current user: public




238922464
Query: gi|238922464|ref|YP_002935977.1| hypothetical protein (EUBREC_0038) [Eubacterium rectale ATCC 33656], from E.rectale

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# E-value Template Links and tools%idFirst MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDETDGIMKKLRSSFETVAAGDKSAPLMDNAQKVYAGMTYGKGRLTESFINDDNRGFLALast
1 3.000e-58gi|489440960|ref|WP_003346432.1| flagellar biosynthesis protein FliS [Bacillus methanolicus]  clstr ali  20  4.NNPYQSYQQNAVNTASPGELTLMLYNGCLKFIHLAKKAMEEKNIEDRNTNLLKAQKIIQELMVTLNMDIDISKQMMALYDYIHRRLIEANVKNDAAILDEVEGLVTEFRDTWKQVIQVNRQKQFAQGGQ........................... 132
2 2.000e-57gi|491030942|ref|WP_004892629.1| flagellar protein FliS [Anoxybacillus flavithermus]  clstr ali  23  3MNNPYQSYQTNAVQTASPGELTLMLYNGCLKFIAQAKKAIEEKDIEARNTNLLKAQKIIQELMVTLNMEYEVAKSMMTMYDYIYRRLVEANIKSDMSILEEVEGYVKEFRDTWKQVIQINRQRQYAQGGQA.......................... 133
3 3.000e-57METAHIT MH0086 GL0028201 [Complete] locus=scaffold30167_3:1382:1858:-  ali  31  1MTDEKKQQYTLKISQASRTQLVVILYEMTLDYLKEAEDAAGSRDEAAFHTGIKRARACIHELSHSLNHEYPVSGNLLQLYLFADRTLIQADARQDAALLKEPEDMVRKLKDAYETISEQDDSGAVMENTQAVYAGLTYGRGALNESLADQSSRGFRV 158
4 3.000e-57T2D.1498414 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  31  1MTDEKKQQYTLKISQASRTQLVVILYEMTLDYLKEAEDAAGSRDEAAFHTGIKRARACIHELSHSLNHEYPVSGNLLQLYLFADRTLIQADARQDAALLKEPEDMVRKLKDAYETISEQDDSGAVMENTQAVYAGLTYGRGALNESLADQSSRGFRV 158
5 5.000e-57JGI.Meta JGI_HUM.0536712 7058499573 C3979308__gene_350524 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  30  1MTDEKKQQYTLKISQASRTQLVVILYEMTLDYLKEAEDAAGSRDEAAFHTGIKRARACIHELSHSLNHEYPVSGNLLQLYLFADRTLIQADARKDAALLKEPEDMVRKLKDAYETISEQDDFGAVMENTQAVYAGLTYGRGALNESLADQSSRGFRV 158
6 8.000e-57gi|515282954|ref|WP_016838008.1| hypothetical protein [Ureibacillus thermosphaericus]  clstr ali  22  5.NNAYNAYKQNSINTASPGELTLMLYNGCIKFLNLARKAIEEKHIEEKNTNLQKAQNIINELIVTLNMDYEISKQILPLYEYMNRRLIEANIKNDVEIVDEVIGLVTEFRDTWKEVIKLNR.................................... 124
7 9.000e-57gi|651950964|ref|WP_026679172.1| flagellar biosynthesis protein FliS [Fictibacillus gelatini]  clstr ali  20  5..NPYQQYQTNSVQTASPGELTLMLYNGCLKFIGLAKAAIKANHIEEKNTNCLKAQKIIQELMVTLDMDIEISKSLMQMYDYFHRRLIEANVKSDIEILEEVEGYVTEFRDTWKEVIQINRRQQYGEGG............................ 131
8 1.000e-56gi|500218056|ref|WP_011888199.1| flagellar biosynthesis protein FliS [Geobacillus thermodenitrificans]  clstr ali  22  3MNNPYQQYQTNAVQTASPGELTLMLYNGCLKFIKLARQAIETGDVTARNENLIKAQNIILELMKTLKMEYEVAKSMMTMYDYIYRRLIEANVKHDAAILDEVEGYVTEFRDTWKQVIQLNRQRQYAEGGQA.......................... 133
9 2.000e-56gi|547949301|ref|WP_022350170.1| putative uncharacterized protein [Firmicutes bacterium CAG:534]  clstr ali  37  1MTKELKQQFTLRISQANKSQLVVILYEMMITYLDEAKEAYDRQDRAGFREGIRKSRGCLMELMSSLHFEYEVASNLLSLYLYANRELARADIRNSVTELVHVKAIMSKLHDAYEKVGEQDTSGPIMENTQTVYAGLTYGKNTLTENLYDQSNRGFR. 157
10 2.000e-56METAHIT MH0065 GL0140622 [Complete] locus=scaffold28231_14:1806:2282:-  ali  37  1MTKELKQQFTLRISQANKSQLVVILYEMMITYLDEAKEAYDRQDRAGFREGIRKSRGCLMELMSSLHFEYEVASNLLSLYLYANRELARADIRNSVTELVHVKAIMSKLHDAYEKVGEQDTSGPIMENTQTVYAGLTYGKNTLTENLYDQSNRGFR. 157
11 2.000e-56T2D.1099948 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  37  1MTKELKQQFTLRISQANKSQLVVILYEMMITYLDEAKEAYDRQDRAGFREGIRKSRGCLMELMSSLHFEYEVASNLLSLYLYANRELARADIRNSVTELVHVKAIMSKLHDAYEKVGEQDTSGPIMENTQTVYAGLTYGKNTLTENLYDQSNRGFR. 157
12 2.000e-56gi|653220944|ref|WP_027433501.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium MD2004]  clstr ali  21  1MTNPYAVYQKNKIMTASPAELTLMLYDGAIKFCNIALAGIEEKDIEKAHINIRKANNIIDELQSTLNHKYPVAKDFENVYEYIRDCLIEANIKKDPEVLNEALGHIRTMRDTWKEVMKANK-----VGTGGVVAG...................... 132
13 2.000e-56gi|550997418|ref|WP_022742127.1| hypothetical protein [Lachnospiraceae bacterium 10-1]  clstr ali  36  5MTKELKQQYTLKITQANKTQLVVILYEMFLIYVEEAKCAHEKEDRKGFREGIRKSRGCLKELMASLHFEYEPAMNLLQLYLYVNRELARADIHNDTKELDHVKAVMTKLHEAYQKVSEQDTSQPVMVNTQTVYAGLTYGKHTLTENLSDQSSRGFRA 162
14 2.000e-56gi|496690420|ref|WP_009331963.1| flagellar biosynthesis protein FliS [Bacillus sp. 2_A_57_CT2]  clstr ali  18  5..NPYQSYQQNSVNTASPGELTLMLYNGCLKFIHQAKKAIMDNNIEAKNTNIQKAQNIIQELMVTLNMDVEVSQNMMSLYDYMNRRLIEANVKSETGILDEVEGLVTEFRDTWKEVIQVNRQKQFSQGG............................ 131
15 3.000e-56gi|490574689|ref|WP_004439709.1| flagellar biosynthesis protein FliS [Bacillus smithii]  clstr ali  18  4.NNPYQAYEKNAVSTASPGELTLMLYNGCLKFLLQAKKAIEDKNFEKKNTYIQKAQNIIRELMVTLNMDVELSKNLMAVYDYMNRRLIQANVKNDLEILDEVMEFITELRDTWKQAIQEQRKQQYGTGG............................ 131
16 3.000e-56gi|651982465|ref|WP_026694357.1| flagellar biosynthesis protein FliS [Bacillus kribbensis]  clstr ali  20  3LQNPYQAYQNNSVNTASPGELTLMLYNGCIKFIHQAKVAMENRQIEFKNINLQKAQNIIQELMVTLDMKLEVSKNMMSLYDYMNRRLIEANIKNDTSILDEIEALVTEFRDTWKQVIQVNRQKQFSQGG............................ 131
17 4.000e-56gi|493357133|ref|WP_006313683.1| Flagellar biosynthesis protein FliS [Clostridiaceae bacterium L21-TH-D2]  clstr ali  21  3MKNPYSQYQQNSVMTASPEELTLMLYNGAVKFIKQGKVFLEQKDMEKAHNSIVRAQDIISELNITLNMDYEISKNLRSLYTFILERLMDANIKKDIKILDEVLPLVEELRDTWKEAMQLAKK................................... 124
18 5.000e-56gi|560301544|ref|WP_023613774.1| flagellar biosynthesis protein FliS [Bacillus sp. 17376]  clstr ali  17  3LNNPYQSYQQSSVNTASPGELTLMLYNGCLKFINLAKHGIQSKDIQAKNLNIQKAQNIVQELMVTLNMDLEVSQNMMSLYDFMNRRLIDANIKNDLQALEEVEGLVTEFRDTWKQVIQLNRQKQHSQGG............................ 131
19 2.000e-55gi|547661564|ref|WP_022124280.1| putative uncharacterized protein [Clostridium sp. CAG:510]  clstr ali  21  5..NAYAQYSNNKVLTASPAELVLMLYDGAIKFCNIAVVAIDAKDIPKAHTNIIKAQKIIDHLRITLDMSYPVAQDFDNIYAYVAKRLVEANVSKDKEILEEVCTHLRSVRDTWKEVMRINH.................................... 123
20 2.000e-55METAHIT MH0012 GL0273163 [Complete] locus=scaffold121426_1:900:1286:-  ali  21  5..NAYAQYSNNKVLTASPAELVLMLYDGAIKFCNIAVVAIDAKDIPKAHTNIIKAQKIIDHLRITLDMSYPVAQDFDNIYAYVAKRLVEANVSKDKEILEEVCTHLRSVRDTWKEVMRINH.................................... 123
21 2.000e-55T2D.295928 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5..NAYAQYSNNKVLTASPAELVLMLYDGAIKFCNIAVVAIDAKDIPKAHTNIIKAQKIIDHLRITLDMSYPVAQDFDNIYAYVAKRLVEANVSKDKEILEEVCTHLRSVRDTWKEVMRINH.................................... 123
22 2.000e-55gi|497987992|ref|WP_010302148.1| flagellar biosynthesis protein FliS [Kurthia sp. JC8E]  clstr ali  23  4.QNAYNAYKQNSITTASPGELTLMLYNGCIKFIHQARKAIELQDIQNRNKYVQKAQAIISELMITLNMDIPVSQNMFGLYEYMNRQLTQANIKNDVSILDEVEGLVVEFRDTWKQVIQKNRQQQFSGN............................. 130
23 2.000e-55gi|497972689|ref|WP_010286845.1| flagellar biosynthesis protein FliS [Kurthia massiliensis]  clstr ali  21  4.QNAYNAYKQNSVNTASPGELTLMLYNGCIKFIHQAKKSIEAKDIPNRNKYIQKAQAILNELMSTLNMDIPVSQNMFNLYEYMYHQLTQANIKNDVAILDEVEGMAVEFRDTWKQVIQMNRQKQH................................ 127
24 4.000e-55JGI.Meta JGI_HUM.2862010 7007522715 C2611115__gene_247700 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 764588959]  ali  36  1MKQEQIKDFTRRISQCNKGSMIVIIYDIVFAYIEDAKQSYAAGDHEGFKNALRKAQRAVDELIHALNFQYEVSKNLYSLYVFSKETMAKAIVKNSTDELEDVLAVLKDLYEAFMEASKQDHSLPLMQNTQQVYAGMTYGKNDLTETFVPETSRGFFA 158
25 4.000e-55gi|516366389|ref|WP_017756422.1| hypothetical protein [Bacillus sp. ZYK]  clstr ali  17  3MRNPYQTYKQNSVETASPGELTLMLFNGCLKFIKQAKQDIDNQNIEGKHTNIIKAENIIHELMVTLNMDIPVAKDMLKMYDYMNRRLVEANITNDISILDEVEVYATEFRDTWKEVIQQVRQQKYQGG............................. 130
26 6.000e-55gi|547951155|ref|WP_022351963.1| putative uncharacterized protein [Firmicutes bacterium CAG:534]  clstr ali  19  5..NAYAQYKNSKVLTASPAELTLMLYEGAIKFCNIAIAAIEQKEVEKAHVNIRKAQKIIEHLRVTLDMKYPVAKDFDNMYQYIDRRLLEANISKDPEILKEVLTHLHAIRDTWKEVMRINREKGV................................ 127
27 6.000e-55METAHIT MH0065 GL0092410 [Complete] locus=scaffold16455_13:1015:1404:-  ali  19  5..NAYAQYKNSKVLTASPAELTLMLYEGAIKFCNIAIAAIEQKEVEKAHVNIRKAQKIIEHLRVTLDMKYPVAKDFDNMYQYIDRRLLEANISKDPEILKEVLTHLHAIRDTWKEVMRINREKGV................................ 127
28 6.000e-55T2D.1095642 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  5..NAYAQYKNSKVLTASPAELTLMLYEGAIKFCNIAIAAIEQKEVEKAHVNIRKAQKIIEHLRVTLDMKYPVAKDFDNMYQYIDRRLLEANISKDPEILKEVLTHLHAIRDTWKEVMRINREKGV................................ 127
29 7.000e-55gi|489425044|ref|WP_003330726.1| flagellar protein FliS [Bacillus azotoformans]  clstr ali  20  4..NPYQTYQNNAVNTASPGDLTLMLYNGCLKFIKQAKIAIENKDVETKHMNLVKAQNIITELMVTLNTDYEVGKNMMQMYDYMKRRLIEANTKSDIAILNEVEGYVAEFRDTWKEVIRISRQQKYAVGGQ........................... 131
30 8.000e-55gi|498362738|ref|WP_010676894.1| flagellar biosynthesis protein FliS [Bacillus timonensis]  clstr ali  18  5..NPYQTYQDNSVFTATPGELTLMLYNGCLKFMGQAKKSIQEKNIETKHINISKAQNIISELMVTLNMDYEISKEMRRLYDFINRRLIEANIKNDVKLLEEAEDLVIEFRDTWKEVIRLNRAKQFKTGG............................ 131
31 1.000e-54gi|510831439|ref|WP_016203467.1| flagellar protein FliS [Bacillus nealsonii]  clstr ali  17  5..NPYQSYQQNSVNTASAGDLTLMLYNGCLKFLHLAKKAIEDKDIPTRNTNIQKSQNIIKELMVTLNMDIPVSQNLMTLYDYMNRQLIKANIGNNIAIIEEVESLVTEFRDTWKEAIVLNRQKQHGQGGQA.......................... 133
32 1.000e-54gi|495454122|ref|WP_008178816.1| flagellar biosynthesis protein FliS [Bacillus sp. B14905]  clstr ali  20  7...AQNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQAIQEKNIQEKNTNLIKAQAIISELMATLNMDIEISKQMLPLYEYMNHRLVEANIQNDVAVIEEVEGLVTEFRDTWKEVIRINRQQQFGQG............................. 131
33 1.000e-54gi|511039244|ref|WP_016293259.1| flagellar protein FliS [Lachnospiraceae bacterium 28-4]  clstr ali  31  1MTRELKQEYTRKITQANKTQLITILYEMLLIYVEEAADAHEKEDRGGFREGIRKARGCIDELLASLNFDYELAMNFLQLYLYVNRELVRAEVRNAEEPLGNVNKVIKGLHEAYAKLDEMDTSGPVMENVQTVYAGLTYGRNNLNENLADQGNRGFRV 158
34 2.000e-54METAHIT MH0024 GL0032743 [Lack 5`-end] locus=C4180776_1:2:376:+  ali  20  2..NAYNQYNNSKILTASPAELVLMLYDGAIKFCNIAVAAIEAKDVPKAHTNIVKAQKIIDHLRMTLNMSYPVAQDFENIYSYLGQRLVEANVSKDPEILKEVCTHLHSVRDTWKEVMKTGQGGA................................. 123
35 2.000e-54gi|573589651|gb|ETT87858.1| flagellar protein [Viridibacillus arenosi FSL R5-213]  clstr ali  23  4.QSAHQAYKQNSVTTASPGELTLMLYNGCIKFLHKGKLAIGSKDVEAKNTNLLKAQAIISELMSTLNMDIEISKQMLNLYEYMNRRLVEANIQNDVAIIDEVEGYVVEFRDTWKEVIRLNRQQQFTGN............................. 130
36 2.000e-54gi|653071330|ref|WP_027322495.1| flagellar biosynthesis protein FliS [Bacillus sp. URHB0009]  clstr ali  18  4.QNPYQSYQQNSVNTASPGELTLMLYNGCLKFVHQAKKAIEDKNIEARNINIQKASKIITELMVTLNQELEITKQILPLYDFMNRRLIEANLKNDLTALSEVEDLLVDFRDTWKQVIQLNRQKQFAKGGQA.......................... 133
37 3.000e-54gi|651563021|ref|WP_026570964.1| MULTISPECIES: flagellar biosynthesis protein FliS [Bacillaceae]  clstr ali  19  3MQQQYQAYKNNSVTTASPGELTLMLYNGCLKFTKQAVKDIEAGNHELKNINIQKAQKIIQELMVTLDQKAEISKEILPIYDYINRRLMEANINNDKEILEEVMGLVEEFRDTWKEVIKLNRQKQYGRGAQA.......................... 133
38 4.000e-54gi|497882827|ref|WP_010196983.1| flagellar biosynthesis protein FliS [Bacillus sp. m3-13]  clstr ali  22  3MKNPYQAYQQNSVNTATPGELTLMLYNGAIKFMKLAKKGMEDKDIEMKNTNLIKAQKIVQELMVTLDTSHDVGKSMMTMYDYMNRRLIDANLKNDSSIVDEVEGLMMEFRDAWKQVIQANRQQAFAQGGKA.......................... 133
39 5.000e-54gi|493891546|ref|WP_006837550.1| flagellar biosynthesis protein FliS [Bacillus sp. SG-1]  clstr ali  19  4.KNPYKTYQNNTVNTASPGELTLMLYNGCLKFIQLAKRGIEEKNIEQKNLNIQKAQNIVSELMVTLNMDVEVSKNIMSLYEFIHRRLVEANIKNDLNALNEAEALIVDFRDTWKQVIQLDRQQKFEGKAGQV......................... 134
40 8.000e-54T2D.4084169 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  5..NAYNQYNNSKILTASPAELVLMLYDGAIKFCNIAVAAIEAKDVPKAHTNIVKAQKIIDHLRMTLNMSYPVAQDFENIYSYLGQRLIEANVSKDPEILKEVCTHLHSVRDTWKEVMKTGQGGA................................. 126
41 9.000e-54gi|491790494|ref|WP_005601298.1| MULTISPECIES: flagellar biosynthesis protein FliS [Butyrivibrio]  clstr ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
42 9.000e-54METAHIT MH0025 GL0039200 [Complete] locus=scaffold11566_6:1435:1812:-  ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
43 9.000e-54T2D.468067 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
44 9.000e-54JGI.Meta JGI_HUM.0339000 7048770290 SRS011134_Baylor_scaffold_5282__gene_6287 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
45 1.000e-53gi|651593957|ref|WP_026588929.1| flagellar biosynthesis protein FliS [Bacillus sp. NSP9.1]  clstr ali  16  4.NNPYAAYQQNSVNTASPGELTLMLYNGCLKFIKKAQQGIEQGDMEMKNENLVKAQNIIRELNITLDRSIEIGESMAAMYEYIYRRLVDANIHNDLDILREAEGYVIEFRDTWKEVMQIERQGRHGSGGQA.......................... 133
46 1.000e-53gi|504637535|ref|WP_014824637.1| flagellar biosynthesis protein FliS [Solibacillus silvestris]  clstr ali  20  5.TNAFNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQSIADKNIEERNHYIQRSQAIIGELMATLNMDIGISKQMLPLYEYMSRRLTEANIQNDSSIIEEVEGLVTEFRDTWKEVIKITRQQQYGTAGQ........................... 133
47 1.000e-53gi|547653991|ref|WP_022122449.1| flagellar protein FliS2 [Clostridium sp. CAG:510]  clstr ali  33  1MTKECKQQFTLRITQANKTELIVILYEMLLAYTQDAKISLQEGNTEAFRDNIRKADNCLTELTESLDLSYEIGRRLLSLYMFCKKELLKADVRKKEEFVLHVEAVITRLRDAYREVAAQDESTPVMENSQEIYAGLTYGRDSLTENMAESTNRGFRA 158
48 1.000e-53gi|647281956|ref|WP_025727184.1| flagellar biosynthesis protein FliS [Bacillus ginsengihumi]  clstr ali  17  4.KNPYQAYQNNSVTTASPGELTLMLYNGCLKFIHLAKQAIEQNNIEEKHKNLIKAQNIIRELMVTLEPKFDGAENMMRLYDFMLQELIAANLKNDIKKLNDVEELVTGFRDTWKEVIQLNRKQSYAQGGKA.......................... 133
49 2.000e-53gi|548309877|ref|WP_022500410.1| putative flagellar protein FliS [Firmicutes bacterium CAG:95]  clstr ali  34  1MTKEMKQNYTLRISQANKSELVVIVYEMLLTYIEDAKAAHANGDTEGFAVSIRRAEGCIRELMASLHMDYVLAGNLLSLYVYAVKLLSKAKLHNSTKELAEVEKMMRKLHDAYATVSKEDTSGSVMENTQTVYAGLTYGKNQLMESLGNEGSRGLRV 158
50 2.000e-53METAHIT MH0012 GL0055868 [Complete] locus=scaffold40595_4:7129:7605:+  ali  34  1MTKEMKQNYTLRISQANKSELVVIVYEMLLTYIEDAKAAHANGDTEGFAVSIRRAEGCIRELMASLHMDYVLAGNLLSLYVYAVKLLSKAKLHNSTKELAEVEKMMRKLHDAYATVSKEDTSGSVMENTQTVYAGLTYGKNQLMESLGNEGSRGLRV 158
51 2.000e-53T2D.3280576 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  34  1MTKEMKQNYTLRISQANKSELVVIVYEMLLTYIEDAKAAHANGDTEGFAVSIRRAEGCIRELMASLHMDYVLAGNLLSLYVYAVKLLSKAKLHNSTKELAEVEKMMRKLHDAYATVSKEDTSGSVMENTQTVYAGLTYGKNQLMESLGNEGSRGLRV 158
52 2.000e-53JGI.Meta JGI_HUM.0422926 7049113083 C5187368__gene_349080 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158499257]  ali  34  1MTKEMKQNYTLRISQANKSELVVIVYEMLLTYIEDAKAAHANGDTEGFAVSIRRAEGCIRELMASLHMDYVLAGNLLSLYVYAVKLLSKAKLHNSTKELAEVEKMMRKLHDAYATVSKEDTSGSVMENTQTVYAGLTYGKNQLMESLGNEGSRGLRV 158
53 2.000e-53gi|547903133|ref|WP_022306604.1| flagellar protein FliS [Roseburia sp. CAG:380]  clstr ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
54 2.000e-53METAHIT MH0065 GL0128576 [Complete] locus=scaffold83316_12:323:703:+  ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
55 2.000e-53T2D.1113051 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
56 2.000e-53JGI.Meta JGI_HUM.0524696 7058468292 C3932717__gene_319243 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
57 2.000e-53gi|547465971|ref|WP_022084988.1| putative uncharacterized protein [Roseburia sp. CAG:197]  clstr ali  43  1MKNELKQDFTRRLSQCNAGEMIVIIYDILFAYLDDVKEAHEEDSHEQMKVAIRRAQNVLDELIHSLNFAYPLSKNLHSLYVFCKNQLARTMYENRLDGLMEAEKILRRLYGSFVEVARQDTSEPLMRNTQQVYAGMTYGRASLNENYMDDDQRGFFV 157
58 2.000e-53METAHIT MH0055 GL0088621 [Complete] locus=scaffold10881_9:605:1078:-  ali  43  1MKNELKQDFTRRLSQCNAGEMIVIIYDILFAYLDDVKEAHEEDSHEQMKVAIRRAQNVLDELIHSLNFAYPLSKNLHSLYVFCKNQLARTMYENRLDGLMEAEKILRRLYGSFVEVARQDTSEPLMRNTQQVYAGMTYGRASLNENYMDDDQRGFFV 157
59 2.000e-53T2D.924641 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  43  1MKNELKQDFTRRLSQCNAGEMIVIIYDILFAYLDDVKEAHEEDSHEQMKVAIRRAQNVLDELIHSLNFAYPLSKNLHSLYVFCKNQLARTMYENRLDGLMEAEKILRRLYGSFVEVARQDTSEPLMRNTQQVYAGMTYGRASLNENYMDDDQRGFFV 157
60 3.000e-53gi|501764389|ref|WP_012634560.1| flagellar biosynthesis protein FliS [Clostridium cellulolyticum]  clstr ali  21  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDDKNIEKANNSIIRAQDIILEFQVTLDMKYEVSNNLYSIYDYMHRRLVQANIKKDKDILEEVLGMAKELRDTWTQAMKIAKR................................... 124
61 3.000e-53gi|645063480|ref|WP_025434688.1| flagellar biosynthesis protein FliS [Eubacterium acidaminophilum]  clstr ali  18  3MANPYAKYQEQSVFTATPEELTLMLYDGCIKFINRAAIGIEDKNIEMTNTNIIKAQNIVRELNITLNMDYEVSKGLRPLYDYMHTRLIDANIKKDKEALEEVKGLVTDMRDTWKEAMKLAR.................................... 123
62 3.000e-53JGI.Meta JGI_HUM.1178964 7037836216 SRS014923_WUGC_scaffold_14075__gene_19967 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYRYLQERLVEANMKKDKEILEEVLAHLRTMRDTWKEVMKLAHSK.................................. 125
