.................................. 144
566 8.000e-27gi|95929893|ref|ZP_01312634.1| flagellar protein FliS [Desulfuromonas acetoxidans DSM 684]  clstr ali  16  1MNTYTQQYQQNQILTASPEQILIMLYDGAIRFTRQAMAGIEAGNKQQRREGISRAMAIVSEFANTLDHGGEIAENLDGLYAFMNRQLSEANLDEDIEKLKVVEHLLTDLRQTWSEAISIARKEAAGRTAAAQQ........................ 135
567 8.000e-27gi|296103619|ref|YP_003613765.1| Flagellar protein FliS [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  15  8.SAYTAVSLDSQITGATPHQLIVLLYDGAINAMKRAEIYFQSGNIARRGEMISRAINIIDGLRAGLDHEGKIAEELESLYDYISRTLLEANLNKSGEKLPHLIALMTGMAETWQAIAPQQKQ................................... 131
568 9.000e-27gi|375104674|ref|ZP_09750935.1| flagellar biosynthetic protein FliS [Burkholderiales bacterium JOSHI_001]  clstr ali  17  19...YRRVGVETALASASAHHMVTMLFDGLMETLAQARGAIETGNVAAKGQAIGRAVRIVEELKAGLDLKGRLAADLSDLYAYVELRLTQANLRSDLAALDECKRLIQPLRDAWASIGPQVDNG.................................. 141
569 9.000e-27gi|336424487|ref|ZP_08604524.1| flagellar protein FliS [Lachnospiraceae bacterium 3_1_57FAA_CT1]  clstr ali  18  1MQNPYEKYRQQSVMTMTQGDMISLLYSELGDRLGKGLICLENKDYEGCNTAFKKAQEILTHLTATLDRKYEVADKLAALYDFFKYQIIQSNIRKEAGPIEEILPMIKELQEVFVQADKQVRIEN................................. 124
570 1.000e-26gi|386852834|ref|YP_006270847.1| Flagellar protein fliS [Actinoplanes sp. SE50/110]  clstr ali  19  1MTAAHDRYLQDSINTASPARLLVMLYDRLILDLTQGEEALREGDRDAAHERITHAQEIVLELRVTLDLEWDGAPGLANLYGFILTELIGANIAKSPERVAGCRTLLEPLRDAWREAAVAAK.................................... 124
571 1.000e-26gi|107023993|ref|YP_622320.1| flagellar protein FliS [Burkholderia cenocepacia AU 1054]  clstr ali  13  10.SAYARVGVETGVMGASPHRLIAMLYQGARQAIALARMHLQQDNVSGRGEAIGKAIRIVEGLQASLNRDGEIAERLNALYAYIGRRLLEANAQASDAMLVEVDGLLATLEEAWTGIAPEVARMAAQQVAE........................... 141
572 1.000e-26gi|333901217|ref|YP_004475090.1| flagellar protein FliS [Pseudomonas fulva 12-X]  clstr ali  23  12..SYRAVDLHARAASASPYELVLQLFDGLLDELARARGHIQARRYQQKGQSLEKCLQILNGLNGALDHDGEVVQGLARLYDYCIYRISDVSVTLSLEGLDEVTGLLGVLREGWEGVNAK...................................... 130
574 1.000e-26gi|402700549|ref|ZP_10848528.1| flagellar protein FliS [Pseudomonas fragi A22]  clstr ali  13  7LRQYQKVNSHAQISEASPHRLIQMLMEGGLDRMAQAKGAMSRGDIPQKVVLITKAIDIITGLRQGMDEEDKVAQRQDSLYEYMTIRLTQANAQNDPEIIDEVARLLITVKSGWDEIAPQ...................................... 129
575 1.000e-26gi|117923404|ref|YP_864021.1| flagellar protein FliS [Magnetococcus marinus MC-1]  clstr ali  21  1MSYGLRSYKSSRANTASREDLLILLYEGAIRFLEKSLQAHTAGTLSEHKMMLQRAMAIISELQNTLDFEGDLAMQLFDLYNYMLDRLTKANINRDMSAISEVIEHLNVLLDGWRQAVAQVKRQGGMAA............................. 130
576 1.000e-26gi|253827536|ref|ZP_04870421.1| flagellar protein FliS [Helicobacter canadensis MIT 98-5491]  clstr ali  17  6...AYSSYQQNSVAVESPAKLVEMLYEGILRFASMAKRCIDANDIEKKIYYINRTTDIFVELLNSLDYEGQVAHYLTGLYTHQIKLLTQANMENSKEKIDIVIKVAKGLLEAWKEVNQNE..................................... 124