63 3.000e-53gi|498017899|ref|WP_010332055.1| flagellar biosynthesis protein FliS [Bacillus mojavensis]  clstr ali  18  4.QNPYAAYQQSSVNTATPGELTLMLYNGCLKFIKLACQAIENNDIERKNENLIKAQNIIQELNGTLNRNIELSGSMGAMYDYIYRRLVEANIKSDKSILEEVEGYVTDFRDAWKQAIQIERKDRHGSGG............................ 131
64 3.000e-53gi|494767821|ref|WP_007503229.1| flagellar biosynthesis protein FliS [Caldalkalibacillus thermarum]  clstr ali  17  5..NPYQTYKHNAVQTASPGELTLMLYNGCLNFIKQARQAIEEDNIQERNKYMQKAQDIIRELMVTLNTDYAVAKDMLRMYDYILRRLIEANINNDTAILDEVETYVSQFRDTWKEVLRLNRQKQYGGGVP........................... 132
65 4.000e-53gi|547326947|ref|WP_022057915.1| flagellar protein FliS [Clostridium sp. CAG:167]  clstr ali  19  1MNQDTNAYQRNAILTASPAELTLMLYDGAIKFCNIAIIGIEKKDMEKAHVNLKKAQDIITELRVTLDHKYPVWEDFDRVYDYIYRRLVEANMSKDIAVVEDALKYIREMRDTWKEVMKAAPAGSKQ............................... 127
66 4.000e-53METAHIT V1 GL0106872 [Complete] locus=scaffold3159_5:29272:29661:+  ali  19  1MNQDTNAYQRNAILTASPAELTLMLYDGAIKFCNIAIIGIEKKDMEKAHVNLKKAQDIITELRVTLDHKYPVWEDFDRVYDYIYRRLVEANMSKDIAVVEDALKYIREMRDTWKEVMKAAPAGSKQ............................... 127
67 4.000e-53T2D.2139822 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  1MNQDTNAYQRNAILTASPAELTLMLYDGAIKFCNIAIIGIEKKDMEKAHVNLKKAQDIITELRVTLDHKYPVWEDFDRVYDYIYRRLVEANMSKDIAVVEDALKYIREMRDTWKEVMKAAPAGSKQ............................... 127
68 4.000e-53JGI.Meta JGI_HUM.2274931 7052116898 C3544885__gene_228959 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 765074482 replicate  ali  19  1MNQDTNAYQRNAILTASPAELTLMLYDGAIKFCNIAIIGIEKKDMEKAHVNLKKAQDIITELRVTLDHKYPVWEDFDRVYDYIYRRLVEANMSKDIAVVEDALKYIREMRDTWKEVMKAAPAGSKQ............................... 127
69 5.000e-53METAHIT MH0058 GL0104049 [Complete] locus=scaffold52939_7:1854:2234:-  ali  21  5.NKAAQLYQKNSIETASPARLTLMLYDGAIKFSHIAIEAIEEGNIEKAHKNIVKVQNIIVEFRSTLDMKYPVAKDFDNVYDYIYRRLVEANMKKDKEIMEEALEHIKTMRDTWKEVMELNH.................................... 124
70 5.000e-53T2D.976004 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5.NKAAQLYQKNSIETASPARLTLMLYDGAIKFSHIAIEAIEEGNIEKAHKNIVKVQNIIVEFRSTLDMKYPVAKDFDNVYDYIYRRLVEANMKKDKEIMEEALEHIKTMRDTWKEVMELNH.................................... 124
71 7.000e-53gi|547834492|ref|WP_022242367.1| putative uncharacterized protein [Roseburia sp. CAG:45]  clstr ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYKYLQERLVEANMKKDKEILEEVLVHLRTMRDTWKEVMKLAHSK.................................. 125
72 7.000e-53METAHIT MH0025 GL0024356 [Complete] locus=scaffold10184_5:14254:14631:+  ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYKYLQERLVEANMKKDKEILEEVLVHLRTMRDTWKEVMKLAHSK.................................. 125
73 7.000e-53T2D.467212 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYKYLQERLVEANMKKDKEILEEVLVHLRTMRDTWKEVMKLAHSK.................................. 125
74 8.000e-53gi|498317742|ref|WP_010631898.1| flagellar biosynthesis protein FliS [Sporolactobacillus vineae]  clstr ali  21  3.NNAYKVYQQNSVLTATPGELTLLLFNGCLKFIRQGRGAILNKNYEQKNKVIQKAQAIITELMVSLDSKQPVAKDMMSLYDYIHRRLIEANVKNDITILDEVEKLVADFRDTWKQVIIINRKEQGKNHS............................ 130
75 9.000e-53gi|653188185|ref|WP_027424507.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AC3007]  clstr ali  21  6...AYQQYKNSKVLTASPAELTLMLYDGCIKFCNMGVMAINGKDYAAANKNIQKAERIIGEFKMTLDHKYEVAKDFDNIYDYVLRRLHEANMHKDTEILNECITHMRSLRDTWKEVMKQAGQPAMPEAAQA.......................... 133
76 1.000e-52gi|516041931|ref|WP_017472514.1| flagellar biosynthesis protein FliS [Amphibacillus jilinensis]  clstr ali  18  3.QQHYQAYKNNSVNTASPGELTLMLYNGCLKFIKYAKKGIEQGDIQLKNTNIQKAQNIINELMVTLDQGAPIAKEMLPLYDYVNHCLIQANIKNDLESLMEANRVVEEFRDTWKEVLKQTRTQQYTQGAKA.......................... 132
77 1.000e-52gi|651519241|ref|WP_026559724.1| flagellar biosynthesis protein FliS [Bacillus sp. J37]  clstr ali  15  4.NNPYQAYQQNSVGTASPGELTLMLYNGCLKFIKQASKAIEDSNIEDKNTNIQKANKIISELMLTLNMDLEISKEMQVMYDYMSYRLIEANTKNDVEILEEVEGYVVDFRDTWKQVIQTSRQQQFGMGGHA.......................... 133
78 1.000e-52gi|495392851|ref|WP_008117552.1| MULTISPECIES: flagellar biosynthesis protein FliS [Bacteria]  clstr ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
79 1.000e-52METAHIT V1 GL0038541 [Complete] locus=scaffold99329_1:608:1000:-  ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
80 1.000e-52T2D.1982227 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
81 1.000e-52JGI.Meta JGI_HUM.0242200 7004266893 C4260648__gene_337822 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160400887]  ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
82 1.000e-52gi|652403152|ref|WP_026798929.1| flagellar biosynthesis protein FliS [Pontibacillus halophilus]  clstr ali  20  4.....QAYQSNSVQTASPGELTLMLYNGCLKFIKLARKAIESNQFEAKNTNIQKARNIVQELMVTMNQDYEISKEIMPLYDYMNRRLMEANINNDVNILDEVEGLATEFRDTWKEVVKQTRMEKFGQGGQA.......................... 129
83 1.000e-52gi|547901491|ref|WP_022305039.1| putative uncharacterized protein [Roseburia sp. CAG:380]  clstr ali  32  1MDSEKRKAYTTRISQANRSELVVIIYELLLDSLADARQAFGKEDFDTADVELKRAQGLVCELRGSLNFEYPVSYRLVSLYRYINEQLVKSITRKKDVNLDSCERVISSLKDSFEEVSKQDTSGPVIENGQQVYAGLTYGKGSLNEVAIDAGGRGFQA 159
84 2.000e-52gi|521288835|ref|WP_020453103.1| MULTISPECIES: flagellar assembly protein FliS [Bacillus]  clstr ali  22  3LNNPYAAYQQNSINTATPGELTLMLFDGCLKFMKLAKQAIEQEDMETKNTNLVKAQKIIQELNITLDRKVELAASMGAMYEYIHRRLVEANIRNDKDIVTEVEGYVKDLRDAWKQALQIERQGRFGSGG............................ 131
85 2.000e-52gi|652833144|ref|WP_027116886.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium P6B14]  clstr ali  18  3.QNRMSDYQRNAILTATPAELTLMLYEGAIKFCNLAKMAIEKKDIQKAHENIKRAQDIITEFRVTLDRKYPVWEDFERVYDYIYRKLVEANIHKDLEPLEEALKYIREMRDTWKEVMKLAR.................................... 122
86 2.000e-52METAHIT MH0065 GL0033625 [Complete] locus=scaffold1269_1:938:1423:-  ali  32  3MDSEKRKAYTTRISQANRSELVVIIYELLLDSLADARQAFGKEDFDTADVELKRAQGLVCELRGSLNFEYPVSYRLVSLYRYINEQLVKSITRKKDVNLDSCERVISSLKDSFEEVSKQDTSGPVIENGQQVYAGLTYGKGSLNEVAIDAGGRGFQA 161
87 2.000e-52T2D.1087845 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  32  3MDSEKRKAYTTRISQANRSELVVIIYELLLDSLADARQAFGKEDFDTADVELKRAQGLVCELRGSLNFEYPVSYRLVSLYRYINEQLVKSITRKKDVNLDSCERVISSLKDSFEEVSKQDTSGPVIENGQQVYAGLTYGKGSLNEVAIDAGGRGFQA 161
88 3.000e-52gi|517536148|ref|WP_018706356.1| hypothetical protein [Bacillus fordii]  clstr ali  20  5..NPYEAYQNNSVTTASPGELTLMLYNGCLKFINLAKHAIENKEIENRNTNIQKAQNIVSELMLTLNMDVEISKNMRSLYEYSNRRLMEANFKQDISILEEVEEIMTEFRDAWKQVIQLNRQ................................... 124
89 4.000e-52JGI.Meta JGI_HUM.0784139 7018899601 SRS022609_Baylor_scaffold_74868__gene_126343 flagellar protein fliS [Human Stool microbiome from visit number 2 of subje  ali  19  5..NAYAQYNNSKVLTATPAELTLMLYEGAIKFCNIAIVAVEKKDIEKANNNIIKTERIIDYFRQTLDTKYPVAEDFDRVYEYIGRRLVEANLKKDKEILEEVAEHLRSMRDTWKEVMQVNREK.................................. 125
90 6.000e-52gi|504270700|ref|WP_014457802.1| flagellar biosynthesis protein FliS [Bacillus megaterium]  clstr ali  16  4.NNPYQAYQQGAVQTASPGELTLMLYNGCLKFIKLARTGIEEKNIELKNTNLLKAQNIIQELMITLDTNVQVAKSMMAMYDYINQCLIEANTKNDTASLDEAEQYVTEFRDTWKQVVQLHRQQVHGSGGQA.......................... 133
91 6.000e-52gi|505328762|ref|WP_015515864.1| MULTISPECIES: flagellar biosynthetic protein FliS [Eubacterium]  clstr ali  18  4.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQATCNG.................................. 125
92 6.000e-52METAHIT MH0016 GL0053400 [Complete] locus=scaffold45848_4:460:855:+  ali  18  4.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQATCNG.................................. 125
93 6.000e-52T2D.2603643 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQATCNG.................................. 125
94 6.000e-52gi|550174396|ref|WP_022588181.1| flagellar biosynthesis protein FliS [Caldanaerobacter subterraneus]  clstr ali  29  8..NPYQQYKENAILTASPEELVLMLYNGIIRFIDEAKTALQKKDYVETNAKIQRAQDIITELMLTLDMNYDISKNLYNLYDYILRRLIDANVKKDIEILDEVRGFVVELRDTW--------SLALQKVREKVYA....................... 131
95 6.000e-52gi|640599713|ref|WP_025028345.1| flagellar biosynthesis protein FliS [Bacillus mannanilyticus]  clstr ali  16  4.NNPYQAYQQNAMNTASPGELTLMLYNGCLKFIKQAKLDIEKKNIEAKNTNIIKAQNIIRELMVTLNMDVEISEQLMQMYDYLLNRLIEANLRNNIDILKEVEGFVTEFRDTWKEALQINRRMQHGQG............................. 130
96 7.000e-52JGI.Meta JGI_HUM.4707565 7025558325 C3976441__gene_155075 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 604812005]  ali  18  5.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQATCNG.................................. 126
97 9.000e-52gi|583922847|gb|EWG11506.1| flagellar protein FliS [Bacillus firmus DS1]  clstr ali  17  5..NPYKKYKENTVTQASPAELTLMLYNGALKFIKLAKQGIEEQNIELKNTNIQKTQSIIQELMVTLNTDVEISNNLMRMYDFMFRQLVEANVKNDAKLLDEVEGFLVEFRDTWKEMIQQSRKG.................................. 125
98 9.000e-52gi|547280159|ref|WP_022013639.1| putative uncharacterized protein [Clostridium sp. CAG:122]  clstr ali  33  1MTSEEKRQFTARISQANKSELVVILFEMFDYCIEQAEDGFKTEDLQKADSYLKSAKGCVSELRGSLDMGYEISHNLYSIYTYVNRQLTASIIKRKPVNIDSVKENMEKLRKSFEEVAKQDTSGSVVQNSQKVYAGLTYGKGTLNEVFMDNEARGFKA 158
99 9.000e-52T2D.771928 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  33  1MTSEEKRQFTARISQANKSELVVILFEMFDYCIEQAEDGFKTEDLQKADSYLKSAKGCVSELRGSLDMGYEISHNLYSIYTYVNRQLTASIIKRKPVNIDSVKENMEKLRKSFEEVAKQDTSGSVVQNSQKVYAGLTYGKGTLNEVFMDNEARGFKA 158
100 1.000e-51T2D.2697073 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  43  1MDNELKKDFTRRLSQCNSGEMIVIIYDIFFAYVDDIRQAHCKGDHDGQKDAIRNAQSVLDELIGSLNFSYPISHNLYKLYMFCKNELSRAMYENRLDGVQEAEHIMHRLYTSFVEVAKQDKSAPLMKNTQQVYAGMTYARGAVNEDYMDDSHRGFFV 158
101 1.000e-51METAHIT unmapped GL0156791 unmapped_[Complete]_[mRNA]_locus=scaffold361806_1:404:778:+  ali  20  5..NGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
102 1.000e-51T2D.2379480 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  5..NGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
103 1.000e-51JGI.Meta JGI_HUM.2827600 7007349830 SRS016095_WUGC_scaffold_30046__gene_74815 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  20  5..NGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
104 1.000e-51gi|647307879|ref|WP_025747915.1| flagellar biosynthesis protein FliS [Caldicoprobacter oshimai]  clstr ali  21  3LNNPYQQYQQQSVMTASPGELLVMLYNGCIRFIKQAIECINGKDLEGAHKAIIRAQDIILEFMTTLDMKYEVSHNLMALYDYLHRRLVEANTRKDVAALEEVLGFVTELRDTWAEAVKITRKQ.................................. 125
105 1.000e-51METAHIT MH0006 GL0147204 [Complete] locus=scaffold173771_1:79:477:+  ali  19  9..NAYAQYNNSKVLTATPAELTLMLYEGAIKFCNIAIVAVEKKDIEKANNNIIKTERIIDYFRQTLDTKYPVAEDFDRVYEYIGRRLVEANLKKDKEILEEVAEHLRSMRDTWKEVMQVNREK.................................. 129
106 1.000e-51T2D.92766 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  9..NAYAQYNNSKVLTATPAELTLMLYEGAIKFCNIAIVAVEKKDIEKANNNIIKTERIIDYFRQTLDTKYPVAEDFDRVYEYIGRRLVEANLKKDKEILEEVAEHLRSMRDTWKEVMQVNREK.................................. 129
107 1.000e-51METAHIT MH0024 GL0052008 [Complete] locus=scaffold27279_3:1366:1842:-  ali  32  1MTKECKQQFTLRITQANKTELIVILYEMLLAYTQDAKISLQEGNTEAFRDNIRKADNCLTELTESLDLSYEIGRRLLSLYMFCKKELLKADVRKKEEFVLHVEAVITRLRDAYREVAAQDESTPVMENSQEIYAGLTYGRDSLTENMAYETNSGFRA 158
108 1.000e-51T2D.454857 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  32  1MTKECKQQFTLRITQANKTELIVILYEMLLAYTQDAKISLQEGNTEAFRDNIRKADNCLTELTESLDLSYEIGRRLLSLYMFCKKELLKADVRKKEEFVLHVEAVITRLRDAYREVAAQDESTPVMENSQEIYAGLTYGRDSLTENMAYETNSGFRA 158
109 1.000e-51gi|502937031|ref|WP_013172007.1| flagellar protein FliS [Bacillus selenitireducens]  clstr ali  18  4.NNPYQQYKQNTVDTKSPGELTLMLYDGCLKFIRRAEEAIKNKNIEVKNENLLKAQNIIRELMLTLNTDVAVSQDMMSMYDYILNQLVEANMKNDLDALKEAAKYTEDFRDTWKEVIKIDRQE.................................. 125
110 2.000e-51JGI.Meta JGI_HUM.1185298 7037865446 SRS014923_WUGC_scaffold_29623__gene_49197 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEVAIEEKDIQKAHNNIRKVQNIIGYLQSTLDTKYPVAQDFINIYDYLSQRLVEANVKKDKEILEEVNMHLHSVRDNWKEVMRVNREK.................................. 125
111 2.000e-51gi|504822296|ref|WP_015009398.1| flagellar biosynthesis protein FliS [Amphibacillus xylanus]  clstr ali  19  3.QQPYQAYINNSVNTASPAELTLMLYNGCLKFIRYGKKGIEEQNMELKNTNIQKAQNIITELMVTLDQSAPIAKDIMPLYDYINQLLIEANIKNDLNSLDEAANLVEEFRDTWKEVIKQTRTREYKQGVQA.......................... 132
112 2.000e-51JGI.Meta JGI_HUM.0522558 7058461396 C3919447__gene_312347 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  31  3MDSEKRKAYTTRISQANRSELVVIIYELLLDSLADARQAFGKEDFDTADVELKRAQGLVCELRGSLNFEYPVSYRLVSLYRYINEQLVKSITRKKDVNLDSCERVISSLKDSFEEVSKQDTSGPVIESGQQVYAGLTYGKGSLNEVAIDAGGRGFQA 161
113 3.000e-51gi|651374101|ref|WP_026486328.1| flagellar biosynthesis protein FliS [Caldanaerobius polysaccharolyticus]  clstr ali  23  4.NNPYQQYKANAVMTASPEELTLMLYDGIIRFLNQAKEAISSHDMQTAHERLVRVQDILNELNATLDRNYDISANFASLYDFMIRKTVEANVKKDVSIIDEVLDLARDLRDTWQQAMKKARKEK................................. 126
114 3.000e-51gi|547200785|ref|WP_021941911.1| flagellar protein FliS [Clostridium sp. CAG:632]  clstr ali  20  3.NNAAQAYGARKVETATPAELTLMLYEGTIKFCNIAMGAIEKKDYEKANINIQKARKIIVELQTTLDHKYPVAEDFDRIYDYIFHKLVQANIKKDPEILEEALVELRDLRDAWKEIMRTAK.................................... 122
115 3.000e-51METAHIT MH0065 GL0075295 [Complete] locus=C4651944_1:503:883:-  ali  20  3.NNAAQAYGARKVETATPAELTLMLYEGTIKFCNIAMGAIEKKDYEKANINIQKARKIIVELQTTLDHKYPVAEDFDRIYDYIFHKLVQANIKKDPEILEEALVELRDLRDAWKEIMRTAK.................................... 122
116 3.000e-51T2D.1123407 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  3.NNAAQAYGARKVETATPAELTLMLYEGTIKFCNIAMGAIEKKDYEKANINIQKARKIIVELQTTLDHKYPVAEDFDRIYDYIFHKLVQANIKKDPEILEEALVELRDLRDAWKEIMRTAK.................................... 122
117 4.000e-51gi|548336542|ref|WP_022516187.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:182]  clstr ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYAVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
118 4.000e-51JGI.Meta JGI_HUM.1193340 7037903444 SRS014923_WUGC_scaffold_47617__gene_87195 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYAVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
119 4.000e-51gi|547835013|ref|WP_022242865.1| putative uncharacterized protein [Roseburia sp. CAG:45]  clstr ali  41  1MDSRTKQDFTRRITQSNRSELVVVLYDICFSYLDEAEKNLKEKDFDVYKEAVRKADAVIGELQAALNFQYELSLQLYPLYSYCRRELMRSMYQQSGDGIAHAKRVLSGLYQAFCEVAKQDTSEPLMHNTQQVYAGMTYGKEQLNENFQSDTSRGFFA 158
120 4.000e-51METAHIT MH0025 GL0074402 [Complete] locus=scaffold29988_3:7934:8410:-  ali  41  1MDSRTKQDFTRRITQSNRSELVVVLYDICFSYLDEAEKNLKEKDFDVYKEAVRKADAVIGELQAALNFQYELSLQLYPLYSYCRRELMRSMYQQSGDGIAHAKRVLSGLYQAFCEVAKQDTSEPLMHNTQQVYAGMTYGKEQLNENFQSDTSRGFFA 158
121 4.000e-51T2D.476293 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  41  1MDSRTKQDFTRRITQSNRSELVVVLYDICFSYLDEAEKNLKEKDFDVYKEAVRKADAVIGELQAALNFQYELSLQLYPLYSYCRRELMRSMYQQSGDGIAHAKRVLSGLYQAFCEVAKQDTSEPLMHNTQQVYAGMTYGKEQLNENFQSDTSRGFFA 158
122 4.000e-51CGD_mhc6b.726667 GDGC0ZU01AXEHE|GDGC0ZU01AXEHE|metagene|gene_1  ali  18  4.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQ....................................... 120
123 5.000e-51gi|503063644|ref|WP_013298620.1| flagellar biosynthesis protein FliS [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  19  1MFDPYLEYKRNSIMTASPEELVMMLYNGIIRFVNEAKQAIDDKNIERAHNSITRAQDIVLELMSTLDMKYDISKNLYSIYDYISRRLIEANLKKDKVALDEVESLISDLKDTWGKAMDKVRAKVYSKG............................. 128
124 5.000e-51gi|548247477|ref|WP_022465335.1| putative uncharacterized protein [Clostridium sp. CAG:277]  clstr ali  33  21MDKENKKIYTTRISQANRSELVVIIYELMLESLAEAGQAFEKEDFDTADVELKRVQGFLCELRGSLDFQFPVSYRLASLYRYVNEQLVKSITRKKNVGLASCERVLQGLKESFEEIAKQDTSGPVMENSQQVYAGLTYGKGSLNEVTIDPGGRGFQV 179
125 5.000e-51gi|653240250|ref|WP_027445884.1| flagellar biosynthesis protein FliS [Pontibacillus marinus]  clstr ali  17  3.TQAYQAYQNNSVETASPGELTLMLYNGCLKFIRLAKKGIEESNYELKNTNIQKAQKIIQELMVTMNPEYKITEEIMPLYDYINRKLMEANLHNDTAMLDEAAELVTDFRDTWKEVVKQTRQQKFGSGG............................ 130
126 5.000e-51gi|547314005|ref|WP_022045653.1| putative flagellar protein FliS [Roseburia sp. CAG:18]  clstr ali  43  1MENELKKDFTRRLSQCNSGEMIVIIYDIFFAYVDDIRQAHCKGDHDGQKDAIRNAQSVLDELIGSLNFSYPISHNLYKLYMFCKNELSRAMYENRLDGVQEAEHIMHRLYASFVEVAKQDKSAPLMKNTQQVYAGMTYARGAVNEDYMDDSHRGFFV 158
127 5.000e-51JGI.Meta JGI_HUM.0413604 7049094042 C5176519__gene_330039 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158499257]  ali  43  1MENELKKDFTRRLSQCNSGEMIVIIYDIFFAYVDDIRQAHCKGDHDGQKDAIRNAQSVLDELIGSLNFSYPISHNLYKLYMFCKNELSRAMYENRLDGVQEAEHIMHRLYASFVEVAKQDKSAPLMKNTQQVYAGMTYARGAVNEDYMDDSHRGFFV 158
128 5.000e-51gi|503861883|ref|WP_014095877.1| flagellar biosynthesis protein FliS [Bacillus coagulans]  clstr ali  20  5..NPYQAYQNNSIATASPGELTLMLYNGCLKFIHLAKKAIENKNFEEKNKNIQKAQNIIRELMMTLDTKFEDAEKMLSLYDFILRELIQANVKNDMSKLDTAEELVTGFRDTWKQVIQANRRQTYGQGG............................ 132
129 5.000e-51gi|501225583|ref|WP_012268601.1| flagellar biosynthesis protein FliS [Thermoanaerobacter sp. X514]  clstr ali  23  2MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGTIEKKDYMAANNSIQRAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVTILEEVKGFAIELRDTWSVALNKVREKVYAKG............................. 129
130 5.000e-51gi|558636518|ref|WP_023511351.1| flagellar biosynthesis protein FliS [Sporolactobacillus laevolacticus]  clstr ali  21  4..SAYKTYQQNSILTATPGELTLMLYNGCIKFIRQAKIAITEKNIEDKNKYLQKAQDIIRELMVTLDQKQQVAQSMMQMYDYMNRRLIEANIKNDLKILNEVEGLVTEFRDTWKQVIEITQKNQ................................. 125
131 5.000e-51gi|516754026|ref|WP_018084741.1| hypothetical protein [Desulfurispora thermophila]  clstr ali  22  5..NPYQQYRQNAVNSAAPGELTLMLYNGAIKFLHQAREAIAAKDVPGAHEALVRAQEIIQYLFDTLDMQYEIAGNLAALYDFILRQLRQANIKKDVGPVEEVLPLLEDLRDTWGKA......................................... 118
132 6.000e-51gi|515752311|ref|WP_017184911.1| hypothetical protein [Alkalibacillus haloalkaliphilus]  clstr ali  22  6..QAYQAYQQNSVSTASPGELTLQLYNGCIKFIKLAKTAIEKEDFQSKNEQLQKAQNIIAELMVTLNPDYDITNQLLPLYDYINYCLREANIHNDVAKLDEAQKMVEQLRDTWKEAIKLDRQNKYAPGAKA.......................... 134
133 6.000e-51gi|497451562|ref|WP_009765760.1| flagellar biosynthesis protein FliS [Sporosarcina newyorkensis]  clstr ali  25  4.NNPYAAYQNNSVTTSTPGELTLMLYNGCLKFIQQGKMALEEGKLEEKNVAIQKAQAIVTELMLTLDTSYPVAENMLVLYEFVNSRLIDGNIKNDPALFDEASGIIKEFRDTWKQVIQVNRSKQY................................ 127
134 6.000e-51gi|547313580|ref|WP_022045246.1| flagellar protein [Roseburia sp. CAG:18]  clstr ali  18  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAIEKGDIEKAHNNIRKAENIIREFQITLDHKYAVAKDFDAVYTYLLQRLLEANMKKDKDILEEVLGHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
135 6.000e-51JGI.Meta JGI_HUM.0395078 7049041120 C5124457__gene_277117 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158499257]  ali  18  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAIEKGDIEKAHNNIRKAENIIREFQITLDHKYAVAKDFDAVYTYLLQRLLEANMKKDKDILEEVLGHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
136 7.000e-51gi|653220298|ref|WP_027432857.1| hypothetical protein [Lachnospiraceae bacterium MD2004]  clstr ali  38  1MNNELKMNYTRRITQSNPSEIIAILYEIFFTYLQDGEEAMKCRNLEQAREELRHASQVIQHLKDALDRKQELSKQLYPLYDFCQRALEKSNYRGDLSGIEEARRIMGPLQEAFQQIAKQDQSGSVMKHTQTVLAGMTYGRGTLNETTIYENNRGFLA 157
137 7.000e-51T2D.2952952 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  4.NKGYAAYANNKIMTASPAELTLMLYEGAIKFCNLAMEAIDAKDIQKAHENIMKAEHIVEEFQATLDHRYPVAKDFDNVYSYLLERLKEANLKKDKEIMEEVTKHLRTMRDTWKEVMKHGRSGQ................................. 126
138 7.000e-51METAHIT unmapped GL0027310 unmapped_[Complete]_[mRNA]_locus=scaffold827198_1:61:450:+  ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYVVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
139 7.000e-51T2D.2528580 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYVVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
140 7.000e-51gi|652813539|ref|WP_027105262.1| hypothetical protein [Lachnospiraceae bacterium V9D3004]  clstr ali  33  1MTDEDIQAFSKRVTQANQSELTVITYEIVLHYIDDAIEAIDNNDTANYRIYISKAREFLRELMSALVFTSTTSFNLLKIYSFFHKQLITAEYDMDKEKPETVKKLMNKLLDAFREVAEKDSSPAVMMNTQQVYAGLTYGKGYLNETMLDETGRGFRA 159
141 8.000e-51gi|511045167|ref|WP_016299101.1| flagellar protein FliS [Lachnospiraceae bacterium COE1]  clstr ali  19  4.QNGYAQYQNAKIMTASPAELTLMLYEGAIKFGNIAIVAMENKNPAKAHENIVRVENIIQNFRDTLDKKYPIWEEFEKIYVYLLRRCHECNIAKDPEIMEEVLKHIRSMRDNWKEVMKKVASDKSNPAAQARVAG---GRGN............... 141
142 8.000e-51gi|551041191|ref|WP_022784832.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium NK4A179]  clstr ali  22  3.KNPYEQYKNNAIATATPAELTLMLYEGAIKFGNIAIKAIEEGDIQKAHTNIMKVQRIISEFRNTLDFKYPVAKDFDRVYEYLERRLVEANVSKDKEIMEEMVMHIRSMRDNWKEVMKRAKQPQ................................. 125
143 8.000e-51JGI.Meta JGI_HUM.1597361 7027265228 C5287224__gene_287182 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765074482]  ali  18  24.QRAINAYQKNAIMTASKAELTLMLYDGAIKFCNIALSGFENKDYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAGK................................. 146
144 9.000e-51JGI.Meta JGI_HUM.0245831 7004273903 C4264442__gene_344832 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160400887]  ali  40  1MDSRTKQDFTRRITQSNRSELVVVLYDICFSYLDEAEKNLNKKDFDVYKEDIRKADAVIGELQAALNFQYELSAQLYPLYSYCRRELMCSMYQQNGDGIAHAKRVLNGLYQAFCEVAKQDTSEPLMHNTQQVYAGMTYGKEQLNENFQSDTSRGFFA 158
145 9.000e-51METAHIT V1 GL0128472 [Complete] locus=scaffold39751_4:699:1094:-  ali  16  9.NQGYAAYANNKIATASPAELTLMLYEGAIKFCNIAIVGVEEKSIQKTHDNIMKTERIIEELQSTLDHKYPVAKDFDEVYSYLLRRLRQANIKKDKDILEEVLKHLRTMRDTWKEVMRTAHRTQ................................. 131
146 9.000e-51T2D.1803913 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  9.NQGYAAYANNKIATASPAELTLMLYEGAIKFCNIAIVGVEEKSIQKTHDNIMKTERIIEELQSTLDHKYPVAKDFDEVYSYLLRRLRQANIKKDKDILEEVLKHLRTMRDTWKEVMRTAHRTQ................................. 131
147 9.000e-51JGI.Meta JGI_HUM.0945772 7067754089 C3231922__gene_303066 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159571453]  ali  16  9.NQGYAAYANNKIATASPAELTLMLYEGAIKFCNIAIVGVEEKSIQKTHDNIMKTERIIEELQSTLDHKYPVAKDFDEVYSYLLRRLRQANIKKDKDILEEVLKHLRTMRDTWKEVMRTAHRTQ................................. 131
148 9.000e-51gi|511031625|ref|WP_016285716.1| flagellar protein FliS [Lachnospiraceae bacterium 3-1]  clstr ali  17  4.NKGYNAYARNKILTASPAELTLMLYEGAIKFCNIAIAAIEEKNIEKAHNNITKVENIVAEFLSTLDHKYPVAKDFENVYNYLMERLLEANLKKDKEILEEVLTHLRTMRDTWKEVMEQNKTAK................................. 126
149 9.000e-51METAHIT MH0024 GL0073248 [Complete] locus=scaffold63754_2:19:495:+  ali  43  1MENELKKDFTRRLSQCNSGEMIVIIYDIFFAYVDDIRQAHCTGDHDGQKDAIRNAQSVLDELIGSLNFSYPISHNLYKLYMFCKNELSRAMYENRLDGVQEAEHIMHRLYTSFVEVAKQDKSAPLMKNTQQVYAGMTYARGAVNEDYMDDSHRGFFV 158
150 1.000e-50METAHIT MH0065 GL0107392 [Complete] locus=scaffold2863_3:4350:4730:+  ali  17  4.NKGYAAYANNKIMTASPAELTLMLYEGAIKFCNLAMEAIDAKDIQKAHENIMKVEHIVEEFQATLDHRYPVAKDFDNVYSYLLERLKEANLKKDKEIMEEVTKHLRTMRDTWKEVMKHGRSGQ................................. 126
151 1.000e-50JGI.Meta JGI_HUM.1967793 7017239860 C3251345__gene_145109 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160765029]  ali  17  4.NKGYAAYANNKIMTASPAELTLMLYEGAIKFCNLAMEAIDAKDIQKAHENIMKVEHIVEEFQATLDHRYPVAKDFDNVYSYLLERLKEANLKKDKEIMEEVTKHLRTMRDTWKEVMKHGRSGQ................................. 126
152 1.000e-50T2D.4148297 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  33  25MDKENKKIYTTRISQANRSELVVIIYELMLESLAEAGQAFEKEDFDTADVELKRVQGFLCELRGSLDFQFPVSYRLASLYRYVNEQLVKSITRKKDVGLASCERVLQGLKESFEEIAKQDTSGPVMENSQQVYAGLTYGKGSLNEVAIDPGGRGFQV 183
153 1.000e-50METAHIT O2 GL0085205 [Complete] locus=scaffold7143_4:493:957:-  ali  17  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAIEKGDIEKAHNNIRKAENIIREFQITLDHKYAVAKDFDAVCTYLLQRLLEANMKKDKDILEEVLGHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
154 1.000e-50T2D.1664901 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAIEKGDIEKAHNNIRKAENIIREFQITLDHKYAVAKDFDAVCTYLLQRLLEANMKKDKDILEEVLGHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
155 1.000e-50gi|547854614|ref|WP_022261526.1| flagellar protein FliS [Butyrivibrio sp. CAG:318]  clstr ali  18  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQ................................. 127
156 1.000e-50METAHIT MH0012 GL0293800 [Complete] locus=C18744566_1:290:685:+  ali  18  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQ................................. 127
157 1.000e-50T2D.329801 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQ................................. 127
158 1.000e-50JGI.Meta JGI_HUM.3188962 7005492296 SRS013687_Baylor_scaffold_47664__gene_88762 flagellar protein fliS [Human Stool microbiome from visit number 1 of subjec  ali  18  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQ................................. 127
159 1.000e-50METAHIT MH0045 GL0068699 [Complete] locus=scaffold86703_1:49:525:-  ali  32  1LTSEEKRQFTARISQANKSELVVILFEMFDYCIEQAEDGFKTEDLQKADSYLKSAKGCVSELRGSLDMGYEISHNLYSIYTYVNRQLTASIIKRKPVNIDSVKENMEKLRKSFEEVAKQDTSGSVVQNSQKVYAGLTYGKGTLNEVFMDNEARGFKA 158
160 1.000e-50JGI.Meta JGI_HUM.3506780 7019907468 C2496108__gene_220806 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160603188]  ali  32  1LTSEEKRQFTARISQANKSELVVILFEMFDYCIEQAEDGFKTEDLQKADSYLKSAKGCVSELRGSLDMGYEISHNLYSIYTYVNRQLTASIIKRKPVNIDSVKENMEKLRKSFEEVAKQDTSGSVVQNSQKVYAGLTYGKGTLNEVFMDNEARGFKA 158
161 1.000e-50gi|504457205|ref|WP_014644307.1| flagellar biosynthesis protein FliS [Halobacillus halophilus]  clstr ali  19  4.....QAYQNNSVETASPGELTLMLYNGCLKFIKTAKKAIENHDIEKKNTNIQKAQKIIRELMVTMEQDYEVAKDIMPLYDYMNRRLMEANITNDLGILEEVQGLTEEFRDTWKEVILQTRRVQQGQGGRA.......................... 129
162 1.000e-50JGI.Meta JGI_HUM.6836487 7063492051 C3130952__gene_93835 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 764669880]  ali  30  4MTKECKQQFTLRITQANSTQLIVILYEMTLQYLADGEQAVDD---AGLVEAVHRARGCIKELLNSLHREYSPAGELSRLYLFCLRRLAVCEVRRDRTILEEIRKVIAPLCDAYRQIQDQDTSGPVMNNSQTVYAGLTYGRNQLTENMADQTNRGMLV 158
163 1.000e-50gi|651401889|ref|WP_026513483.1| hypothetical protein [Butyrivibrio sp. LB2008]  clstr ali  31  1MTQEKKQEFTLKITQANKTQLITILYEMVIEYLNDAIDAIGIGRKEEAEKSLGYAQNCIDELLRSLDLRYELARNLHPLYIFFKKELMLAGVTYSSHKIWRVEQNFKTLKEAYEELEKYDTSSPMMGNTQKVYAGLTYGRHSLNEGMMASANRGYMA 158
164 1.000e-50METAHIT MH0063 GL0061236 [Complete] locus=scaffold80247_3:404:793:+  ali  15  4.NNGYNAYAQNKILTATPAELTLMLYEGAIKFCNIAVVAIENKDYAKANTNIQKAERIIGEFKATLNHKYATAKDFDVVYDYLMERLLQANMKKDTEILEEVLKHLRTMRDTWKEVMQITKNG.................................. 125
165 1.000e-50T2D.1067146 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  15  4.NNGYNAYAQNKILTATPAELTLMLYEGAIKFCNIAVVAIENKDYAKANTNIQKAERIIGEFKATLNHKYATAKDFDVVYDYLMERLLQANMKKDTEILEEVLKHLRTMRDTWKEVMQITKNG.................................. 125
166 1.000e-50JGI.Meta JGI_HUM.2296328 7004744558 SRS013705_Baylor_scaffold_91903__gene_112818 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1  ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVRGNLDSDTAKIDEAAGIIRELRDAWAQAMKKARAEKMGEGAEAV......................... 133
167 1.000e-50gi|503042277|ref|WP_013277253.1| flagellar biosynthesis protein FliS [Acetohalobium arabaticum]  clstr ali  21  3.NNPYQKYKNTQVETASQEKLLLMLYDGAIKFLKQAIKGVEENDYEAANNYLVRTQDIIHELMATLDMEKEIARNLESLYDYMNRRLIEANVNKDIEPMEEVRDMLAELRETWQEAIKKVKQ................................... 125
168 1.000e-50gi|652814066|ref|WP_027105604.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium V9D3004]  clstr ali  21  3.NNAANSYKNNKIMTATPAELTLMLYDGAVKFCNIALMAFEKNDYTKVNDNIIKVENIITEFRSTLDFKYPVANDFEVVYDYIYRRLVDANIKKDPEILNEALKYIKEMRETWQEVMKINKNQ.................................. 124
169 2.000e-50METAHIT O2 GL0020395 [Complete] locus=scaffold11001_1:299:787:+  ali  37  5MTTEKKQMFTRRITQANKTQLTVIVYEMLSAYLEDARAAHDAGQTEELVQNIDLARACIGQLRSSLDFQYELAGNLFSLYCYADRELARDMFSLKVDNLDTIEMIFTKLRDAYQQISSQDQSGPLMENIQSVYAGLTYGRTDLNESLVNDAKRGFLV 162
170 2.000e-50T2D.1559886 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  37  5MTTEKKQMFTRRITQANKTQLTVIVYEMLSAYLEDARAAHDAGQTEELVQNIDLARACIGQLRSSLDFQYELAGNLFSLYCYADRELARDMFSLKVDNLDTIEMIFTKLRDAYQQISSQDQSGPLMENIQSVYAGLTYGRTDLNESLVNDAKRGFLV 162
171 2.000e-50JGI.Meta JGI_HUM.2745273 7025242208 C3586802__gene_184747 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 764224817] :  ali  18  9..NPYQKYKETSINTASKEEITLMLYEGCIKFMNLARIGIEEKNIQKANENLIKAQNIVTELDITLNMDIPISKNFHQLYDFVLSRLIDANIKKDVAFIDDAKLVMVDLRDGWKEAM------PLMRKAQK.......................... 131
172 2.000e-50gi|495910983|ref|WP_008635562.1| MULTISPECIES: flagellar protein FliS [Bacillaceae]  clstr ali  24  4.....QAYQNNSVSTASPGELTLMLYNGCIKFIKAGKKAMESNEIEAKNTNIQKAQKIIQELMVTIDDQYEVSKQILPLYDYMNRRLIEANTKNDTGVLDEVQGMVEEFRDTWKQVLLADRKLQHGSGG............................ 127
173 2.000e-50METAHIT V1 GL0079299 [Complete] locus=scaffold1871_8:6908:7387:+  ali  33  1MDKENKKIYTTRISQANRSELVVIIYELMLESLAEAGQAFEKEDFDIADVELKRVQGFLCELRGSLDFQFPVSYRLASLYRYVNEQLVKSITRKKDVGLASCERVLQGLKESFEEIAKQDTSGPVMENSQQVYAGLTYGKGSLNEVTIDPGGRGFQV 159
174 2.000e-50gi|511025884|ref|WP_016280144.1| flagellar protein FliS [Lachnospiraceae bacterium A4]  clstr ali  30  1MTREMKQIFTRRITQANRTQLVVILYDMVLEYLKEAIAAQEIDCIQEYKKAMQCARNCISELRNSLDFNYEISKNLFAIYAFADRELASEMHSIKKDALSQIAGMFQKLRDAYYTISKEDHSQPLMQNAQNVYAGYTYGRTDVNESLYSGAARGYCV 157
175 2.000e-50gi|547480345|ref|WP_022098286.1| putative uncharacterized protein [Eubacterium eligens CAG:72]  clstr ali  32  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDAC---ESDSTEQAHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQAVYSGLTYSKGGINETQTDNENRGFRV 156
176 2.000e-50T2D.682007 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.QRAINAYQKNAIMTASKAELTLMLYDGAIKFCNIALSGFENKDYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMHLNKAGK................................. 126
177 2.000e-50gi|502179011|ref|WP_012726961.1| MULTISPECIES: flagellar biosynthesis protein FliS [Exiguobacterium]  clstr ali  20  4..NPYAAYQNNAVTTANPQELTLMLYDGALKFMRLAKLAIDQGNPDLKNINIQKTQAIFQELRLTLNKDIAISANLDSLYDYMWRRLVDANVKNDTTILDEVLDFTTELRDTWKEAMKLAKQ................................... 123
178 2.000e-50gi|497024420|ref|WP_009439491.1| MULTISPECIES: flagellar biosynthesis protein FliS [Selenomonas]  clstr ali  20  3.NTAADAYKRQQVMTATPEALTLMLYNGCLKFIKEGVEALAEKHYETANESLQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKSDPAIIAEASDIMTELRDAWAQAMKKAREEKGSQGTEGVYAG...................... 138
179 2.000e-50gi|517205790|ref|WP_018394608.1| hypothetical protein [Bacillus sp. 37MA]  clstr ali  20  4..NPQQAYANNSVTTASPGELTLMLYNGCIKFIRLAERAMADKNIEQKNVNIQKAQAIVRELSITLKTDTDVAKNMLALYEYLYTRLIEANVQNDPAILKEVEGFVTEFRDTWKQVIQENRR------IQQVGAG...................... 130
180 2.000e-50gi|548374964|ref|WP_022518779.1| putative flagellar protein FliS [Roseburia sp. CAG:100]  clstr ali  37  1MTTEKKQMFTRRITQANKTQLTVIVYEMLSAYLEDARAAHDAGQTEELVQNIDLARACIGQLRSSLDFQYELAGNLFSLYCYADRELARDMFSLKVDNLDTIEMIFTKLRDAYQQISSQDQSGPLMENIQSVYAGLTYGRTDLNESLVNDAKRGFLV 158
181 2.000e-50T2D.3426337 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  41  1MKKEQIMDFTRRISQSNRGGLVIVIYDIFFAYIEDAKEAYDNKEWENYKTALRNATKAVSELMSSLDFSYELAGELYRIYVFCRETLAKAMYKRDLKEIELAESLMNKLYTAFAEVMKEDTSAPLMRNTQQVYAGYTYGKNDLVETYQDDTSRGFLV 158
182 2.000e-50JGI.Meta JGI_HUM.1229490 7038097434 C3337517__gene_281185 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763860675]  ali  37  1MTTEKKQMFTRRITQANKTQLTVIVYEMLSAYLEDARAAHDAGQTEELVQNIDLARACIGQLRSSLDFQYELAGNLFSLYCYADRELARDMFSLKVDNLDTIEMIFTKLRDAYQQISSQDQSGPLMENIQSVYAGLTYGRTDLNESLVNDAKRGFLV 158
183 2.000e-50gi|489340841|ref|WP_003248016.1| MULTISPECIES: flagellar biosynthesis protein FliS [Geobacillus]  clstr ali  22  8.....QVYKQNSVSTASPGELTLMLYNGCLKFLNKAKQAMREGNIQERNTNLQKAQRIIQELMATLNQKYEIAKQMMIMYEYMNRRLIEANIKNDISIVEEVEGFVAEFRDTWEEVIRLTRQKQF................................ 127
184 2.000e-50gi|551003453|ref|WP_022748159.1| flagellar protein FliS [Lachnobacterium bovis]  clstr ali  38  1MTQEKIQEFTRRLSQCNKSELTIINYEIAFTYMEDAESAYNNGDYAEFKKNIEWAEKAIEELRSVLNFEYELSNNLNEIYLYCNRSLSESVYKNETNGIKEAKKLLEKLYESFRVAAESDNSGSMMDNVQNVYAGITYSKNDLNETYTNDSNRGFLA 157
185 2.000e-50gi|495158581|ref|WP_007883383.1| MULTISPECIES: flagellar protein FliS [Roseburia]  clstr ali  37  1MEKEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCRDSLAAAMYKRSLTEIETAEKMLRKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQEDKSRGFFA 158
186 2.000e-50gi|518072867|ref|WP_019243075.1| hypothetical protein [Bacillus massilioanorexius]  clstr ali  19  4.NNPYKAYEQNSVTTASPGELTLMLYNGCLKFIGKAKIAIEQNHIEERNTNIQKAQNIIRELMVTLNMDYEVSKNMMTIYEYINGLLTEANIQSELAKLVEAEGLVKEFRDTWKQVVQMNRKKQYQGGA............................ 131
187 2.000e-50gi|489616010|ref|WP_003520450.1| flagellar biosynthesis protein FliS [Clostridium thermocellum]  clstr ali  26  3LKNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQAQMALNDKNIEKANKSIIRAQDIISEFRCTLDMKYDIAHQLDLLYDYMYRRLVDANIKKDGAIAEEVLGFAKELRDTWEQAMKIAKQQ.................................. 125
188 3.000e-50gi|548068328|ref|WP_022377788.1| putative uncharacterized protein [Clostridium sp. CAG:62]  clstr ali  33  1MEKERLQEYAARVTQANRSELVVIIYEATLASIEEGKNYLKQGEIEAARHEIERARSMITELMGSLDLQYEISHYLRQLYVFAYRELCQGIANRDPEQLNHATDIFEALLPSFKEVAKQDDSEAVMKNVQTIYAGLTYGRGTLNETIDSDANRGFEA 159