578 2.000e-26gi|403386670|ref|ZP_10928727.1| flagellar protein FliS [Clostridium sp. JC122]  clstr ali  15  6..NGYNAYKNNSINYASKEQLLLMLLDGAVKYAKIGRQAILDKDIKKKHENLVKTQDIFYELMISLDRSTQWIDGLSSVYEFINNRLMEANIKSDIKIMDEIIPLIEDIRSMWNDAYKIAAKQ.................................. 128
579 2.000e-26JCVI_PEP_1096682167543 /source_dna_id=JCVI_ORF_1096682167542 /offset=0 /translation_table=11 /length=144 /full_length=144  ali  14  7....ANQYKKTSIQTASRGQILILLYEAAIKNLKKAAQSIEQNDLSAKGQAIGKTHDIINELAVTLDFEGQIAQDLERLYHYMSGELIQANAQNSPEKLRNIQKLLETLLEGWRQAVAQTQN................................... 126
580 2.000e-26gi|170737025|ref|YP_001778285.1| flagellar protein FliS [Burkholderia cenocepacia MC0-3]  clstr ali  22  9..NYQTTNLASQAASASPVRLVIVLMDGLLDEMARARAHIEAGRYEEKGNSLNKCIGMLHGLTSALDFDSEVVVHLARLYEYCTVRLNEAGLTLDPRLIDEVSMLIRRLRAAWEGVDQ....................................... 126
582 2.000e-26gi|387894896|ref|YP_006325193.1| flagellar protein FliS [Pseudomonas fluorescens A506]  clstr ali  15  7LRQYQKVNAHAQVSEASPHRLVQMLMEGGLDRMAQAKGALSRGDIAQKGLMLGKAIEIISGLRDGLEPEKAAIQRLDALYNYMGNRLVEANRVNDVEMIDEVARLLITVKTGWDAIAPQ...................................... 129
584 3.000e-26gi|291276615|ref|YP_003516387.1| flagellar protein [Helicobacter mustelae 12198]  clstr ali  19  3MINAYNSYQQNSITIESPTKLIEMLYEGILRFSGLAQRSILSDDIEGKIYYINRITDIFTELLNALDYEGEVAVYLTGLYTYQIKLLTQANVENNTEKIGTVVNVTKGLLDAWKEIHAHE..................................... 124
585 3.000e-26gi|332140559|ref|YP_004426297.1| Flagellin-specific chaperone FliS [Alteromonas macleodii str. `Deep ecotype`]  clstr ali  14  8...YQREALKTRLASADPFEVTQMLMEGALESMKIAKINIQNNDLENKSKFIAKATSIIDSLRLSLNHNGELSSNLESLYVYMSDSLLESSINNDIAKIEEVVELLSDIKVAWDQIPERDRQSAFNQMQNK.......................... 137
586 3.000e-26gi|229591859|ref|YP_002873978.1| flagellar protein FliS [Pseudomonas fluorescens SBW25]  clstr ali  17  7LRQYQKVNSHAQISEASPHRLVQMLMEGGLDRMAQAKGALARGDIAAKGLMLGKAIDIVIGLRDGLDANPAYVQQLESLYAYMTNRLMEANVHNDAEMIDEVARLLITVKEGWDAIAAPQA.................................... 131
587 3.000e-26gi|312884819|ref|ZP_07744511.1| LafC [Vibrio caribbenthicus ATCC BAA-2122]  clstr ali  16  8.QSYQQVDLDAQAASASPHQLVIMLIDGLLDELERVRGHVTEKRLAEKGAGINRCMNILVGLDSALDIESEIAENLHQLYDFCQVELYRASISNDLAKLANVEQVMHNIREGWVNFGQHV..................................... 128
589 3.000e-26gi|87119662|ref|ZP_01075559.1| hypothetical protein MED121_06975 [Marinomonas sp. MED121]  clstr ali  20  8.QAYKKDSLKSDLAGADPHRIIQLLMQGALERLALAKGCIERRDLEGKANVLTRAIEIINALKDSLDRSYELADNLDALYDYMTFRITEASSKLDNSIIDEVMGLMLQIKGAWDQISELDKQEAY................................ 133
590 3.000e-26JCVI_PEP_1096691389575 /source_dna_id=JCVI_ORF_1096691389574 /offset=0 /translation_table=11 /length=147