189 3.000e-50METAHIT MH0014 GL0062115 [Complete] locus=scaffold27670_9:7965:8444:-  ali  33  1MEKERLQEYAARVTQANRSELVVIIYEATLASIEEGKNYLKQGEIEAARHEIERARSMITELMGSLDLQYEISHYLRQLYVFAYRELCQGIANRDPEQLNHATDIFEALLPSFKEVAKQDDSEAVMKNVQTIYAGLTYGRGTLNETIDSDANRGFEA 159
190 3.000e-50T2D.352006 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  33  1MEKERLQEYAARVTQANRSELVVIIYEATLASIEEGKNYLKQGEIEAARHEIERARSMITELMGSLDLQYEISHYLRQLYVFAYRELCQGIANRDPEQLNHATDIFEALLPSFKEVAKQDDSEAVMKNVQTIYAGLTYGRGTLNETIDSDANRGFEA 159
191 3.000e-50gi|547940564|ref|WP_022341918.1| flagellar protein FliS [Roseburia sp. CAG:309]  clstr ali  17  3.QRAINAYQRNAVMTASKAELTLMLYDGAIKFCNIALSGFEKKEYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAGS................................. 125
192 3.000e-50METAHIT MH0086 GL0179773 [Complete] locus=scaffold2463_2:699:1079:-  ali  17  3.QRAINAYQRNAVMTASKAELTLMLYDGAIKFCNIALSGFEKKEYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAGS................................. 125
193 3.000e-50gi|649360825|gb|KDR94773.1| flagellar protein FliS [ [[Clostridium] litorale DSM 5388]  clstr ali  19  3MANPHLKYQQQAVMTAPPEELTLMLYDGCVKFLSRAEIGLEDNNIEMINNNLVKAQNIISELNSTLNMDYEVSKGLRPIYNYLHSRLLDANIKKDRAIVEEVKGFIIELRDTWKEAMKIARR................................... 124
194 3.000e-50gi|511066068|ref|WP_016307676.1| hypothetical protein [Lachnospiraceae bacterium A2]  clstr ali  37  1MTQEKKQEFTRRLSCCNRGEMIVILYDILFTYLDDAIAAKEQGTYEEFRESAGKAGQVVHRLMDDLDFTYPIASELYPAYQFVSKLLALAVCKNTADSLKDAKRVLKNLYDGFTEAAKQDSSGPLMQHTQQVVAGMTYQKGSLTETLQGSESRGFFA 158
195 3.000e-50T2D.3732081 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  15MNTGYQQYEKNKILTASPAELTLMLYDGAIKYANIAIMAIDKGDVEKAHNSIRRVERIIEEFQNTLDFKYPVAKDFDEVYKYIRTRLREANVKKDKEIIEEVLKHLRTMRDTWKEVIQLSRN................................... 138
196 3.000e-50JGI.Meta JGI_HUM.1919508 7045851745 C3134234__gene_274957 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 159207311]  ali  19  15MNTGYQQYEKNKILTASPAELTLMLYDGAIKYANIAIMAIDKGDVEKAHNSIRRVERIIEEFQNTLDFKYPVAKDFDEVYKYIRTRLREANVKKDKEIIEEVLKHLRTMRDTWKEVIQLSRN................................... 138
197 4.000e-50T2D.3075008 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  38  1MEKEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCKDSLAAAMYKRSLTEIENAEKMLQKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQEDKSRGFFA 158
198 4.000e-50T2D.3873989 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  30  1MTKSEINEYAMRISQASRSEIIVIMYEVAIKYIDDGVLALQDGNVQEFRHDIKKAKAFVNELASALDLKYPISGNLLSLYTYMNNVMVKADITLKTDDLIRVKGMLDRLHSAFVEVSRQDSSQPMMRNVQQVYTGLTYSKNSLNDSYVSDFNRGYKV 159
199 4.000e-50T2D.2649980 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  32  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDAC---ESDSAEQAHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQAVYSGLTYSKGGINETQTDNENRGFRV 156
200 4.000e-50gi|556509069|ref|WP_023353970.1| flagellar protein FliS [Catonella morbi]  clstr ali  35  1MKAESVKIYTRRITSANKSEIIVIMYDIIEENLTLAEEAINKGDRVTFKNELKQAVSFVKELLVSLDMSYEVSKNLASLYIYVSRCLNFALVSGKKEEIEAARKVLRKLGDSFREVAKTDKSEPVMGKTQQVYAGITYGKGSLDETLIDSENRGFRA 160
201 4.000e-50METAHIT MH0023 GL0003061 [Complete] locus=scaffold3383_2:877:1272:-  ali  17  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKKDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMRVTCNGS................................. 126
202 4.000e-50T2D.444204 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKKDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMRVTCNGS................................. 126
203 4.000e-50JGI.Meta JGI_HUM.0454210 7058202701 SRS049959_WUGC_scaffold_28224__gene_53652 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYEGAIKFCNVAIDAVERKDIAKAHTNIVKVENIIDYLRKTLDMKYPVAQDFERMYVYLDQRLVEANVKKDVEILEEIRDHLHAIRDNWKEVMRVNREK.................................. 125
204 5.000e-50CGD_mhc6b.559301 GBSZFAF02G6XSI|GBSZFAF02G6XSI|metagene|gene_1  ali  17  16.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAIEAIDANDIQKAHNNIMKVQRIIEEFQSTLDHKYPVAKDFDEVYNYLLMRLREANIKKDKDIMEEVLKHLRTMRDTWKEVMRTAHA................................... 136
205 5.000e-50gi|547292492|ref|WP_022025252.1| flagellar protein FliS [Clostridium sp. CAG:75]  clstr ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
206 5.000e-50METAHIT V1 GL0024952 [Complete] locus=scaffold41593_6:851:1231:-  ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
207 5.000e-50T2D.3273797 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
208 5.000e-50JGI.Meta JGI_HUM.0936401 7067718886 C3185906__gene_267863 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159571453]  ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
209 5.000e-50METAHIT MH0021 GL0066216 [Complete] locus=C2092389_1:1166:1636:+  ali  30  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDACESDSAK---QAHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQAVYSGLTYSRGGINETQTDNENRGFRV 156
210 5.000e-50gi|518999167|ref|WP_020155042.1| hypothetical protein [Caldibacillus debilis]  clstr ali  18  4.QNPYQAYQDNAVTTASPGELTLMLYNGCLKFIAAAKEAMKKKDYAGKNTNLQKAQNIIRELMVTLKPEYEVSKNMMAMYDYIYRRLLEANLKNDLAILEECEGFVTEFRDVWKQVIQINRKQQYKEGGQ........................... 132
211 5.000e-50gi|652514776|ref|WP_026908985.1| flagellar biosynthesis protein FliS [Paucisalibacillus globulus]  clstr ali  18  3LNKPYQAYQNNAVNTASGGELTLMLYNGCNKFIKQAIRDIQEKNMEAKNTNIQKAQAIIQELMITLDLEVEISKHIMPLYDYMNRRLMEANLKNDIEILAEVQGFVVDFRDTWKQVILKTRQKQYAQG............................. 130
212 5.000e-50gi|497211720|ref|WP_009525982.1| flagellar biosynthesis protein FliS [Peptostreptococcaceae bacterium ACC19a]  clstr ali  17  4..NPYAKYKENSVNTATKEELTLMLYDGCIKFMNLAKIGIEEKNIEKANDNLLKAQAIITELDITLNMDIEISKNMHSLYDFALSRLVDANLKKDASLIDDAKSVIVDLRDAWKEAMNIVKRGK................................. 125
213 5.000e-50gi|548331667|ref|WP_022515560.1| putative uncharacterized protein [Roseburia sp. CAG:182]  clstr ali  39  1MQKEKIQEFTRRVSQDNRTSLIVTMYDIMLTYLDEAKAALEAEDREGFKAGLRHADRVLVQLQDSLNFKYSPADTLYALYVYCREELALAMAKQDLTGIGHAQTVLCGLRGGFAEAAAKDTSEPLMHNTEQVYAGITYGKNNLNESFQSEASRGFFV 157
214 5.000e-50JGI.Meta JGI_HUM.1238603 7038122904 C3382249__gene_306655 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763860675]  ali  39  1MQKEKIQEFTRRVSQDNRTSLIVTMYDIMLTYLDEAKAALEAEDREGFKAGLRHADRVLVQLQDSLNFKYSPADTLYALYVYCREELALAMAKQDLTGIGHAQTVLCGLRGGFAEAAAKDTSEPLMHNTEQVYAGITYGKNNLNESFQSEASRGFFV 157
215 6.000e-50METAHIT MH0044 GL0010764 [Complete] locus=scaffold5303_14:11729:12247:+  ali  21  21.QNGYAQYQNSRIMTASPAELTLMLYEGAIKFGNIAIMAMQNNDPSKAHENVVKVEKIIQNFRDTLDKKYPVWEDFEKVYTYLLRRCHEANIAKDPEIMEEVVGHLRSMRDNWKEVMKKVASDRDNPSAQSRIAG...................... 154
216 6.000e-50T2D.754679 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  21.QNGYAQYQNSRIMTASPAELTLMLYEGAIKFGNIAIMAMQNNDPSKAHENVVKVEKIIQNFRDTLDKKYPVWEDFEKVYTYLLRRCHEANIAKDPEIMEEVVGHLRSMRDNWKEVMKKVASDRDNPSAQSRIAG...................... 154
217 6.000e-50JGI.Meta JGI_HUM.5858479 7039437063 C1745076__gene_157839 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 159814214]  ali  21  21.QNGYAQYQNSRIMTASPAELTLMLYEGAIKFGNIAIMAMQNNDPSKAHENVVKVEKIIQNFRDTLDKKYPVWEDFEKVYTYLLRRCHEANIAKDPEIMEEVVGHLRSMRDNWKEVMKKVASDRDNPSAQSRIAG...................... 154
218 6.000e-50gi|503127878|ref|WP_013362539.1| flagellar biosynthesis protein FliS [[Clostridium] sticklandii]  clstr ali  16  3MNNPYAKYKEQSVTTATPEELTLMLYNGCIKFINLAEVYIEEKDYAKSNLNIQKAQGIIQELNITLNMDYEISQNLRQLYTFVNEKLLDANIKKDKQALFDAKEIVSDLRDTWKEAMALSRKGK................................. 126
219 6.000e-50JGI.Meta JGI_HUM.0426982 7049120336 C5190352__gene_356333 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158499257]  ali  33  1MEKERLQEYAARVTQANRSGLVVIIYEATLASIEEGKKYLKQGEIEAARHEIERARSMITELMASLDLHYEISHYLRQLYVFAYRELCQGIANRDPEQLNHATDIFEALLPSFKEVAKQDDSEAVMKNVQTIYAGLTYGRGTLNETIDSDANRGFEA 159
220 6.000e-50gi|548310300|ref|WP_022500812.1| putative uncharacterized protein [Firmicutes bacterium CAG:95]  clstr ali  18  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYTYLQQRLAQANIKKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
221 7.000e-50gi|647634227|ref|WP_025907032.1| flagellar biosynthesis protein FliS [Bacillus flexus]  clstr ali  17  4..NPYQAYQQGAVQTASPGELTLMLYNGCIKFIKMARIGFEQHNIEAKNENLLKAQKIIQELMVTLDTSAAVGKEMMAMYDYMNQRLIEANVQNRVELLDEVEGYAVEFRDTWKQVIQMNRKQTHGSGGQA.......................... 132
222 8.000e-50gi|502257470|ref|WP_012744009.1| flagellar biosynthesis protein FliS [Eubacterium rectale]  clstr ali  17  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKNDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMRVTCNGS................................. 126
223 8.000e-50JGI.Meta JGI_HUM.0635152 7003439368 C3693051__gene_200955 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159207311]  ali  17  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKNDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMRVTCNGS................................. 126
224 8.000e-50gi|500860009|ref|WP_012011420.1| flagellar biosynthesis protein FliS [Bacillus pumilus]  clstr ali  18  4.QNPYAAYQKNSIETATPAELTLMLYEGCLKFIRLAKYAIQKEDAETRNVNLKKAQNIIQELNVTLNRSYDVSKSMASMYDYIYRRLIEANFQNDEEMLNEVEQYVTDFRDAWKEVIQNDRKG.................................. 125
225 8.000e-50gi|653215065|ref|WP_027427702.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AD3010]  clstr ali  21  5..NAYAQYNRNKILTASPAELTLMLYDGCIKFINIAIMGIDEKDIAKANTNIKKAERIILELQSTLNEKYEVAKDFNAVYSYVKRRLLEANLSKDKEILEECAGHMRTMRDTWKEVMKTAH.................................... 123
226 8.000e-50JGI.Meta JGI_HUM.1111735 7078983616 C3331390__gene_218949 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763678604]  ali  16  16..NGYAAYANSKIMTASPAELTLMLYDGAIKFCNIAIAGIEENNIEKAHNNIRKVENIISEFQATLNHKYATADDFNNVYVYLKERLIEANMKKDKEILEEVLKHLRTMRDTWKEVMKLAAGQ.................................. 136
227 8.000e-50gi|510875738|ref|WP_016216408.1| hypothetical protein [Eubacterium sp. 14-2]  clstr ali  40  1MTQEKKQEFTRRLSCCNRGEMIVIIYDILFSHLEDALAAQEKGAYEEFREATGKAGQVVRRLMDDLDFSYPIAGELYPIYQFVSRLLALAVCKNTAQNIQDAQRILKELYESFVEAAKQDSSEPLMQHAQQVVAGMTYQKGSLTETVQGDSSRGFFA 158
228 9.000e-50gi|505173101|ref|WP_015360203.1| flagellar protein FliS [[Clostridium] stercorarium]  clstr ali  23  5...AYNQYRENSVYTASPEELTLMLYNGLIKFIMKAQNAISKKDIEGANENILRAQDIVSELMSTLDKKYEIANNLEMLYDFMLRRLIEANVKKSCEILDEVLEFAKELRDTWEQAMRIARKQ.................................. 124
229 1.000e-49METAHIT MH0077 GL0155208 [Complete] locus=scaffold10352_1:425:793:-  ali  18  4.NQAYAAYNNSKILTASPAELTLMLYDGAIKFANIAIMAIEKHDIEKAHNNIVKTERIILEFQATLDDKYPVAKDFDAVYTYLIQRLREANLKKDPEILEEVLKHLRTMRDTWKEVMAKA..................................... 122
230 1.000e-49gi|595762437|emb|CDO03256.1| Flagellar protein FliS [Oceanobacillus picturae]  clstr ali  19  3.TKQYQAYKNNAVNTASGGELTLMLYNGCIKFIKQASRNIENNDFEQKNTNIQKAQNIIQELMITLDQKVEISQQILPLYEYMHFQLKEANIKNDPAILQEVLDLTVDFRDTWKQVLQKSRQTTYTQGAQ........................... 131
231 1.000e-49METAHIT MH0020 GL0085693 [Complete] locus=scaffold8316_2:20297:20704:-  ali  18  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAMEKNDVQKAHDNIMKTEKIIEEFQATLDHKYPVAKDFEAVYSYLLKRLFDANIRKDPEILEEVLRHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
232 1.000e-49T2D.412183 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAMEKNDVQKAHDNIMKTEKIIEEFQATLDHKYPVAKDFEAVYSYLLKRLFDANIRKDPEILEEVLRHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
233 1.000e-49JGI.Meta JGI_HUM.1798983 7014787825 SRS050422_LANL_scaffold_35357__gene_52505 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  18  4.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAMEKNDVQKAHDNIMKTEKIIEEFQATLDHKYPVAKDFEAVYSYLLKRLFDANIRKDPEILEEVLRHLRTMRDTWKEVMAKTANGNNIKTKEPV......................... 134
234 1.000e-49gi|652500051|ref|WP_026894455.1| flagellar biosynthesis protein FliS [Clostridiisalibacter paucivorans]  clstr ali  17  5..NPYAQYQQNSVMTASPEELTLMLYNGAIKFIKQAKIFINEKQMENAHKSIVRAEDIIAELNITLNMDYEISENLRSLYTFILDRLTDANVQKSTDVLNEILPLVEDLRDTWQQAMKQAK.................................... 123
235 1.000e-49JGI.Meta JGI_HUM.1923324 7068730639 SRS015065_WUGC_scaffold_32618__gene_82136 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  18  9..SAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAELSVEKNDIPRAHENIRKVQNIIGYLHSTLDMKYEVSKDFDNIYSYLERRLVEANVKKDKEILEEINTHLHSIRDNWKEVMK....................................... 124
236 1.000e-49gi|517953062|ref|WP_019123270.1| hypothetical protein [Brevibacillus massiliensis]  clstr ali  21  2LQNPAQVYQNNQVTTATPGELTLMLYNGAIRFIKQTRQAILDKKLEKAHECNIRVQDILHELMSSLNRDVPISEQFITMYDYMLRRMVEANVRKDVEILDEVESLFGEFRDTWKEAMILAKKQ.................................. 124
237 1.000e-49gi|551037069|ref|WP_022780814.1| MULTISPECIES: flagellar biosynthesis protein FliS [unclassified Lachnospiraceae]  clstr ali  20  5..NPYAQYKNSKILTASPAELTLMLYEGAIKFGNIAIEAIENKEIEKAHNNIIRVQKIIDEFRATLNRKYPVAEEFDKIYRYLLRRLLEANATKDEEIMKEVVEHLRSMRDNWKEVMKKVKEE.................................. 125
238 1.000e-49JGI.Meta JGI_HUM.0590400 7070285893 C4471001__gene_327217 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 2 of subject 16015  ali  16  2..NPYAKYKENSINTATKEELTLMLYDGCIKFMNLAKIGIEEKNIQKANDNLLKAQAIITELDVTLNMDIEISKNMHSLYDFALSRLVDANLKKDTSFIDDAKIVIVDLRDAWKEAMNIVKRGK................................. 123
239 1.000e-49gi|494500710|ref|WP_007290173.1| flagellar biosynthesis protein FliS [Thermosinus carboxydivorans]  clstr ali  21  1MNNMANAYKTQQIMTAPPEQLTLMLYNGAIKFVDESIQAIEQRDFPKAHASNLRAQDIVRELMVTLDMQYEIAKTWYQLYDYILYRLIQGNIKKDKDQLQEARGMLQEFRDTWVEAMKRARAGQAAVG-QAV......................... 133
240 1.000e-49METAHIT MH0012 GL0074308 [Complete] locus=scaffold9472_3:724:1110:-  ali  18  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYTYLQQRLAQANIRKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
241 1.000e-49JGI.Meta JGI_HUM.0412397 7049091221 C5174509__gene_327218 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158499257]  ali  18  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYTYLQQRLAQANIRKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
242 1.000e-49T2D.2752953 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYSYLQQRLAQANIRKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
243 2.000e-49gi|647411307|ref|WP_025786023.1| flagellar biosynthesis protein FliS [Sporosarcina sp. D27]  clstr ali  21  3MHNPYATYQNNSVTTSTPGELTLMLYNGCLKFIEQAKRAADLGQIEQKNTAVQKAQAIISELMITLDASFPVAKDMLVLYEFANSRLVDGNIKNDAKLFDEAAEIITEFRDTWKQVIQLNRQKQYGNVSE........................... 132
244 2.000e-49gi|503548211|ref|WP_013782287.1| flagellar biosynthesis protein FliS [Mahella australiensis]  clstr ali  21  3LNNPYHQYQQNSIMTASPGDLILMLYDGAIKFIKQAKVYIDEKDMQKANNAILKAEDIVAELMADLDPAYDISHDLYSLYEFINDCLVRANIKKDKVLLDQSLDLISDMRQTWAQVVKQYR--------QQEYAGI..................... 130
245 2.000e-49gi|512486119|ref|WP_016429516.1| flagellar protein FliS [Paenisporosarcina sp. HGH0030]  clstr ali  17  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFIRLSKKAMTEKNYEVKNTNIIKAQNIIQELRITLNQEIEISNNMTQLYEYMHTRLVDANIKNNLEILEEVEGYVVELRDTWKQVIELAKK................................... 124
246 2.000e-49gi|547727493|ref|WP_022141663.1| flagellar protein FliS [Clostridium sp. CAG:230]  clstr ali  19  6..NAAQLYQKNSVQTASPSKIILMLYDGAIKFCHMAQVAIDEKNIEKANLNIQKAQKIIVQLRVSLDTKYPVSQEFDKVYDYIYRRLVEANMKKDNEILEEALKHIKTMRETWIEVMKKTHS................................... 125
247 2.000e-49T2D.2892238 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  30  1MTKECKQQFTLRITQANSTQLIVILYEMTLQYLADGEQAADD---AGLAEAVHRARGCIKELLNSLHREYSPAGELSRLYLFCLRRLAVCEVRRDRTILEEIRKVIAPLCDAYRQIQDQDTSGPVMNNSQTVYAGLTYGRNQLTENMADQTNRGMLV 155
248 2.000e-49gi|503844358|ref|WP_014078352.1| flagellar biosynthesis protein FliS [Roseburia hominis]  clstr ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAIEGIDANDIQKAHNNIMKVQRIIEEFQSTLDHKYPVAKDFDEVYNYLLMRLREANIKKDKDIMEEVLKHLRTMRDTWKEVMRTAHA................................... 124
249 2.000e-49gi|547741529|ref|WP_022155007.1| flagellar biosynthetic protein FliS [Firmicutes bacterium CAG:65]  clstr ali  18  5..SAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAELSVEKNDIPRAHENIRKVQNIIGYLHSTLDMKYEVSKDFDNIYSYLERRLVEANVKKDKEILEEINTHLHSIRDNWKEVMK....................................... 120
250 2.000e-49gi|547246858|ref|WP_021982582.1| flagellar biosynthetic protein FliS [Eubacterium sp. CAG:603]  clstr ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
251 2.000e-49METAHIT unmapped GL0294738 unmapped_[Complete]_[mRNA]_locus=C220145255_1:522:893:-  ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
252 2.000e-49T2D.2578470 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
253 2.000e-49gi|547564974|ref|WP_022111733.1| flagellar protein FliS [Roseburia intestinalis CAG:13]  clstr ali  15  4.NRGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVERIIEEFQSTLNHKYPVAKDFDEVYNYLLVHLQEANIKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
254 2.000e-49gi|651996699|ref|WP_026700734.1| flagellar biosynthesis protein FliS [Bacillus aidingensis]  clstr ali  19  1MNPPQQKYQQNALDTASSGDLTLLLYNGCIKFIDKADKAMEENNIEDKNKFIKRAQDIIRELMITLKTDSDIGQNMYSLYDFIHRRLIDANVQNDREALQEARGFVVDFRDTWKEIIKLDRQQRFGEGGQA.......................... 136
255 2.000e-49METAHIT MH0021 GL0099044 [Complete] locus=scaffold71977_1:2899:3285:+  ali  18  5..NAYTQYNNSKILTASPAELTLMLYEGAIKFCNIAEQAVEEKDIQKAHNNIRKVQNIIGYLQSTLDTRYPVAQDFINIYDYLSKRLVEANVKKDKEILEEINMHLHSVRDNWKEVMRINREK.................................. 125
256 2.000e-49T2D.429399 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  5..NAYTQYNNSKILTASPAELTLMLYEGAIKFCNIAEQAVEEKDIQKAHNNIRKVQNIIGYLQSTLDTRYPVAQDFINIYDYLSKRLVEANVKKDKEILEEINMHLHSVRDNWKEVMRINREK.................................. 125
257 2.000e-49gi|499202201|ref|WP_010899741.1| flagellar biosynthesis protein FliS [Bacillus halodurans]  clstr ali  16  3MKNPYQTYQTNKVETSSPAELTLMLYNGCLKFISQAQHAIENNAIEEKNTHLQKAQNIIRELMVTLKGDTELGKNMLALYDFILNRLTEANLENNLTKLSEAEDLVKQFRDTWKEALQIDRKKRHGNGGEA.......................... 133
258 2.000e-49METAHIT V1 GL0048967 [Lack 5`-end] locus=scaffold1472_1:2754:3164:-  ali  16  15..NGYAAYANSKIMTASPAELTLMLYDGAIKFCNMAIAGIEENNIEKAHNNIRKVENIISEFQATLNHKYATADDFNNVYVYLKERLIEANMKKDKEILEEVLKHLRTMRDTWKEVIKLAAGQ.................................. 135
259 2.000e-49T2D.2119835 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  15..NGYAAYANSKIMTASPAELTLMLYDGAIKFCNMAIAGIEENNIEKAHNNIRKVENIISEFQATLNHKYATADDFNNVYVYLKERLIEANMKKDKEILEEVLKHLRTMRDTWKEVIKLAAGQ.................................. 135
260 2.000e-49gi|551037548|ref|WP_022781288.1| hypothetical protein [Lachnospiraceae bacterium NK4A136]  clstr ali  33  1MTDELKQQFTRRITNANKSELIVILCDMFDIYVSDAKTAIEDGDTVVFKNNIRYARAVLSELIDSLNLEYELARNIYQLYRFVERYLIKADIKLDKTYLIPCLNIMRKMNESYEKIGKLDPSGPVMKNTEEVYAGMTYGRTDLNENMNTAYNRGYWA 157
261 2.000e-49METAHIT MH0002 GL0025518 [Lack 5`-end] locus=C3677093_1:3:530:+  ali  30  25........YAMRVSQASKSELIVIMYEVAVKYIDDALNAISQNNVEEFRQNVRKAKSFVNELASVLDLKYPISGNLLSLYTYMNNVMVKADITLRTEDLKRVKGMLSKLHAAFMEVSRQDNTKPMMSNVQQVYSGLTYSKNSLNDSYVADWNRGYKV 175
262 2.000e-49T2D.20602 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  30  25........YAMRVSQASKSELIVIMYEVAVKYIDDALNAISQNNVEEFRQNVRKAKSFVNELASVLDLKYPISGNLLSLYTYMNNVMVKADITLRTEDLKRVKGMLSKLHAAFMEVSRQDNTKPMMSNVQQVYSGLTYSKNSLNDSYVADWNRGYKV 175
263 2.000e-49METAHIT MH0014 GL0154645 [Complete] locus=scaffold6495_15:2431:2826:+  ali  17  9.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAIEAIDANDIQKAHNNIMKVQRIIEEFQSTLDHKYPVAKDFDEVYNYLLMRLREANIKKDKDIMEEVLKHLRTMRDTWKEVMRTAHA................................... 129
264 2.000e-49T2D.345613 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  9.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAIEAIDANDIQKAHNNIMKVQRIIEEFQSTLDHKYPVAKDFDEVYNYLLMRLREANIKKDKDIMEEVLKHLRTMRDTWKEVMRTAHA................................... 129
265 2.000e-49JGI.Meta JGI_HUM.1199522 7037928897 SRS014923_WUGC_scaffold_56857__gene_112648 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  17  9.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAIEAIDANDIQKAHNNIMKVQRIIEEFQSTLDHKYPVAKDFDEVYNYLLMRLREANIKKDKDIMEEVLKHLRTMRDTWKEVMRTAHA................................... 129
266 2.000e-49gi|511028801|ref|WP_016282986.1| flagellar protein FliS [Lachnospiraceae bacterium A4]  clstr ali  17  4.QNGYAQYQSAKIMTASPAELTLMLYDGAIKFGNIAILGMENNDPAKAHENIVKVEKIIQNFRDTLDRKYAVSKDFENVYVYLLRRCHEANINKDPEIMEEVLRHLRSMRDNWKEVMKKVAGDKSNPVAQARVAG...................... 137
267 2.000e-49gi|511031432|ref|WP_016285523.1| hypothetical protein [Lachnospiraceae bacterium 3-1]  clstr ali  38  1MTQEKKQEFTRRLSCCNRGEMIVIMYDILMSYLDEALEAQEKESYEEFRSAVGKAEQVVQRLKEDLDFTYPIASELYPLYQFVNKLLAFAVCKNTADYIHDAKKVLKNLYDGFVEAAKQDSSEPLMQHTQQVVAGMTYQKGSLTETLQGSESRGFFA 158
268 3.000e-49METAHIT MH0016 GL0090079 [Complete] locus=scaffold81267_6:575:1051:+  ali  38  3..KEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCKDSLAAAMYKRSLTEIENAEKMLQKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQEDKSRGFFA 158
269 3.000e-49gi|518372553|ref|WP_019542760.1| flagellar biosynthesis protein FliS [Selenomonas bovis]  clstr ali  21  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGIQGVKEKQWEAANNSLQKAQSIISEFRITLDMDYEISHQLMPLYNYTYDRLVEGNIKSDVAMLEEAKGIIKELRDAWAQAMKKARKEKGTQGVQN.......................... 132
270 3.000e-49gi|490756810|ref|WP_004619108.1| flagellar biosynthesis protein FliS [Clostridium papyrosolvens]  clstr ali  19  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDQRKIERANNSIIRAQDIVREFQVTLDMKYEVSKHLDSIYDYMYRRLIQANIKKDKAILEEMLEMAKDLRDTWTQAMKLAKRQ.................................. 125
271 3.000e-49gi|489446590|ref|WP_003352007.1| flagellar biosynthesis protein FliS [Bacillus methanolicus]  clstr ali  21  1MANQQQVYKQNSVSTASPGELTLMLYNGCLKFLAKMKQAIIEKNISERNVNSQKAQRIIQELMVTLNQEYEVAKQMMAMYDYMNRRLIEANVKNDVAIVEEVEGFVTEFRDTWKEVIRLNRQKQF................................ 127
272 3.000e-49T2D.3731737 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.NQGYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKNDIQKAHTNIIKTERIIIEFQSTLDEKYPVAKDFNAVYTYLIRRLRDANIKKDAEILEEVLKHLRTMRDAWKEVMAKTANG.................................. 125
273 3.000e-49JGI.Meta JGI_HUM.6623804 7006916546 SRS063215_LANL_scaffold_23823__gene_27119 flagellar protein fliS [Human Subgingival plaque microbiome from visit number  ali  19  4.NSAAEAYKKQQVLTATPEALTLMLYNGCLKFIKEGVDALAEKKYENANICLQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKSDPAIIQEATDIITELRDAWVQAMKTAREEKGAQGMEGVYAG...................... 139
274 3.000e-49METAHIT MH0060 GL0119060 [Complete] locus=scaffold67734_9:197:673:-  ali  35  1MTTEKKQMFTRKITQANRTQLVVIVYEMLLVYLEDARNAHEAKDREEFVHNLGLARECIGQMRTSLNFEYELSRNLFSLYCYADKELAKDIYGFKTDNLDVIQMIFTKLHDAYYTISSQDQSGPLMDNIQSVYAGLTYGRTDLNESLTNDVKRGFLA 158
275 3.000e-49T2D.1013518 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  35  1MTTEKKQMFTRKITQANRTQLVVIVYEMLLVYLEDARNAHEAKDREEFVHNLGLARECIGQMRTSLNFEYELSRNLFSLYCYADKELAKDIYGFKTDNLDVIQMIFTKLHDAYYTISSQDQSGPLMDNIQSVYAGLTYGRTDLNESLTNDVKRGFLA 158
276 3.000e-49gi|501157299|ref|WP_012201844.1| hypothetical protein [Lachnoclostridium phytofermentans]  clstr ali  35  1MNKDRLREFAVRVTQANQSQLIVILYDILEADLECATDAINAKDYKIYEKELRHASRVINQLMGALDYRYPLSYDLLSLYSYLNKKLVCAQMSRSNQDFPEILDLINDLRVGFLEVSKQDNSGPMMQNTQQIYAGLTYGKGTLNESSLNDINRGFKA 159
277 4.000e-49gi|517490146|ref|WP_018660723.1| flagellar biosynthesis protein FliS [Bacillus acidiproducens]  clstr ali  16  4.QNPYQAYQNNSISTASAGELTLMLYNGCLKFIHLARVAMQNKNIEEKNKNIQKAQNIIRELMVSLDTEKAAAEKMLAIYEFMLHELIAANIKNDPGKLDTVEELVTGFRDTWKQVIQLNRRQTFGSGGRA.......................... 134
278 4.000e-49gi|652787766|ref|WP_027092636.1| flagellar biosynthesis protein FliS [Cohnella thermotolerans]  clstr ali  20  1MITPQDQYLMMQVQTASPGELTLMLYNGCIRFLKLALAGIEAKDAANKHLNIIKAQNILEELQSTLNMNYEISANLFSLYDFIRSQLIHANLHMDAESIRTCIGLMTELRDTWAQAVKQVKSGQ................................. 124
279 4.000e-49gi|501009150|ref|WP_012062054.1| flagellar biosynthesis protein FliS [Alkaliphilus metalliredigens]  clstr ali  19  3MQNPYQQYKQNSVMTASPQELTLMLYNGALKFINVSKKNIDEKNIAKANESIQRVQSIIQELNITLDMNYEVSKNLRSLYTYILERLVDANMQKDMNALEEAAQMITELRDTWKDAMKQAR.................................... 123
280 4.000e-49gi|651366683|ref|WP_026478988.1| flagellar biosynthesis protein FliS [Alkaliphilus transvaalensis]  clstr ali  19  1MQNPYSQYKENSIKTASPQELTLMLYNGALKFINQGKLFIEQKNFASANEALKRAQDVITELNITLDMNYEISQNLRGLYTYLLDQVIEANITKNIAPLDEAASMVTELRDTWKEAMKLAK.................................... 121
281 4.000e-49gi|651936533|ref|WP_026672359.1| flagellar biosynthesis protein FliS [Bacillus bogoriensis]  clstr ali  18  8....AAAYKQNTLNTASPGELTLMLYNGCLKFIKQGKTGIENNDIEMRNINIKKAQDIIRELMVTLETNSDLGKNMMRIYDFVLSRLVDANIKNDVQALNEAEQFVTEFRDTWKQVIQIDRQQRHGSGGQA.......................... 134
282 4.000e-49T2D.4182822 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  6..NAAQLYQKNSVQTASPAKIILMLYDGAIKFCHMAQVAIDEKNIEKANLNIQKAQKIIVQLRVSLDTKYPVSQEFDKVYDYIYRRLVEANMKKDNEILEEALKHIKTMRETWIEVMKKTHS................................... 125
283 5.000e-49T2D.3823258 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  1MNNGYAAYANSKIMTATPAELTLMLYEGAIKFCNIAIMGIEEKDIEKTHNNIKKVENIITEFQVTLDHKYPVADDFDNVYKYLKDRLLEANVKKDKDILEEVLGHLRTMRDTWK........................................... 116
284 5.000e-49gi|493689193|ref|WP_006639249.1| flagellar protein FliS [Bacillus sonorensis]  clstr ali  18  3LNNPYAAYQQNSINMKSPGELTLMLYDGCLKFMKLAKQAMEQGDMEMKNTNLVKAQKIIQELNLTLNREVELSQSMGAMYEYIHRRLIEANINNDQDIVSEVEGYVNDFRDAWKQAIQIERQGRYGTGGRA.......................... 133
285 5.000e-49gi|651393337|ref|WP_026505121.1| hypothetical protein [Butyrivibrio sp. NC3005]  clstr ali  28  1MNQEKKQEYTRRIVEANGTQMITILYEMTLDYLEDAALAMDLNDIHSADREINRAQSCINELMHSVNLSTDLGINFFQIYMFARRQLITASAKRDKGCIDIVHSLFEKLKDSYKELEKYDDSPSSMDGAQAVFAGLTYGPGQLNETVSDYVKRGYEA 158
286 5.000e-49gi|501153642|ref|WP_012198343.1| flagellar biosynthesis protein FliS [Lachnoclostridium phytofermentans]  clstr ali  19  3.QNAASIYQGTKINTASPAELTLMLYEGAIKFCNKALYGLEQNDIAKVNENLLKAQKIVTELRSTLDFKHPIAREFDTVYDYINRRLVDANIKKDTEILEEALDYIRQMRDTWKEVMKKNN.................................... 122
287 5.000e-49JGI.Meta JGI_HUM.1768320 7012167621 SRS055378_LANL_scaffold_76977__gene_92803 flagellar protein fliS [Human Supragingival plaque microbiome from visit numbe  ali  23  3.NNAAEVYKKQQVMTATPEALTLMLYNGCLKFIKEGLEALDEKNYENANIFFQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKGDPAIIKEADDIMLGLRDAWSGAMKKAREEKGMQGAEGVYAG...................... 138
288 5.000e-49JGI.Meta JGI_HUM.0995279 7002088620 SRS022725_LANL_scaffold_94891__gene_212160 flagellar protein fliS [Human Supragingival plaque microbiome from visit numb  ali  34  4...ESVKIYTRRITSANKSEIIVIMYDIIEENLTLAEEAINKGDRVTFKNELKQAVSFVKELLVSLDMSYEVSKNLASLYIYVSRCLNFALVSGKKEEIEAARKVLRKLGDSFREVAKTDKSEPVMGKTQQVYAGITYGKGSLDETLIDSENRGFRA 160
289 5.000e-49METAHIT MH0006 GL0256325 [Complete] locus=scaffold245262_5:342:728:+  ali  18  5..SAYAQYNNSKVLTASPAELTLMLYEGAIKFCNVAIDSVERKDIAKAHTNIVKVENIIDYLRKTLDMKYPVAQDFERMYVYLDQRLVEANVKKDVEILEEIRDHLHAIRDNWKEVMRVNREK.................................. 125
290 5.000e-49T2D.105170 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  5..SAYAQYNNSKVLTASPAELTLMLYEGAIKFCNVAIDSVERKDIAKAHTNIVKVENIIDYLRKTLDMKYPVAQDFERMYVYLDQRLVEANVKKDVEILEEIRDHLHAIRDNWKEVMRVNREK.................................. 125
291 6.000e-49gi|497332127|ref|WP_009646340.1| flagellar biosynthesis protein FliS [Selenomonas sp. CM52]  clstr ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVQGNLSSDTGKIDEAAGIIRELRDAWAQAMKKARAEKSGE.............................. 128
292 6.000e-49gi|489558106|ref|WP_003462653.1| flagellar protein FliS [Gracilibacillus halophilus]  clstr ali  16  4..QQYQAYQNNSVETASPSELTLMLYNGCIKFIKQAKKAIDEGNIQDRNNYIQRAQNIIRELMVTLDQDAPIAQEIMPLYDFVHYNLTQGNVNNNKEALQEAEDIVVDFRDTWKEVIKQERKRTYGQGT............................ 130
293 6.000e-49gi|501110735|ref|WP_012160328.1| flagellar biosynthesis protein FliS [Alkaliphilus oremlandii]  clstr ali  19  3MNNPYGQYKQNSVMTASPQELTLMLYNGALKFIGMAKINIQEKDIPKANESIKRAQDIIQELNITLNMDYPISTNLRSMYTYILEKLVDGNIYKEIQYLDEAAEIITELRDTWKEAMKISKGGK................................. 126
294 6.000e-49gi|547467121|ref|WP_022086057.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:197]  clstr ali  18  4.NQAYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKHDIEKAHNNIVKTERIILEFQATLDDKYPVAKDFDAVYTYLIQRLREANLKKDSEILEEVLKHLRTMRDTWKEVMAKA..................................... 122
295 6.000e-49JGI.Meta JGI_HUM.1226708 7038083383 C3305165__gene_267134 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763860675]  ali  18  4.NQAYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKHDIEKAHNNIVKTERIILEFQATLDDKYPVAKDFDAVYTYLIQRLREANLKKDSEILEEVLKHLRTMRDTWKEVMAKA..................................... 122
296 7.000e-49gi|495157836|ref|WP_007882639.1| MULTISPECIES: flagellar biosynthesis protein FliS [Roseburia]  clstr ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
297 7.000e-49METAHIT MH0067 GL0002281 [Complete] locus=scaffold4036_1:1053:1430:-  ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
298 7.000e-49T2D.1146246 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
299 7.000e-49JGI.Meta JGI_HUM.2278066 7052155733 C3652736__gene_267794 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 765074482 replicate  ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
300 7.000e-49METAHIT MH0026 GL0075529 [Complete] locus=scaffold12896_16:295:762:+  ali  30  1MTKECKQQFTLRITQANSTQLIVILYEMTLQYLADGEQAADD---AGLVEAVHRARGCIKELLNSLHREYSPAGELSRLYLFCLRRLAVCEVRRDRTILEEIRKVIAPLCDAYRQIQDQDTSGPVMNNSQTVYAGLTYGRNQLTENMADQTNRGML. 154
301 7.000e-49gi|511038544|ref|WP_016292562.1| flagellar protein FliS [Lachnospiraceae bacterium 28-4]  clstr ali  19  5..NRYEQYSSNKVMTASPAELTLMLYEGAIKFCNIAIMGLEQSDIEKAHNNMIKTEKIIRYLRETLDMKYPVAQEFENIYVYLDRRLVEANMKKDKEILDEICEHLRSVRDTWKEVMRINREK.................................. 125
302 7.000e-49METAHIT V1 GL0070799 [Complete] locus=scaffold6136_3:1487:1873:+  ali  17  4.NNAYQAYNNSKIMTASPAELTLMLYEGAIKFCNIAIMGVEEKDVEKAHTNIMKVERIIEEFQATLDHKYAIAEDFDNVYKYLQERLAEANMKKDKEILEEILTHLRTMRDTWKEVMRLNK.................................... 123
303 7.000e-49T2D.2218613 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  4.NNAYQAYNNSKIMTASPAELTLMLYEGAIKFCNIAIMGVEEKDVEKAHTNIMKVERIIEEFQATLDHKYAIAEDFDNVYKYLQERLAEANMKKDKEILEEILTHLRTMRDTWKEVMRLNK.................................... 123
304 7.000e-49METAHIT MH0014 GL0005383 [Complete] locus=scaffold307_1:572:958:-  ali  19  6...GYQQYEKNKILTASPAELTLMLYDGAIKYANIAIMAIDKGDVEKAHNSIRRVERIIEEFQNTLDFKYPVAKDFDEVYKYIMTRLREANVKKDKEIIEEVLKHLRTMRDTWKEVIQLSRN................................... 124
305 8.000e-49METAHIT MH0080 GL0089093 [Complete] locus=scaffold94382_1:726:1106:-  ali  15  4.NRGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDVQKAHDNIMKVERIIEEFQSTLNHKYPVAKDFDEVYNYLMVRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
306 8.000e-49T2D.1381185 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  15  4.NRGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDVQKAHDNIMKVERIIEEFQSTLNHKYPVAKDFDEVYNYLMVRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
307 8.000e-49METAHIT MH0023 GL0002506 [Complete] locus=scaffold7399_1:2107:2493:-  ali  20  6...AYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEMAVEKSDVPKAHENIRKVQNIIGYLHSTLDMKYEVAKDFDNIYNYLERRLVEANVKKDKEILEEINMHLHSIRDNWKEVMK....................................... 120
308 8.000e-49T2D.445016 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  6...AYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEMAVEKSDVPKAHENIRKVQNIIGYLHSTLDMKYEVAKDFDNIYNYLERRLVEANVKKDKEILEEINMHLHSIRDNWKEVMK....................................... 120
309 8.000e-49JGI.Meta JGI_HUM.0608273 7003294222 SRS024132_Baylor_scaffold_27413__gene_55809 flagellar protein fliS [Human Stool microbiome from visit number 2 of subjec  ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANNNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
310 8.000e-49gi|497214887|ref|WP_009529149.1| flagellar biosynthesis protein FliS [Peptostreptococcaceae bacterium CM5]  clstr ali  18  4..NPYAKYKENSINTASKEELTLMLYDGCIKFMNLAKIAIEEKNIQKANDNLLKAQAIVTELDITLNMDIEISKNLHSLYDFVQNRLIEANLTKKASFVDEAKLIITDLRDAWKEAINLVRRGK................................. 125
311 8.000e-49JGI.Meta JGI_HUM.1204670 7037942878 SRS014923_WUGC_scaffold_59614__gene_126629 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  15  4.NKGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVEHIIEEFQSTLNHKYPVAKDFDEVYNYLMMRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
312 9.000e-49JGI.Meta JGI_HUM.1396172 7016908315 SRS052697_LANL_scaffold_59313__gene_116062 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  31  2...........RVSQASKSELIVIMYEVAVKYIDDALNAISQNNVEEFRQNVRKAKSFVNELASVLDLKYPISGNLLSLYTYMNNVMVKADITLRTEDLKRVKGMLSKLHAAFMEVSRQDNTKPMMSNVQQVYSGLTYSKNSLNDSYVADWNRGYKV 149
313 9.000e-49gi|547270852|ref|WP_022004958.1| flagellar protein FliS [Firmicutes bacterium CAG:194]  clstr ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
314 9.000e-49METAHIT MH0006 GL0273905 [Complete] locus=scaffold319591_1:921:1310:+  ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
315 9.000e-49T2D.2960316 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
316 9.000e-49gi|651380728|ref|WP_026492890.1| hypothetical protein [Butyrivibrio sp. XPD2002]  clstr ali  30  1MTQEKIQVYTRRITMANKTQMITILYEMVLDYLAEAKDALELDDKKGFSEGLSKAMNCIDELIHSLNLNYELGKNLLALYLFEKRQILIATAKNSDEELDHVNKTFEALHSAYVQLEKMNNDEALMTNVPKVYAGLTYGKGNLKESFADNMSRGYMA 158
317 1.000e-48METAHIT MH0048 GL0045021 [Complete] locus=scaffold45976_1:289:765:-  ali  40  1MEKEKITEFTRRISQCNRSGLTLITYEICFVHCVDAKKAYAQKEHEVFKKEVQKASECVNRLMETLNFEYEIAKELYPVYRFCRDELAMALVKNDISRVENAEKILKNLYGAFEEVSKEDYSRPLMENSEKVIAGMTYQKNNLTENYIGNESRGFLA 158
318 1.000e-48T2D.813648 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  40  1MEKEKITEFTRRISQCNRSGLTLITYEICFVHCVDAKKAYAQKEHEVFKKEVQKASECVNRLMETLNFEYEIAKELYPVYRFCRDELAMALVKNDISRVENAEKILKNLYGAFEEVSKEDYSRPLMENSEKVIAGMTYQKNNLTENYIGNESRGFLA 158
319 1.000e-48JGI.Meta JGI_HUM.0734505 7045156997 C3745423__gene_283094 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158337416]  ali  40  1MEKEKITEFTRRISQCNRSGLTLITYEICFVHCVDAKKAYAQKEHEVFKKEVQKASECVNRLMETLNFEYEIAKELYPVYRFCRDELAMALVKNDISRVENAEKILKNLYGAFEEVSKEDYSRPLMENSEKVIAGMTYQKNNLTENYIGNESRGFLA 158
320 1.000e-48gi|517983601|ref|WP_019153809.1| flagellar biosynthesis protein FliS [Bacillus massiliosenegalensis]  clstr ali  19  4.QQVQNAYKQNSVNTASPGELTLMLYNGCLKFLQKGKQAMKDKNIEEKNKNLQKAQKIIQELMITLNQDYGIAKEMMQMYEYMNRRLIDANVQNSVEILEEVEGYVNEFRDTWKEVIRLNRQKLYQGN............................. 130
321 1.000e-48gi|489420996|ref|WP_003326733.1| flagellar biosynthesis protein FliS [Bacillus atrophaeus]  clstr ali  17  4.QNPYTAYQQNSINTATPGELTLMLYNGCLKFIKLANQAIHLGDMESKNVNLIKAQNIIQELNITLNRDIELSGSMGAMYEYIHRKLVEANIQSDKDILAEIEGYITDFRDAWKQAIQIERKDRHGSGG............................ 131
322 1.000e-48gi|551011049|ref|WP_022755560.1| hypothetical protein [Butyrivibrio fibrisolvens]  clstr ali  27  1MTKEQINSYTRRISEANETQMITILYEMTLDYLADAKKALFAKDYDRYDVELTRAQNCITELIRSLNMNYEIAHTFMQLYIFAKRHLITAAIRREGDYIDDIISIFEKMRNCYKELEKLNEAASVIEGAQHVFAGLTYGPGHLNETVADYTNRGYRA 158
323 1.000e-48gi|515948415|ref|WP_017378998.1| hypothetical protein [Paenisporosarcina sp. TG-14]  clstr ali  19  4.KNPYEVYQKNSVMTASPQELTLMLYSGCLKFIKLAKKAMVEKNFEVKNTNIIKAQAIIQELRVTLNQEIEISKNMAQLYDYMYNRLVDANMKNDLETLQEVEGYVVEMRDTWKQVMGLVKK................................... 124
324 1.000e-48gi|498366998|ref|WP_010681154.1| flagellar biosynthesis protein FliS [Acetivibrio cellulolyticus]  clstr ali  21  4.NNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQSQMGINEKNIEKANNCIIKAQNIISEFRCTLDMKYEISKQLELIYDYMNRRLIEANIKKDVTIVEEILGYARELRNTWEQAMKIARQQ.................................. 125
325 1.000e-48gi|489243206|ref|WP_003151407.1| MULTISPECIES: flagellar biosynthesis protein FliS [Bacillus]  clstr ali  14  4.NNPFAAYQQTSVFTAAPEELTLMLYNGCLRFIKLARQAMKQNNLEAKNENIVKAQNIIQELSITLNREIEISEQMSSIYDYIRRRLIDANVQNNGEFLDEAEKLVTEFRDTWKQAMQSERKNSHGAGG............................ 131
326 1.000e-48gi|502886625|ref|WP_013121601.1| flagellar biosynthesis protein FliS [Thermincola potens]  clstr ali  23  1MQNPYSQYKQISVQTASPEQLVVMLYDGAIKFLHLAKEAVARKNMEDTNKYIGKTQDIINEFIVSLDMSAEIAHNLYNIYDYWNRRLIQANIKKDPDIIAEVLGQVQELREVWAEAAVKSKEGK................................. 126
327 1.000e-48METAHIT V1 GL0075555 [Lack 3`-end] locus=scaffold31231_4:147:620:+  ali  43  1MDNSLKQDFTRRLSQCNSGGMIVIIYEIGFAYMHDARKAYESGNHDEMKASIRKAQKVLDELIGSLNFAYEISNNLYSLYMFCKNELARVLYENRLNGLEEAEKIMRRLYHSFAEAAKGDTSAPIMSNTQQIYAGMTYGRNQLNENDMNYDNRGFLV 158
328 1.000e-48T2D.1802774 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  43  1MDNSLKQDFTRRLSQCNSGGMIVIIYEIGFAYMHDARKAYESGNHDEMKASIRKAQKVLDELIGSLNFAYEISNNLYSLYMFCKNELARVLYENRLNGLEEAEKIMRRLYHSFAEAAKGDTSAPIMSNTQQIYAGMTYGRNQLNENDMNYDNRGFLV 158
329 1.000e-48gi|547967479|ref|WP_022367455.1| flagellar biosynthetic protein FliS [Firmicutes bacterium CAG:882]  clstr ali  18  1MNTPYQQYEKSKILTASPAELTLMLYEGAIKFANIAVMAIEKGDVEKAHNNIRKVERIIEEFQVTLNHKYPVAKDFDEVYKYLQQRLLEANIKKDKVIMEEVLRHLRTMRDTWKDVMRLAKTQ.................................. 125
330 1.000e-48gi|651376991|ref|WP_026489209.1| hypothetical protein [Butyrivibrio sp. XBB1001]  clstr ali  29  1MTQEKKQEYTLKITQANKTQMITILYEMVLEYIADAKAAISTGNRTLSDRNIGYAQNCIDELIRSVNLRTELGKMLHKLYIFSKKELMLAGVNMSTSRLQRVERNFKALHAAYKEIESIDKSEPTMGNTQSVYAGLTYGRYSLNESVKDSSNRGFMA 158
331 2.000e-48gi|652439969|ref|WP_026835008.1| flagellar biosynthesis protein FliS [Eubacterium xylanophilum]  clstr ali  18  3.TNMADSYKTNAILTASPAELTLMLYDGAIKFCNIALIALEKNDYGKCNENLKRAQDIILEFRITLDHKYPVWEDFDRVFEYIYNCLIDGNIHKDKEMIEEGLGRIREMRDTWKEVMQLNNQK.................................. 124
332 2.000e-48gi|505363383|ref|WP_015550485.1| flagellar biosynthetic protein FliS [Butyrivibrio fibrisolvens]  clstr ali  20  1MTNGYDAYAKNRILTASPAELTLMLYEGAIKFCNIAIVACENKDIEKAHINIRKTDRIIEEFEITLDDKYPVAKDFHAVYTYLRSCLRHAMIDKDPETLQEVLKHLRTMRDAWKDVMKLTANGKKLDG-QTNIAG...................... 136
333 2.000e-48gi|635344655|emb|CDQ26193.1| Flagellar protein FliS [Halobacillus trueperi]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKVAGKAMENNEIEKKNTHIQKAQKIIQELMVTMDQQYSLTQEIMPLYDYMNRRLMEANTKNDNEILDEVLGLVEEFRNTWKQVILEARKAQYGQGG............................ 127
334 2.000e-48gi|653619916|ref|WP_027630251.1| flagellar biosynthesis protein FliS [Clostridium cellobioparum]  clstr ali  20  4.NNGYDQYKSNSINTATPEELTMMLYNGLVKFLMQAQSAIDAKNIERANNSIIKAQAIIIEFMTTLDMNYEVSQNLELLYDYMYRQLTQANLKKDNVIVGDVLGMAKELRDAWSQAMKLAKHPAPVQ.............................. 129
335 2.000e-48JGI.Meta JGI_HUM.1588068 7027187619 C5146565__gene_209573 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765074482]  ali  32  1MDKENKKIYTTRISQANRSELVVIIYELMLESLAEAGQAFEKEDFDTADVELKRVQGFLCELRGSLDFQFPVSYRLASLYRYVNEQLVKSITRKKNVGLASCERVLQGLKESFEEIAKQDTSGPVMENSQQVYAGLTYGKGSLNEVTIDPG...... 151
336 2.000e-48gi|504023012|ref|WP_014257006.1| flagellar biosynthesis protein FliS [Clostridium clariflavum]  clstr ali  23  4.NNGYEQYRESSVYTATPEELVLMLYNGLVKFLMQAQMAINKKNIEKANNCIIKAQNILTEFRCTLDMKYDIAHQLDSLYDYMLSRLIDANIKKDNTIIEEILGYARELRNTWEQAMKIAKQQ.................................. 125
337 2.000e-48gi|518207541|ref|WP_019377749.1| flagellar biosynthesis protein FliS [Virgibacillus halodenitrificans]  clstr ali  21  3LNKQYQTYQNNAVNTASGGELTLMLYNGCMKFIKQAIKDLENKNYEAKNTNIQKAQNIIQELMLTLDQKVEISKQILPLYEFMQFQLREGNIKNDPSLLIEALEFITEFRDTWKEVMLKNKKAQPVQGAQ........................... 132
338 2.000e-48JGI.Meta JGI_HUM.0193915 7004114525 C4094048__gene_185454 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160400887]  ali  16  4.NNAYQAYNNSKIMTASPAELTLMLYEGAIKFCNIAIMGVEEKNVEKAHTNIMKVERIIEEFQATLDHKYAIAEDFDNVYKYLQERLAEANMKKDKEILEEILTHLRTMRDTWKEVMRLNK.................................... 123
339 2.000e-48gi|503138713|ref|WP_013373374.1| flagellar biosynthesis protein FliS [Paenibacillus polymyxa]  clstr ali  21  3.TSPYEKYRQSSVQTSTPSQLVVMLYDGAIRFVKAGLVALDSKDYQKVNLNLGKAQTIISELMSTLDHSYDISKSLFALYEYMNYLLIQANIKKSADPANEALGYLTELRETWVQASKLTAGAA................................. 125
340 2.000e-48gi|547727239|ref|WP_022141420.1| putative uncharacterized protein [Clostridium sp. CAG:230]  clstr ali  35  1MTQTQKKEYTARVAQANRSELVVIIYELFFIAMDEAEQAFKKGKLEEGVKEIKRAEGFLQELMGSLDKRYEVAQNLMNLYRYVYEQLIFSVIRRKMVHADTVREVMGKLKDAFIEVAKEDDSAPVMENTQQLYAGLTYGKGALNEVLLSDDNRGYR. 158
341 2.000e-48gi|547566103|ref|WP_022111842.1| putative flagellar protein FliS [Roseburia intestinalis CAG:13]  clstr ali  40  1MKKEQIMDFTRRISQSNRGGLVIVIYDIFFAYMEDTKEAHDNGEWENYKTALRNASKTISELISSLDFSYELAGELYRIYVFCRETLAKAMYKRDLKEVELAENLMKKLYTAFAEVMKEDTSAPLMRNTQQIYAGYTYGKNDLVETYQDDTSRGFLV 158
342 3.000e-48gi|499663175|ref|WP_011343909.1| flagellar biosynthesis protein FliS [Carboxydothermus hydrogenoformans]  clstr ali  23  1MNNPYAQYQTQNIATAPPEKLLIMLYDGAIKFLKQGLKALDEKKYDDFSYYISRTQDIISELMVTLDMDYEISKNLYQLYDYFMYRLIHGNVKKDRQSIEEVQKHLEELRETWVQAA........................................ 117
343 3.000e-48gi|651901097|ref|WP_026656232.1| hypothetical protein [Butyrivibrio sp. AE3003]  clstr ali  27  1MTQEKKQEFTLKISQANKTQLITILYEMVIEYLNDAIDEIGIGKKDEANKYLGYAQNCIDELIRSLDLRYELAKNLHAIYIFSKKELMVAGVNYSSHKIWRVVQNFKCLKEAYKEIEKYDTSCPMMGNTQKVYTGLTYGRHLMNEDLMVCANRGYMA 158
344 3.000e-48gi|652827516|ref|WP_027113237.1| hypothetical protein [Lachnospiraceae bacterium NK4A144]  clstr ali  29  1MTDEMKQEFTRRITAANRTEMVVITYEIALEYLKEADEA---GSGESFYEAVKHAKRCVEQLRSVLDYNYEISHTLMRLYNFISEELDRAVMRNDPSCYAESRKILTELHDAWDEISDQDDSGQMMQNTEKVYAGLTYGREGAAESTADPV-RGFTV 153
345 3.000e-48gi|547816947|ref|WP_022225745.1| putative uncharacterized protein [Clostridium sp. CAG:253]  clstr ali  31  1MTTEEKRRFTARISQANKSELVVIVFEMFDYCIEQAEDGFKSGDLQKAEKYLKSAKGCVSELRGSLDLKYELSYNLHNIYSFVNKQLTASIVKREPVNLDNVKENMGKLCKAFEEVAKQDTSKSVVQNSQQVYAGLTYGKGTLNEVFMDNEARGFKA 158
346 4.000e-48T2D.4182927 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  35  7MTQTQKKEYTARVAQANRSELVVIIYELFFIAMDEAEQAFKKGKLEEGVKEIKRAEGFLQELMGSLDKRYEVAQNLMNLYRYVYEQLIFSVIRRKMVHADTVREVMGKLKDAFIEVAKEDDSAPVMENTQQLYAGLTYGKGALNEVLLSDDNRGYR. 164
347 4.000e-48gi|493741206|ref|WP_006690311.1| flagellar biosynthesis protein FliS [Selenomonas flueggei]  clstr ali  19  3.NSAAEAYKKQQILTATPEALTLMLYNGCLKFIKEGSDALAEKNYEAANISLQKAQNIISEFRVTLNMDYEISHQLMPLYNYAYDRLVEGNLDNNFDAIKEATDIITELRDAWAQAMKKAREEKGRQGTEGVYAG...................... 138
348 4.000e-48gi|548369866|ref|WP_022518113.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:100]  clstr ali  18  4.QNGYAQYQNSKIMTASPAELTLMLYEGAIKFGNIAIMAMENKDPAKAHENVVKVEKIVQNFRETLDKRYPIWEDFEKIYAYLLRRCHEANIAKDPEIMQEVVDHLRSMRDNWKEVMKSVATNQNNPAAQSKIAG...................... 137
349 4.000e-48METAHIT MH0039 GL0017862 [Complete] locus=scaffold42974_7:2379:2840:+  ali  18  4.QNGYAQYQNSKIMTASPAELTLMLYEGAIKFGNIAIMAMENKDPAKAHENVVKVEKIVQNFRETLDKRYPIWEDFEKIYAYLLRRCHEANIAKDPEIMQEVVDHLRSMRDNWKEVMKSVATNQNNPAAQSKIAG...................... 137
350 4.000e-48T2D.677748 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.QNGYAQYQNSKIMTASPAELTLMLYEGAIKFGNIAIMAMENKDPAKAHENVVKVEKIVQNFRETLDKRYPIWEDFEKIYAYLLRRCHEANIAKDPEIMQEVVDHLRSMRDNWKEVMKSVATNQNNPAAQSKIAG...................... 137
351 4.000e-48gi|517760788|ref|WP_018930996.1| hypothetical protein [Gracilibacillus lacisalsi]  clstr ali  18  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQAKKAIESQNHQSKNEMIQKTQDIIRELMVTLDQDAPIANEIMPLYDFVYHALTQANIKNDLEQLEQAREIIENFRDTWKEVIKQERIRQHGQGV............................ 130
352 4.000e-48CGD_mc16b.704752 GCGJX3R02JO3TI|GCGJX3R02JO3TI|metagene|gene_1  ali  16  6.KNPYAAYNNSKIQTATPAELTLLLYEGAIKFTNIAIVAIEKGDIEKAHNNIRKAENIIREFQITLDHKYAVAKDFDAVYTYLLQRLLEANMKRNKDILEEVLGHLRTMRDTWKKLCKTATE................................... 126
353 5.000e-48gi|648228602|ref|WP_026009751.1| flagellar biosynthesis protein FliS [Bacillus endophyticus]  clstr ali  20  3MNNAYQAYQQGSVNTATPGELTLMLYNGCLKFIRRAKTAIENREVEEKNKNLIKAQNIITELMVTLRTGSELSDQMRTMYDYINQRLMKANIESSVDILEEVESYVMEFRDTWKEVIQKTRS................................... 124
354 6.000e-48gi|547325689|ref|WP_022056699.1| putative uncharacterized protein [Clostridium sp. CAG:167]  clstr ali  34  1MDKKVLQEFATRVTQANPSELVVVIYEAAIASMKEGKKALCDQKIEEARKELERARGMLDELMRSLDMQYSISHYLRQLYIFAYRELCQSVALRQPERVDHAMDILEQLLPSFKEVAKQDDREAVMQNVQSIYAGLTYGPGSLNETMGNGTNRGFEA 160
355 6.000e-48METAHIT V1 GL0107526 [Complete] locus=scaffold1560_3:1528:2010:+  ali  34  1MDKKVLQEFATRVTQANPSELVVVIYEAAIASMKEGKKALCDQKIEEARKELERARGMLDELMRSLDMQYSISHYLRQLYIFAYRELCQSVALRQPERVDHAMDILEQLLPSFKEVAKQDDREAVMQNVQSIYAGLTYGPGSLNETMGNGTNRGFEA 160
356 6.000e-48T2D.2138754 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  34  1MDKKVLQEFATRVTQANPSELVVVIYEAAIASMKEGKKALCDQKIEEARKELERARGMLDELMRSLDMQYSISHYLRQLYIFAYRELCQSVALRQPERVDHAMDILEQLLPSFKEVAKQDDREAVMQNVQSIYAGLTYGPGSLNETMGNGTNRGFEA 160
357 6.000e-48gi|489639562|ref|WP_003544002.1| flagellar biosynthesis protein FliS [Desulfotomaculum nigrificans]  clstr ali  19  4.KNPYQNYQQNAIMSAGPEELTTMLYNRLVKDLKLAREHVENRDIEGAHSSIVHAQDILSHLMHTLDTSYEVGQNLMAMYDYMYRCLVQANLKKDANLIQEVTGYAEEIRDTWIQAVKLAKSSAAMGN............................. 130
358 6.000e-48gi|502941062|ref|WP_013176038.1| flagellar biosynthesis protein FliS [Syntrophothermus lipocalidus]  clstr ali  22  6..NAYQQYRNSTVETASPGALLLMLYDAAIQNLEGAKRAIEGNDMAGAHNYLTRAQDIVLELMSTLNMEYQISKSLWSLYDYLYRQLVQANVKKSVELVEEVYGFMTELRDTWREAVRKAGRTAAVSGG............................ 132
359 7.000e-48gi|548219072|ref|WP_022438264.1| flagellar protein FliS [Clostridium sp. CAG:411]  clstr ali  20  7...AANAYQGTRINTASPAELTLMLYDGAIKFCNIGMVALEKGDYEKANLNIQKAKKIIVQFRNDLDFNYPVAQDFDRVYEYIYYTLVDANVKKDKELLEEALGRIREMRDTWKQVMDKVKNG.................................. 126
360 8.000e-48METAHIT MH0058 GL0063440 [Lack 5`-end] locus=scaffold30832_3:3:548:+  ali  31  24LTTEEKRRFTARISQANKSELVVIVFEMFDYCIEQAEEGFKSGDLQKAEKYLKSAKGCVSELRGSLDLKYELSYNLHNIYSFVNKQLTASIVKREPVNLDNVKENMGKLCKAFEEVAKQDTSKSVVQNSQQVYAGLTYGKGTLNEVFMDNEARGFKA 181
361 8.000e-48T2D.974434 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  31  24LTTEEKRRFTARISQANKSELVVIVFEMFDYCIEQAEEGFKSGDLQKAEKYLKSAKGCVSELRGSLDLKYELSYNLHNIYSFVNKQLTASIVKREPVNLDNVKENMGKLCKAFEEVAKQDTSKSVVQNSQQVYAGLTYGKGTLNEVFMDNEARGFKA 181
362 8.000e-48gi|40889902|pdb|1VH6|A Chain A, Crystal Structure Of A Flagellar Protein  clstr ali model  17  6.QNPYTAYQQNSVNTATPGELTLXLYNGCLKFIRLAAQAIENDDXERKNENLIKAQNIIQELNFTLNRNIELSASXGAXYDYXYRRLVQANIKNDTGXLAEVEGYVTDFRDAWKQAIQSERKDRHGSGG............................ 133
363 9.000e-48gi|506236525|ref|WP_015756300.1| flagellar biosynthesis protein FliS [Desulfotomaculum acetoxidans]  clstr ali  20  5..NPYQQYQQNSITSAKPGQLTLMLYNGAIKFIKTAILGMEKKDIGTANGAVIRAQEIIRYLDHTLDPQYEISQNLSSLYDYIYRRLVEANINKNAAVLEEVVSMVEELRDTWMSVLKKT..................................... 122
364 9.000e-48gi|499379315|ref|WP_011066893.1| flagellar biosynthesis protein FliS [Oceanobacillus iheyensis]  clstr ali  22  4.NNAYQVYQNNSVNTASNGELTLMLYNGCMKFIKQAKKDMEADNFAEKNKNIQKAQNIIQELMITLDAKMDISKQILPLYEYMQYQLKEANIHNDTSKLDEVLGFVTEFRDTWKQVIIKNRQQQYNEGA............................ 131
365 1.000e-47T2D.4099972 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  29  9MKSDSIKTYSYRVSQASKSDLIVILYDIAMESVQDAQAAYREKNDDEYHASLKRAKRVVDELESSLDMQYDISKELFKIYVSMMRFLVKADAGHDVTVLDTVLSMLSKLRKSFYEVSRQDTTGPVMRNAEQVYAGLTYSNGTSTEIAENSGNRGYTV 167
366 1.000e-47gi|492391867|ref|WP_005829829.1| flagellin-specific chaperone FliS [Brevibacillus agri]  clstr ali  25  4.QQSLQAYQTNSVNTANPGELTLMLYNGALKFLKQSKAAIAEKKFDKANEYNKRVQDIVGELMVTLDQKYPIAQQMMSLYEYMQTRLIEANLKKETSILDEVEGLLTQFRDTWKQAMVLAKTQ.................................. 125
367 1.000e-47gi|544869518|ref|WP_021282973.1| hypothetical protein [Clostridium sp. BL8]  clstr ali  19  5.NNGYNAYKNNSINFASKEQLFLMLLDGAVKFSKIARQAIEDKEIIKAHENIIKTQNIFYELMVTLDTSSPWLKDLFNIYDFITRRLIDANVKKDVKIIDEIIPLIEDIRDTWNEAYRLSKSGK................................. 129
368 1.000e-47METAHIT MH0030 GL0013455 [Complete] locus=scaffold69180_1:194:580:-  ali  20  7...AANAYQGTRIRTASPAELTLMLYDGAIKFCNMGKVALEKGDFEKANLNIQKAKKIIVQFRNDLDFNYPVAQDFDRVYEYIYYTLVDANVKKDKELLEEALGRIREMRDTWKQVMDKVKNG.................................. 126
369 1.000e-47T2D.553226 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  7...AANAYQGTRIRTASPAELTLMLYDGAIKFCNMGKVALEKGDFEKANLNIQKAKKIIVQFRNDLDFNYPVAQDFDRVYEYIYYTLVDANVKKDKELLEEALGRIREMRDTWKQVMDKVKNG.................................. 126
370 1.000e-47gi|653218495|ref|WP_027431084.1| hypothetical protein [Lachnospira multipara]  clstr ali  32  1MNNDLIRTYSYRISQANRSQLVVVIYDLAIDYLKEACQL---EKVEEKRHNIVNAGRAIDQLIVGLNMEFDLSQNLFIIYNHIKRSLISASVKLDNGELERVIALLSKLRKSFYEVSKADESAPLMKNTQNVYAGLTYSRLGACESVTNNANRGYIV 154
371 1.000e-47gi|490159443|ref|WP_004058108.1| flagellar protein FliS [Eubacterium plexicaudatum]  clstr ali  19  4.NSGYAAYAKNKVTTASKGELTLMLYDGAIKFCNMAIVAIKEHDIQKAHTNIIKVERIIEEFQSTLNFKYPVAKDFNNVYQYLQETLRNANIKKDEKMLEEVLKHLRTMRDTWKEVMRKNAS................................... 124
372 1.000e-47JGI.Meta JGI_HUM.2266967 7051999134 SRS047014_WUGC_scaffold_71662__gene_111195 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  36  3..KEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCRDSLAAAMYKRSLTEIETAEKMLRKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQ......... 148
373 1.000e-47gi|490200466|ref|WP_004098960.1| flagellar biosynthesis protein FliS [Acetonema longum]  clstr ali  18  7....ANAYKNQQIMTASPEELTLMLYNGALKFMTESVQAIEEKKYEKAHETNIRSQNIIREFMTTLDMQYELSHNLYEIYDYMHRSLIEANLKKDAAKLKEIRDLLRELRDAWAEAMKRARQDRVG............................... 128
374 1.000e-47METAHIT MH0077 GL0030024 [Complete] locus=scaffold34372_6:1457:1954:-  ali  33  6MKEEDISAFSYRISQATGTELVVILYEMAQQYIDDAQDMYSQGSREEFRRYVKLAKRVTDELKVSLEMKYPISAQLFNIYSYASSTLQTAMNRYDNANLDVVKRIYGRLAQAFSDIADQDKGGPLMENTQKVYAGLTYSNGKLNEDVSGAQSRGF.. 163
375 2.000e-47gi|651957150|ref|WP_026682018.1| flagellar biosynthesis protein FliS [Bacillus megaterium]  clstr ali  20  4.NKQHQAYKNNAVNTASGAELTLMLYNGCIKFIKQAMKDLDSKNYEAKNTNIQKAQKIIQELMITLDPKIEISNQFLPLYEYMLFQLKEANIKNDTSLLEEVLGYTIEFRDTWKQVILETRKKQYAQGAH........................... 132
376 2.000e-47METAHIT unmapped GL0479073 unmapped_[Complete]_[mRNA]_locus=scaffold226818_5:1189:1605:-  ali  35  1....................MIVIIYDIVFAYIEDAKQSYAAGDHEGFKNALRKAQRAVDELIHALNFQYEVSKNLYSLYVFSKETMAKAIVKNSTDELEDVLAVLKDLYEAFMEASKQDHSLPLMQNTQQVYAGMTYGKNDLTETFVPETSRGFFA 138
377 2.000e-47T2D.2336151 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  35  1....................MIVIIYDIVFAYIEDAKQSYAAGDHEGFKNALRKAQRAVDELIHALNFQYEVSKNLYSLYVFSKETMAKAIVKNSTDELEDVLAVLKDLYEAFMEASKQDHSLPLMQNTQQVYAGMTYGKNDLTETFVPETSRGFFA 138
378 2.000e-47gi|518247286|ref|WP_019417494.1| flagellar biosynthesis protein FliS [Anoxybacillus kamchatkensis]  clstr ali  19  5..QAHRAYQQNSVSTASPGELTLMLYNGCLKFLNKAKEAIHENRINERNENLQKAQKIIQELMVTLNQEYEIAKQMMIMYEYMHYRLIQANIKNDVLMVEEVENLVMEFRDTWKEVIRLNRQK.................................. 125
379 2.000e-47gi|653213149|ref|WP_027425843.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium NC2004]  clstr ali  19  2.......YGQNKILTATPAELTLMLYEGAIKFCNKAIDAVDNNDVVEAHKNIRKVENIIIEFQATLDHKYEVAKDFDIIYDYVYRKLVEANIKKDRETLEEVLKELRDLRDSWKIIMKTANSPA................................. 118
380 2.000e-47gi|511046365|ref|WP_016300278.1| flagellar protein FliS [Lachnospiraceae bacterium COE1]  clstr ali  31  1MTKENKQIFTRRITQANRTQLVVIVYEMLLVYLEDAVKAYEAEDKQEFVRNLKLARECIGQMRTSLNFQYELSKNLFAIYCFADRELANDIFANKTDNLDVLKMIFTKLHDAYHTISKEDKSEPLMDNIQDVYAGLTYGRTDVSESLVNDAKRGYMA 158
381 2.000e-47METAHIT MH0010 GL0017748 [Complete] locus=scaffold38953_1:409:885:-  ali  40  1LKKEQIMDFTRRISQSNRGGLVIVIYDIFFAYMEDTKEAHDNGEWENYKTALRNASKTISELISSLDFSYELAGELYRIYVFCRETLAKAMYKRDLKEVELAENLMKKLYTAFAEVMKEDTSAPLMRNTQQIYAGYTYGKNDLVETYQDDTSRGFLV 158
382 2.000e-47JGI.Meta JGI_HUM.0946196 7067755396 C3233034__gene_304373 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159571453]  ali  40  1LKKEQIMDFTRRISQSNRGGLVIVIYDIFFAYMEDTKEAHDNGEWENYKTALRNASKTISELISSLDFSYELAGELYRIYVFCRETLAKAMYKRDLKEVELAENLMKKLYTAFAEVMKEDTSAPLMRNTQQIYAGYTYGKNDLVETYQDDTSRGFLV 158
383 2.000e-47METAHIT MH0025 GL0019345 [Complete] locus=scaffold104756_2:2308:2781:-  ali  97  1MKNELKQELTRRLCVCNNGGLVLVMYDIYFGFSDDVKNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDEADVIMKKLRSSFETVAAGDKSAPLMDNAQKVYAGMTYGRGRLTESFINDDNRGFLA 157
384 2.000e-47gi|502248095|ref|WP_012740967.1| hypothetical protein [Eubacterium rectale]  clstr ali  100  1MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDETDGIMKKLRSSFETVAAGDKSAPLMDNAQKVYAGMTYGKGRLTESFINDDNRGFLA 157
385 2.000e-47gi|515113298|ref|WP_016742351.1| flagellar biosynthesis protein FliS [Brevibacillus brevis]  clstr ali  19  2LQNAAQTYQSNQVTTATPADLTLMLYNGALKFIKQAKGAIEEKDVARAHEASLKVQNILYELMSTLNSDYTISKEFIKLYEYMLHRTIEANMRKDIEILSEVESLFLQFRDTWKEAMQLAKSQ.................................. 124
386 2.000e-47METAHIT MH0063 GL0054154 [Complete] locus=scaffold79670_11:895:1380:-  ali  38  1MTAETIATFTRKIAASNRTGLVCVLYEIYFAYETEALDFLEEGDVTDYTKAVRQCGQVVRHLKEALDFSYDISYSLYALYDYVERTLARAMYEQKADTIHAAGNVMRHLQDSFVQLAKEDASAPLMGNTQQVTAGLTYGKGKLNESMGNEINRGFFA 161
387 2.000e-47T2D.1067062 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  38  1MTAETIATFTRKIAASNRTGLVCVLYEIYFAYETEALDFLEEGDVTDYTKAVRQCGQVVRHLKEALDFSYDISYSLYALYDYVERTLARAMYEQKADTIHAAGNVMRHLQDSFVQLAKEDASAPLMGNTQQVTAGLTYGKGKLNESMGNEINRGFFA 161
388 3.000e-47gi|548212944|ref|WP_022432426.1| putative uncharacterized protein [Eubacterium sp. CAG:38]  clstr ali  29  1MKSDSIKTYSYRVSQASKSDLIVILYDIAMESVQDAQAAYREKNDDEYHASLKRAKRVVDELESSLDMQYDISKELFKIYVSMMRFLVKADAGHDVTVLDTVLSMLSKLRKSFYEVSRQDTTGPVMRNAEQVYAGLTYSNGTSTEIAENSGNRGYTV 159
389 3.000e-47gi|547967893|ref|WP_022367850.1| putative uncharacterized protein [Firmicutes bacterium CAG:882]  clstr ali  27  1MTKSEINAYTMRVAQASKSELIVIMYEMAVKYIDDGTEALQAGNVQEFRVNIKRAKAVVNELASVLDLRFSVSSNLLALYTYMNNVMVKSDITLKTDDLIRVRAMLEKLHTAFGKVSEQDNTEPLMKNVQQVYSGLTYSRNSLNESYANDLKRGYRV 159
390 3.000e-47gi|652569574|ref|WP_026962968.1| hypothetical protein [Alicyclobacillus herbarius]  clstr ali  22  1MMNPYAAYRQTSIQTASRERLLIMLYDGLITALERAQVALESGDVATSHQQLVKAQEIIRELWGPLDMQYEISKSLASLYEYFHRRLVEANLKKDAAPVVEVLEHVRGLRETWVQAAAKSRQEQ................................. 125
391 3.000e-47gi|489483333|ref|WP_003388312.1| flagellar protein FliS [Brevibacillus borstelensis]  clstr ali  20  4..NAAQTYQSNQVTTATPGELTLMLYNGAIKFIKQAKSAIDEKNVVKAHENCLKVQNILYELLSTLNKDYPISGELEKMYDYMLHRMIEANMRKDASILTEVEDYFVQFRDTWKEAMLLAKKQ.................................. 124
392 3.000e-47METAHIT V1 GL0062499 [Complete] locus=scaffold10425_13:229:708:+  ali  29  1MKSDSIKTYSYRVSQASKSDLIVILYDIAMESVQDAQAAYREKNDDEYHASLKRAKRVVDELESSLDMQYDISKELFKIYVSMMRFLVKADAGHDVTVLDTVLSMLSKLRKSFYEVSRQDTTGPVMRNAEQVYAGLTYSNGTSTEIAENSGNRGYTV 159
393 3.000e-47JGI.Meta JGI_HUM.1564643 7026999151 SRS016335_WUGC_scaffold_10641__gene_21105 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  29  1MKSDSIKTYSYRVSQASKSDLIVILYDIAMESVQDAQAAYREKNDDEYHASLKRAKRVVDELESSLDMQYDISKELFKIYVSMMRFLVKADAGHDVTVLDTVLSMLSKLRKSFYEVSRQDTTGPVMRNAEQVYAGLTYSNGTSTEIAENSGNRGYTV 159
394 3.000e-47gi|651892082|ref|WP_026651366.1| hypothetical protein [Butyrivibrio proteoclasticus]  clstr ali  31  1MTQEKKQEMTLKISQANKTQMITILYEMVLEYLDEAMDDLSIGKKEDAQKALSNAQSCIDELIRSLNLKYSLAKDLHKLYIYFKKELIVAGATYSIHKIWRVAQNIKSLCEAYRELEKEDTSAPMMGNIQTVYAGLTYGRNSLNEAVTGSYNRGFMA 158
395 3.000e-47T2D.1314427 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  33  6MKEEDISAFSYRISQATGTELVVILYEMAQQYIDDAQDMYSQGSREEFRRYVKLAKRVTDELKVSLEMKYPISAQLFNIYSYASSTLQTAMNRYDNANLDVVKRIYGRLAQAFSDIADQDKGGPLMENTQKVYAGLTYSNGKLNEDVSGAQSRGF.. 163
396 3.000e-47gi|547960657|ref|WP_022360926.1| putative uncharacterized protein [Bacteroides pectinophilus CAG:437]  clstr ali  33  1MKEEDISAFSYRISQATGTELVVILYEMAQQYIDDAQDMYSQGSREEFRRYVKLAKRVTDELKVSLEMKYPISAQLFNIYSYASSTLQTAMNRYDNANLDVVKRIYGRLAQAFSDIADQDKGGPLMENTQKVYAGLTYSNGKLNEDVSGAQSRGF.. 158
397 4.000e-47gi|491507379|ref|WP_005365015.1| flagellar biosynthesis protein FliS [[Eubacterium] yurii]  clstr ali  13  6..NPYQRYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDAWREAMIIVRKGQ................................. 127
398 4.000e-47gi|639198127|ref|WP_024536572.1| flagellar biosynthesis protein FliS [Sporosarcina sp. EUR3 2.2.2]  clstr ali  20  5..NPYQAYQQNSVMTASPQELTLMLYNGCLKFIKLAKKAMADNKYEDKNTNMIKAQAIIQELRYTLDPDIELSASMAQLYDYMYNRLVEANMKNDAVVLEEVEGYVVELRDTWKQAMSQMKN................................... 124
399 4.000e-47METAHIT unmapped GL0046313 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold783590_1:2:481:+  ali  80  3MKNEMKQELTRRLCECNNGGLVLVLYDIYFAFSLDVRNALGSGDSAALKKGVADVQAALDELMGALDFNYPVSGQLYPLYSYCKRLFSTALYSLDVTVVDEADGIMKKLRESFEIAAGQDKSAPLMGNAQKVYAGMTYGRTDLTENFMNDENRGFLA 159
400 4.000e-47T2D.2507872 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  80  3MKNEMKQELTRRLCECNNGGLVLVLYDIYFAFSLDVRNALGSGDSAALKKGVADVQAALDELMGALDFNYPVSGQLYPLYSYCKRLFSTALYSLDVTVVDEADGIMKKLRESFEIAAGQDKSAPLMGNAQKVYAGMTYGRTDLTENFMNDENRGFLA 159
401 5.000e-47JGI.Meta JGI_HUM.0956367 7001900127 SRS022725_LANL_scaffold_9219__gene_23667 flagellar protein fliS [Human Supragingival plaque microbiome from visit number  ali  13  6..NPYQKYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDGWKEAMIIVRKGQ................................. 127
402 5.000e-47JGI.Meta JGI_HUM.3635082 7032392602 SRS023914_Baylor_scaffold_10072__gene_26124 flagellar protein fliS [Human Stool microbiome from visit number 2 of subjec  ali  30  28MTNELIKTFQYRITQATASQLVVILYDLADRYLEDACESDEEMQI---RDNIYMSGKVIDQLISGLDMQYEVSANLFVIYNHIKRTLISVSVNLNKAELKRVRGLLKNLRESFYEVSKQDTSEPLMKNTQTVYSGLTYSRGGINETQTDNENRGFRV 183
403 5.000e-47T2D.3973642 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  30  28MTKELIKTFQYRITQATASQLVVILYDIADRYLEDACESDEEVQI---RDNIYMSGKVIDQLISGLDMQYEVSANLFVIYNHIKRTLISVSVNLNKAELKRVRGLLKNLRESFYEVSKQDTSEPLMKNTQTVYSGLTYSKGGINETQTDNENRGFRV 183
404 6.000e-47JGI.Meta JGI_HUM.1088015 7078868965 SRS014235_WUGC_scaffold_58353__gene_104298 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  32  5MEKEKLNAYAARVSQANRSELVVIMYEAFLDSVKEGDAQMKQGDMPACRREIERARGLLTELMGSLDFQYEISFYLRRLYIYSYHELCQGMALRDSERFAHATHVMERLLPSFREVAKQDTSEAVMKNVQQIYAGLTYGRGSLNETIGVDKNRGFEA 163
405 6.000e-47T2D.3728574 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  22  6..NAANIYQQNAINTASPARLTLMLYEGAIRFCNIAREAMAEDDYEKINTNVKKAQNIIVELRSTLDMKYPVAKEFDNVYDYVYRRLYEANMQKDMEAMDEVIKHLKTMRDTWKEVMKINH.................................... 127
406 6.000e-47JGI.Meta JGI_HUM.5740408 7072814211 C2773271__gene_106554 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 1 of subject 63875  ali  18  3.NNPYNKIKNSSIMTASPAELTLMLYEGAIKFGNQAVAAIKAKDVSEAHRLIVRVQDIIDELRGTLNFDFPIAEQMDRMYEFISFTLVEANMEKSAEKVETALTFIREFRDTWKEAMGLAKK................................... 123
407 6.000e-47JGI.Meta JGI_HUM.0266202 7004308172 C4276951__gene_379101 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160400887]  ali  32  1MKEEDISAFSYRISQATGTELVVILYEMAQQYIDDAQDMYSQGSCEEFRRYVKLAKRVTDELKVSLEMKYPISAQLFNIYSYASSTLQTAMNRYDNANLDVVKRIYGRLAQAFSDIADQDKGGPLMENTQKVYAGLTYSNGKLNEDVSGAQSRGF.. 158
408 8.000e-47gi|651407111|ref|WP_026517791.1| hypothetical protein [Butyrivibrio sp. MC2021]  clstr ali  31  1MTSEKKQEFTLRISGANKTQMITILYEILICYADDAIDALAIGKRDDAITSLDKAQSCLDELIRSLDLRFELAKQLHKIYLFSKKELVVAGATGSMNKIWRVKRNIRALHEAYTELEKFDTTPPMMDNIQTVYAGLTYGKSALNESIAASSNRGY.. 156
409 8.000e-47JGI.Meta JGI_HUM.1247637 7068102082 SRS015782_WUGC_scaffold_16896__gene_37552 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  96  1MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDEADVIMKKLRNSFETAAADDKSAPLMDNAQKVYAGMTYGKGRLTESFINDDNRGFLA 157
410 8.000e-47gi|569808069|dbj|GAE31554.1| flagellar biosynthesis protein FliS [Bacillus hemicellulosilyticus JCM 9152]  clstr ali  15  3.TQLQSVYKKNSMQTASPGELTLMLYNGCLKFIKQANKAIEENNVEARSHSIQRAQDIIRELMVTLKMDSEASENMMRLYDFILNRLIEANVKNDVKALHDAEELVIQFRDMWKEVIQLDRKERHGEGGKA.......................... 132
411 9.000e-47JGI.Meta JGI_HUM.2899131 7055223932 C3669430__gene_208949 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 765013792] :  ali  19  25MTNAASLYQGASINTATPAELTLMLYNGAIKFCNQAMAGIEEKNVEKANNNLIKAQNIIWELQGTLDFKYKVAKDFDIIYQRILRNLLMANIRKDADKLNEALEDIRGMRDVWVEVMKAAKN................................... 146
412 9.000e-47gi|510895194|ref|WP_016228327.1| flagellar protein FliS [Lachnospiraceae bacterium 10-1]  clstr ali  17  5..NAFAQYNNNKIMTASPAELTLMLYEGAIKFCNIAIDAAEQKNVMKAHSNIVKVENIIAYLRNTLDMQYAVAKEYDRMYDYLQRRLFQANMKKDVEILKEVNTHLRSIRDTWKEVMRINRGK.................................. 125
413 1.000e-46gi|651383286|ref|WP_026495418.1| hypothetical protein [Butyrivibrio sp. WCD3002]  clstr ali  28  1MTREKIQTYTRRITMANKTQMITILYEMVLDYIDDAKKAYEEDDENMYTESMYRAMSCIDELIHSLNISYELGRTLLELYLFEKRTLISCTVKMNEERLSHVVKTFESLRAAYIELEKKDAESAVMTNVPKVYAGLTYGRGTLSESVLGNTSRGFMA 158
414 1.000e-46gi|503044498|ref|WP_013279474.1| flagellar protein FliS2 [Butyrivibrio proteoclasticus]  clstr ali  28  1MTQEKKQEYTLKITQANKTQMITILYEMVIDYISDAEEAMDLGKRDLTERNLQYAQSVIDELIRSVNRRIELGRMLHKLYIFFKTELTAAGVHNSRGRLDKVKQNFKLLHAAYKEIEALDVSEPTMGNTQTVYAGLTYGKYSLNEDVTASSNRGYRA 158
415 1.000e-46METAHIT MH0011 GL0000184 [Complete] locus=scaffold43235_4:2074:2565:-  ali  32  5MEKEKLNAYAARVSQANRSELVVIMYEAFLDSVKEGDAQMKQGDMPACRREIELARGLLTELMGSLDFQYEISFYLRRLYIYSYHELCQGMALRDSERFAHATHVMERLLPSFREVAKQDTSEAVMKNVQQIYAGLTYGRGSLNETIGDDKNRGFEA 163
416 1.000e-46T2D.191138 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  32  5MEKEKLNAYAARVSQANRSELVVIMYEAFLDSVKEGDAQMKQGDMPACRREIELARGLLTELMGSLDFQYEISFYLRRLYIYSYHELCQGMALRDSERFAHATHVMERLLPSFREVAKQDTSEAVMKNVQQIYAGLTYGRGSLNETIGDDKNRGFEA 163
417 1.000e-46gi|545666077|ref|WP_021772468.1| flagellar protein FliS [Mitsuokella sp. oral taxon 131]  clstr ali  18  3.NSAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGTAAVAEKKWEQANIALQKAQNIISEFRITLNMEYDISKQLMPLYNYAYDRLVEGNMKSSVEKIQEARDIISELRDAWAQAMKKARQDQGTRNVQ........................... 131
418 1.000e-46gi|652831917|ref|WP_027116111.1| hypothetical protein [Lachnospiraceae bacterium P6B14]  clstr ali  32  1MDKSTLQAFATRVTQANRSELVVVIYEVALASIKEGRDALEAGAIADARTEIDRAKSMIQELMYALDMHYNISTYLRQLYIFGYRELCQGIANRDPERFDHTTNILEGLLQSFKEVAKQDDSAPLMKNTQTIVAGLTYGPGDLRETVGVNPSRGFRA 160
419 2.000e-46T2D.2924132 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  44...........KVLTASPAELTLLLYEGAIKFCNIAMMGLEEKNIQKTHDNIKKAQAIIEELQSTLNHSYKVAEDFDNVYHYIYSLLTDANIHKDKETLERALTEIRGMRDTWKEVMKKAKS................................... 154
420 2.000e-46T2D.3341305 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKTHNNIVKVENIIEEFQATLNHKYPVAEDFDKIYRYIYDLLIEANIKKDKELLERALDELRGMRDTWKEVMVKAK.................................... 126
421 2.000e-46gi|568807981|dbj|GAE26537.1| flagellar biosynthesis protein FliS [Bacillus wakoensis JCM 9140]  clstr ali  15  3.TNMQAAYKQNAMKTASPGELTLMLYNGCLKFIKQAKQAMDAQEIEKRNIATTKAQNIIRELMVTLKTDSEVGQNMMQMYDFILRQLVEANVKNDPQALANAEDLVTQFRDTWKEVVLIDRQQRHGAGGKA.......................... 132
422 2.000e-46gi|495793681|ref|WP_008518260.1| flagellar biosynthesis protein FliS [Dethiobacter alkaliphilus]  clstr ali  18  4..NPYQKYKQNQVETSSPQQLIIMLYNGAIKFLKLAQMGITEQSIEKAHTNIIKTQDIINELMASLDMNQEVASHLYSLYDYMNSRLLEANLKKDTQILSEVENMLTELRDSWVQALK....................................... 120
423 2.000e-46gi|575082095|dbj|GAE95177.1| flagellar biosynthesis protein FliS [Gracilibacillus boraciitolerans JCM 21714]  clstr ali  18  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQANKAIEDKDYETKNEMIKKTQNIVRELMITLDQEAAITKEIMPLYDFVNHALMQANIKNNVDQLEQARAIIQDFRDTWKEVIKQER---IRQHGQGVKA....................... 132
424 2.000e-46METAHIT MH0038 GL0068610 [Complete] locus=scaffold24817_2:431:832:-  ali  18  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAIIAIEKKDYEKANVNIKKAENIITEFKVTLNHKYAVAEDFEKIYDYIYSLLVDANMSKDIELLNRALDEIRGMRDTWKEVMKRAKS................................... 131
425 2.000e-46T2D.2988112 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAIIAIEKKDYEKANVNIKKAENIITEFKVTLNHKYAVAEDFEKIYDYIYSLLVDANMSKDIELLNRALDEIRGMRDTWKEVMKRAKS................................... 131
426 2.000e-46JGI.Meta JGI_HUM.1424370 7017062489 C3291823__gene_270236 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 706846339]  ali  31  1LTTEEKRRFTARISQANKSELVVIVFEMFDYCIEQAEDGFKSGDLQKAEKYLKSAKGCVSELRGSLDLKYELSYNLHNIYSFVNKQLTASIVKREPVNLDNVKENMGKLFKAFEEVAKQDTSKSVVQNSQQVYAGLTYGKGTLNEVFMDNEARGFKA 158
427 2.000e-46gi|653148638|ref|WP_027397829.1| flagellar biosynthesis protein FliS [Anaerovibrio lipolyticus]  clstr ali  23  2MNNAAEAYKRQQVMTATPEALTLMLYDGCLRFMKEGLEAMEQKKWEQCNTSLQKAQNIINEFRVTLDMKYDIAHQLMPLYDYVYNSLVEANMRSKPEKVTECMDIIKELRSAWAQAMIKARKEK................................. 125
428 2.000e-46gi|518465419|ref|WP_019635626.1| hypothetical protein [Paenibacillus fonticola]  clstr ali  18  3.TSPYDKYRQSSVQTSTPSQLLLMLYDGAIRFVRGGIEGIKEGDYDKVNTLLNKAQSIVTELTVTLDYSYEVSKGLASLYEYINHLLIDANIKKTAPPAEEALGYLLDLRDTWAQAAKLAGGG.................................. 124
429 2.000e-46gi|516336231|ref|WP_017726264.1| hypothetical protein [Bacillus sp. L1(2012)]  clstr ali  16  5..NMQTAYKQNAMKTASPAELTLMLYNGCLKFMKQAKQAIEEKNVEHRNLYTNKAQDIIRELMVTLKTDSEVGKNMLRLYDFALDRLIEANVKSDLKALEDAEDIMVQFRDTWKEAMQLDRQQRHGAGGQA.......................... 133
430 2.000e-46METAHIT MH0016 GL0026372 [Complete] locus=scaffold4136_1:4459:4947:-  ali  33  7MDREAIKTYSYRISQATRSELVVIVYDIIRDYL---KDAVSTSDNAVFKEKLHMAMRGIDQLITGLDMQYELSGNLYVLYNYMKRTLIGAQVSYDKNVVNSIYDMLGQLRQSFYEVSRQDNSAPLMKNTEKVYSGLTYSKYGAGNETASDTNRGYMV 162
431 3.000e-46gi|573550090|gb|ETT48892.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL H7-689]  clstr ali  20  3.KSPYEKYRQSSVQTSTPAQLVIMLYDGAIRFVKVGLEGLNNQDIEKANLNLGKAQTIISELMSTLDQSYDVSKNLFALYEYTNYLLIEANIRKSPEKAEEAIGYLTDLRETWMQASKLASTQ.................................. 124
432 3.000e-46gi|546467217|ref|WP_021866369.1| putative uncharacterized protein [Eubacterium sp. CAG:86]  clstr ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKVHNNIIKVENIIEEFQATLNHKYPVAEDFDKIYKYIYNLLVEANIKKDKELLEQALTELRGMRDTWKEVMVKAKQG.................................. 128
433 3.000e-46METAHIT MH0016 GL0043605 [Complete] locus=scaffold13626_10:71:481:-  ali  15  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAMIAIEKGDLQKAHTNIKKAEDIITEFKVTLNHKYPVAEDFEKIYDYIYSLLVNANVKKDPEILNQALVEIRGMRDTWKEVMNRNRTRGMNQ.............................. 136
434 3.000e-46T2D.375872 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  15  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAMIAIEKGDLQKAHTNIKKAEDIITEFKVTLNHKYPVAEDFEKIYDYIYSLLVNANVKKDPEILNQALVEIRGMRDTWKEVMNRNRTRGMNQ.............................. 136
435 3.000e-46gi|653088798|ref|WP_027339040.1| flagellar biosynthesis protein FliS [Halonatronum saccharophilum]  clstr ali  21  4.NNPYQKYKSTKYETASPEKLLLMLYEGGIRFAKRGKIAMEKKDIQEVNKSLQKVQQVINELMVTLNMDKEISQNLYSLYEYINRRLIEANIKKDPLILDEVINLLTELKEGWEEASKKVNN................................... 126
436 3.000e-46METAHIT MH0021 GL0012751 [Complete] locus=scaffold71730_1:668:1054:-  ali  18  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKVHNNIIKVENIIEEFQATLNHKYPVAEDFDKIYKYIYNLLVEANIKKDKELLEQALNELRGMRDTWKEVMAKAKQG.................................. 128
437 3.000e-46JGI.Meta JGI_HUM.1130606 7079071153 C3551807__gene_306486 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763678604]  ali  18  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKVHNNIIKVENIIEEFQATLNHKYPVAEDFDKIYKYIYNLLVEANIKKDKELLEQALNELRGMRDTWKEVMAKAKQG.................................. 128
438 3.000e-46gi|502242305|ref|WP_012740255.1| hypothetical protein [Eubacterium eligens]  clstr ali  29  1MTKELIKTFQYRITQATASQLVVILYDLADRYLEDACESDEEVQI---RDNIYMSGKVIDQLISGLDMQYEVSANLFVIYNHIKRTLISVSVNLNKAELKRVRGLLKNLRESFYEVSKQDTSEPLMKNTQTVYSGLTYSRGGINETQTDNENRGFRV 156
439 3.000e-46gi|504864176|ref|WP_015051278.1| flagellar biosynthesis protein FliS [Thermacetogenium phaeum]  clstr ali  24  7..NNYDQYRQIAVQTAGPGKLLLMLYDGLTVFLKQAVQAVKDGEFGEAHRCLIRAQDIITELMCTLDMKYEVAKNLFRIYDYLKGRLVEANVKKDSSIIEEVLGLVAELKETWEQIIEPSK.................................... 125
440 4.000e-46gi|517532060|ref|WP_018702268.1| hypothetical protein [Anaeromusa acidaminophila]  clstr ali  16  3MMNPAAAYRNQQIMTASPEQLTLMLYDGAIRFLRASITAIEAKEMEKAHEMNMRTQEIIREFRQTLNMDIELSENWDKLYEFMEYRLMEGNVKKDKAMLQEVLDLLKEMRDTWAEAMKLAK.................................... 123
441 4.000e-46JGI.Meta JGI_HUM.3714688 7067123043 C2907313__gene_160437 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 3 of subject 763536994] :  ali  35  2LTKERKQVYTRRITEANRTQLITIVYELAMEYMDEAIEAEKKSDLTAFADGLRHADACVDDLLKALDMKYDLSENLRELYLYVKKQLICASGKRDLESLKEARQIMENLHRAWKQIESKDSSPPEFKNKQTVYAGLTYGKGTLKESIEGDTNRGIQA 159
442 4.000e-46gi|550548983|ref|WP_022629127.1| flagellar biosynthesis protein FliS [Bacillus marmarensis]  clstr ali  15  3.TAMQSAYKQNAMKTASPGELTLMLYNGCLKFIKQTRLAMEENDLEKRNLNSTKAQNIIRELMVTLKTDNEVGQNMMRMYDFILNRLIEANVKNDANALTEAEGLVVEFRDTWKEVIQLDRKQRHGAGGKA.......................... 132
443 4.000e-46gi|544876082|ref|WP_021289102.1| hypothetical protein [Virgibacillus sp. CM-4]  clstr ali  16  4.NKQHQAYQENAVNTASGAELTLMLYNGCMKFVKQAIKDVEANHFEEKNTNIQKAQNIIQELIITLDPKIEISNQFLPLYDYMLFRLKEANINNNVEYLQEVLELITDFRDTWKQVILEIRKKQYAQGAH........................... 132
444 4.000e-46gi|495707141|ref|WP_008431720.1| flagellar biosynthesis protein FliS [Planococcus donghaensis]  clstr ali  19  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFMKLAKRAMADKKIEEKNTNIIKAQNIIQELRSTLKADIEMSAGLEQMYEYMYSRLVEANMKNDVSALEEVEELMTDIRNTWKQAMALVKK................................... 124
445 4.000e-46gi|652370461|ref|WP_026766474.1| flagellar biosynthesis protein FliS [Selenomonas ruminantium]  clstr ali  20  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMNEGKEAVEAKQYEQANTSLQKAQQIISEFRVTLNMDYEISHQLLPLYNYTYRCLVDGNMQSNPALIQEAIDIIRELRDAWAQAMKKARQDNGLQNAQ........................... 132
446 5.000e-46gi|568815013|dbj|GAE33041.1| flagellar biosynthesis protein FliS [Bacillus akibai JCM 9157]  clstr ali  15  4.NNPQQAYQQNKAVTSSPGELTLMLYNGCLKFINVAKKSIEENNIATRHENLVKAQNIIRELMVTLKTDTKLGKDMLALYDFILSRLTDANTENSMEKLSEAEEMVKDFRDTWKEALQIDRKKRHQ............................... 128
447 5.000e-46T2D.371895 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  33  7MDREAIKTYSYRISQATRSELVVIVYDIIRDYL---KDAVSTSDNAVFKEKLHMAMRGIDQLITGLDMQYELSGNLYVLYNYMKRTLIGAQVSYDKNVVNSIYDMLGQLRQSFYEVSRQDNSAPLMKNTEKVYSGLTYSKYGAGNETASDTNRGYMV 162
448 6.000e-46gi|547940536|ref|WP_022341891.1| putative uncharacterized protein [Roseburia sp. CAG:309]  clstr ali  32  5MEKEKLNAYAARVSQANRSELVVIMYEAFLDSVKEGDAQMKQGDMPACRREMERARGLLTELMGSLDFQYEISFYLRRLYIYSYHELCQGMALRDSERFAHATHVMERLLPSFREVAKQDTSEAVMKNVQQIYAGLTYGRGSLNETIGVDKNRGFEA 163
449 6.000e-46T2D.3347689 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5..NPYNAYKQNSVKMASKQQLLLMLVDGAVKYTKIARLAIEKKDITRAHNELVRVQDIFTELMVTLDKSSQVYEDLYKVYEYIKSRLIEANIKKDVAIIDEVLPLIENVRDTWYEVSKKSK.................................... 124
450 6.000e-46gi|548313076|ref|WP_022503126.1| putative uncharacterized protein [Eubacterium sp. CAG:76]  clstr ali  33  1MDREAIKTYSYRISQATRSELVVIVYDIIRDYL---KDAVSTSDNAVFKEKLHMAMRGIDQLITGLDMQYELSGNLYVLYNYMKRTLIGAQVSYDKNVVNSIYDMLGQLRQSFYEVSRQDNSAPLMKNTEKVYSGLTYSKYGAGNETASDTNRGYMV 156
451 6.000e-46JGI.Meta JGI_HUM.0509901 7058412291 C3813529__gene_263242 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  33  1MDREAIKTYSYRISQATRSELVVIVYDIIRDYL---KDAVSTSDNAVFKEKLHMAMRGIDQLITGLDMQYELSGNLYVLYNYMKRTLIGAQVSYDKNVVNSIYDMLGQLRQSFYEVSRQDNSAPLMKNTEKVYSGLTYSKYGAGNETASDTNRGYMV 156
452 7.000e-46gi|503077362|ref|WP_013312277.1| flagellar biosynthesis protein FliS [Paenibacillus polymyxa]  clstr ali  17  3.NTPYQKYRQTQAQTASKPKLLIMLYDGAIRFVRAGIEGIENKDNEKANNNLCKAQAIVHELISALNFEYPISHDLLRIYEYMLHELIEANIHKIAAPAQEVLEHLTDLREAWLEAMKM...................................... 120
453 7.000e-46gi|503588819|ref|WP_013822895.1| flagellar biosynthesis protein FliS [Desulfotomaculum kuznetsovii]  clstr ali  20  6..NPYQQYLQNAVLTADPGRLTLMLYTGAVRFIRQASDCLAARDIPGAHRACLRAQDIIVYLLETVNREMEVGKNLSALYDYMYRRLVEANVKKDAAVLDEVAGLLEELADTWEQALKL-KGQQVAGG............................. 130
454 8.000e-46METAHIT V1 GL0085283 [Complete] locus=scaffold11240_3:1961:2434:-  ali  29  1MTKELIKTFQYRITQATASQLVVILYDLADRYLEDACESDEEVQI---RDNIYMSGKVIDQLISGLDMQYEVSANLFVIYNHIKRTLISVSVNLNKAELKRVRGLLKNLRESFYEVSKQDTSEPLMKNTQTVYSGLTYSKGGINETQTDNANRGFRV 157
455 8.000e-46gi|652951122|ref|WP_027204515.1| flagellar biosynthesis protein FliS [Butyrivibrio fibrisolvens]  clstr ali  21  11..NPYAQYANNKVLSASGPELTLMLYEGAIKFCNRAENACEKKDIEGTHNNIRKVQNIIAYLRETLNMKYATAQDFENIYSYLDRRLVEANVSKDIEILKEVNKHLHSVRDTWIGVMKANNVPSYMNHSDAV......................... 143
456 8.000e-46gi|503847196|ref|WP_014081190.1| flagellar protein FliS [Roseburia hominis]  clstr ali  41  1MKKEQIVDFTRRISQANRSGLVVVMYDIFFTYLDDARAAYDAADWDAYKEALRRAQRAIDELISALNFSYDMAKNLYSIYVFCRDSIAKSLYKRDLADAEDACRLMKKLYDGFVHAAEQDHSEPLMKNTQQVYAGYTYGRDNLVETCQDDSSRGFLV 158
457 8.000e-46gi|502237255|ref|WP_012738512.1| flagellar biosynthesis protein FliS [Eubacterium eligens]  clstr ali  17  5.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIEKQDYEKANINIKKAENIITEFKVTLNHKYPVAKDFENVYNYIYSLLVDANIKKDTEILNRALDEIRGMRDTWKEVMNRTRS................................... 125
458 8.000e-46JGI.Meta JGI_HUM.0530302 7058484413 C3959387__gene_335364 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  15  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAMIAIEKGDLQKAHTNIKKAEDIITEFKVTLNHKYPVAEDFEKIYDYIYSLLVNANVKKDPEILNQALVEIRGMRDTWKEVMNRTR.................................... 130
459 8.000e-46gi|551022711|ref|WP_022766862.1| hypothetical protein [Butyrivibrio sp. XPD2006]  clstr ali  29  1MTLEKKQEFTLKISEANKTQMITIIYEMVMYYLDEAIESIGIGKKEDAQKSLIRAQNCIDELIHSLNMDYELAKNLYQIYIFSKKELTVAGATFSINRIWRVLKNFKNLHEAYEALEKEDTSGKIMGNTQKVYAGLTYGKYSLNEDVTASYNRGLMA 158
460 9.000e-46T2D.3710292 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  34  5MDNDMIKTYSYRISQATRSQLVVITYDIVIDYLSEAVQ----KDDSGFKESLHMAMRGIDQLITGLDMKYDVSVQLYQLYNYMKRSLINAQVSCDHEKVNEVSGLMKKLRASFLEVSRQDTSEPLMKNTEKVYSGLTYSRYGVNEMAQDTENRGYKA 158
461 9.000e-46T2D.4206508 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  5.QQAYAKYGNNKVLTASPGELTLLLYEGAIKFCNIAIIGVEHNDIQKVHNNLKKAQAIIEELRSTLNHKYPVAKDFDKIYEYIYSLLVDANISKKTEDIEAALVEIRGMRDTWKQVMQKTK.................................... 124
462 9.000e-46METAHIT unmapped GL0475776 unmapped_[Complete]_[mRNA]_locus=scaffold485658_1:2:382:-  ali  21  5..NPYNAYKQNSVKMASKQQLLLMLVDGAVKYTKIARLAIEKKDITRAHNELVRVQDIFTELMVTLDKSAQVYEDLYKVYEYIKSRLIEANIKKDVAIIDEVLPLIENVRDTWYEVSKKSK.................................... 124
463 9.000e-46gi|504784103|ref|WP_014971205.1| flagellar biosynthesis protein FliS [Exiguobacterium antarcticum]  clstr ali  22  1MANPYATYQTNSVTTALPQDLTLMLYEGLIKFSMLAKRAIEQGLIEQKNTNIQKAQAIILELQLTLNQSIALSKELNNLYDYMQGRLIDANVKNDVVAIDEVIGFAEEFRETWKEAMKLARQ................................... 122
464 1.000e-45gi|495688434|ref|WP_008413013.1| Flagellar protein fliS [Desulfotomaculum hydrothermale]  clstr ali  18  4.KDPYKSYQQNAVLSAAPEELTTMLYQRLVKDLKLARESVEKKDIEAAHRCITHAQDIIAHLLDTLDTSYEVGQNLQLMYDYMNRRLVEANIKKDPEILREIAGYAAELRDTWVQAVKQVKTG.................................. 125
465 1.000e-45gi|651418653|ref|WP_026521623.1| flagellar biosynthesis protein FliS [Butyrivibrio sp. VCB2001]  clstr ali  23  11...AYAQYKSNKVMSASGPELTLMLYDGAIKFLNIASYAIENKDIQKSHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYSYIARRLVEANISKDKEIVDEINGHMHAIRDNWVEVMKANH.................................... 128
466 1.000e-45gi|499958959|ref|WP_011639693.1| flagellin-specific chaperone FliS-like protein [Syntrophomonas wolfei]  clstr ali  23  6..QAYNQYKKSVVETVAPEKLLLMLYDAAIKNINNAKKAIKEKDINRAHEQIMRTEEIIVELMSTLNMEYEISGRLFALYEYFYHRLTQANAQKDIVILDEVEGFLLELRGTWQEAINALKTAPSQDN............................. 131
467 1.000e-45T2D.1102470 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  40  1MKKEQIQDFTRRISQSNRTGLTLVTYDIFFAYTAEAKEAFDAGDWQRCKEALRGADRAVQELCDTLDFTYDLAKQLYQIYHFSKDAIAKSMYKKNLTELAQAERMMESLRRAFEKVASEDDSAPLMSNTEQVYAGFTYGKENLVENYQNNGSRGFLA 158
468 1.000e-45T2D.4187299 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  21  5..NAYKAYSNSKLMTASPAQLTLMLYDGAIKFTNIAIEAIENKNYEKANTYIQKTHRIIDEFRSTLNFKYPVAQEFENVYVMISEKLVYANMKKDVEVLQDVLKHLRSMRETWEEVMRLAK.................................... 123
469 1.000e-45gi|640331220|ref|WP_024866129.1| hypothetical protein [Butyrivibrio sp. FCS014]  clstr ali  31  1MTQEKKQEYTLRITQANKTQMITIIYEMVMDYLNDTIDALALGKRADADRSIGYAQNCIDELLRSLDMRYELAKNLHKIYIFSKRELMVAGVKGNIHRVWKVLQNFKQLHSAYLELEKADESAKLMGNTQTVIAGLTYGRFSLNEDVTASMNRGLMA 158
470 1.000e-45gi|406980427|gb|EKE02025.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  23  1MNPYLKQYQQTEVQTASPEKLLIMLYDGAIQFLNKAKTGIANKNIEEIHNNIIGAQKIISEFMNTLDMEVEVAQNLYNLYEYLHYRLVQANIKKDNDMVDEVLTHLKDLKQTWEEAIRIAAREKSM............................... 128
471 1.000e-45JGI.Meta JGI_HUM.0623871 7003344769 SRS024132_Baylor_scaffold_39739__gene_106356 flagellar protein fliS [Human Stool microbiome from visit number 2 of subje  ali  17  11.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIAIIAIEKKEYEKANVNIKKAENIITEFKVTLNHKYAVAEDFEKIYDYIYSLLVDANMSKDIELLNRALDEIRGMRDTWKEVMKRAKS................................... 131
472 1.000e-45METAHIT MH0006 GL0096163 [Complete] locus=scaffold187002_1:1160:1741:+  ali  31  36MTNEKKQEFTLRITQANKSQLIVLLYEIFLQYMEDAKDALADGQKDAFHRSMEKSIDCLRELTDSVQEKNELGRTVLGLYLYVSRQLGIALGSKKAEPLFEAEKVMRRLYEIYKEDAVNDTSDPVMQKSQQIYAGLTYGREDLTVSSQDSSSRGFYA 193
473 1.000e-45gi|506403703|ref|WP_015923422.1| flagellar biosynthesis protein FliS [Halothermothrix orenii]  clstr ali  17  4..NPYQKYKKTRFETANREKLILMLYEGAIKSLNHAKKGMEEDNIELINESLKKSQDIINELMVSLNPEAEIATNLYSLYDYMQRRLIEANLKKEIEPVKEVKKMVEELHETWKEAMLQVHKTKYAGQKKQ.......................... 133
474 1.000e-45gi|653218300|ref|WP_027430890.1| flagellar biosynthesis protein FliS [Lachnospira multipara]  clstr ali  17  15....AEQYKRSKILTASPAELTLMLYEGAIKFCNIAIMAIEKGDMERAHIYIKKTEDIIIEFRSTLDRKYKVAEDFERVYVYIYDLLVEGNIKKDTEILTRALNEIRGMRDTWKKVMEKTKGQS................................. 134
475 1.000e-45gi|548231217|ref|WP_022449885.1| putative uncharacterized protein [Roseburia sp. CAG:303]  clstr ali  21  5..NAYKAYSNSKLMTASPAQLTLMLYDGAIKFTNIAIEAIENKNYEKANTYIQKTHRIIDEFRSTLNFKYPVAQEFENVYVMISEKLVYANMKKDVEVLQDVLKHLRSMRETWEEVMRLAKR................................... 124
476 1.000e-45gi|517807567|ref|WP_018977775.1| flagellar biosynthesis protein FliS [Saccharibacillus kuerlensis]  clstr ali  19  4..SPYQKYQQTQAQTASKPKLLIMLYDGAIRFVKAGIDGISEKNYEAANNNLCKAQAIVHELVSSLNFDYAIADELVRLYEYMLRRLIEANVKKDAAPAEEVLEHLSDLREAWVEASKIS..................................... 121
477 1.000e-45gi|503198254|ref|WP_013432915.1| flagellar biosynthesis protein FliS [Caldicellulosiruptor kristjanssonii]  clstr ali  17  27...AAARYQEEVIMTKPPEELTLMLYDGCIRFIKLAMQAIDEKKLDKANENIIKAENIITELMSTLDMSYEISKNLMSLYDFVYRWLIQANLKKDKKYLEEALEIVQDLRNTWAEAIKIARQQK................................. 147
478 1.000e-45METAHIT MH0065 GL0031081 [Complete] locus=scaffold36610_6:3874:4350:+  ali  40  1LKKEQIQDFTRRISQSNRTGLTLVTYDIFFAYTAEAKEAFDAGDWQRCKEALRGADRAVQELCDTLDFTYDLAKQLYQIYHFSKDAIAKSMYKKNLTELAQAERMMESLRRAFEKVASEDDSAPLMSNTEQVYAGFTYGKENLVENYQNNGSRGFLA 158
479 1.000e-45gi|547855012|ref|WP_022261912.1| putative flagellar protein FliS [Butyrivibrio sp. CAG:318]  clstr ali  31  1MTGEERKEYGMKVTQAGGSGLVVITYDIIAKYLDDAMAALNKSDNAEYRRCLGLARALLAELTGALDMQYEVSKKLMALYIFMNKVIVRADITKDVTELVRIKEMLSKLREAFAKVCEECPQEPVMDNVETVYTGYTYSKTAMNEEIYSNTNRGFTV 157
480 1.000e-45T2D.206967 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  31  1MTGEERKEYGMKVTQAGGSGLVVITYDIIAKYLDDAMAALNKSDNAEYRRCLGLARALLAELTGALDMQYEVSKKLMALYIFMNKVIVRADITKDVTELVRIKEMLSKLREAFAKVCEECPQEPVMDNVETVYTGYTYSKTAMNEEIYSNTNRGFTV 157
481 2.000e-45gi|547796263|ref|WP_022206142.1| putative uncharacterized protein [Eubacterium sp. CAG:252]  clstr ali  34  1MDNDMIKTYSYRISQATRSQLVVITYDIVIDYLSEAVQ----KDDGGFKESLHMAMRGIDQLITGLDMKYDVSVQLYQLYNYMKRSLINAQVSCDHEKVNEVSGLMKKLRASFLEVSRQDTSEPLMKNTEKVYSGLTYSRYGANEMAQDTGNRGYKA 154
482 2.000e-45METAHIT MH0078 GL0020487 [Complete] locus=scaffold30101_3:108:572:+  ali  34  1MDNDMIKTYSYRISQATRSQLVVITYDIVIDYLSEAVQ----KDDGGFKESLHMAMRGIDQLITGLDMKYDVSVQLYQLYNYMKRSLINAQVSCDHEKVNEVSGLMKKLRASFLEVSRQDTSEPLMKNTEKVYSGLTYSRYGANEMAQDTGNRGYKA 154
483 2.000e-45gi|490766306|ref|WP_004628540.1| flagellar biosynthetic protein FliS [Clostridium termitidis]  clstr ali  20  4.NSGYDQYVSNSINTATPEELTLMLYNGLVKFIMQAQSAAIVRDLEKANEAMKRAQAILVEFRSTLNMNYEVSKYLESIYEYMHRQLLQANIKKDKDILEEVLGYAKDLRDTWTKAMKLAKQQ.................................. 125
484 2.000e-45gi|489428699|ref|WP_003334320.1| flagellar biosynthesis protein FliS [Brevibacillus laterosporus]  clstr ali  19  1MNQAAQIYQQNQVKTASPGELTLMLYNGGIRFSKEAKIALEKQDVQKAHQSIIKVQDIIRELMVTLDQNVAISEQFMLMYDYMYNRTIEANLKKDGAIITEVEEFFVQFRDTWKQAILIARRQPEGNQ............................. 129
485 2.000e-45gi|652965129|ref|WP_027218212.1| flagellar biosynthesis protein FliS [Butyrivibrio fibrisolvens]  clstr ali  20  8.QNAYAQYKNNKILGASGPELTLMLYDGAIKFLNIADLAIEKKDIQKAHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYVYIARRLVEANVGKDREIIAELNGHMHAIRDTWIGVMKANN.................................... 127
486 2.000e-45T2D.95051 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  31  36MTNEKKQEFTLRITQANKSQLIVLLYEIFLQYMEDAKDALADGQKDAFHRSMEKSIDCLRELTDSVQEKNELGRTVLGLYLYVSRQLGIALGSKKAEPLFEAEKVMRRLYEIYKEDAVNDTSDPVMQKSQQIYAGLTYGREDLTVSSQDSSSRGFYA 193
487 2.000e-45gi|651904653|ref|WP_026658045.1| hypothetical protein [Butyrivibrio sp. AC2005]  clstr ali  27  1MTQDKIQAYTRRITMANKTQMITILYEMVLDYVAEARDALQNSDKEAYAEGLKKAMNCIDELIHSLNVQYELGKNLLALYLFEKRQLLIAQVRNRYEELEHVCRTFQSLHSAYIQLEKMNDDEAIMTNVPKVYVGLTYGKGLLKESITDNVSRGYRA 158
488 2.000e-45JGI.Meta JGI_HUM.4077605 7031886519 SRS056259_LANL_scaffold_55701__gene_126069 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  29  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDACESDSAK---QAHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQVVYSGLTYSRGGINETQTDN....... 148
489 2.000e-45gi|500959444|ref|WP_012033250.1| flagellar biosynthesis protein FliS [Pelotomaculum thermopropionicum]  clstr ali  18  6....YSQYSLNAVMTASPGELTLMLFNGAVRFIRQGLNFAEEKNIEGAHNAIIRAQEIIQHLNGTLNMDYEVSKNLAMLYDYIVRRLTEANIKKDGQILKEALDLVEDLRNTWAEALKLA..................................... 121
490 3.000e-45gi|503423886|ref|WP_013658547.1| flagellar biosynthesis protein FliS [Cellulosilyticum lentocellum]  clstr ali  17  6....YQKYQQNSVLTASPQELTLMLYNGAIKSCNQGIEAIEEGKIEKAHQYITKTQDIILELKCTLDDKYPISKNFEELYDYIMMLLVDANITKNGERLLEAKAFITDFRDLWKEAMKASKS................................... 123
491 3.000e-45JGI.Meta JGI_HUM.3703256 7060367354 C3667938__gene_201283 hypothetical protein [Human Tongue dorsum microbiome from visit number 3 of subject 158883629]  ali  21  6..NAYETYANQKVMGATPAELTLMLYDGAIKYCNIAEAAIEKKDIERSHQNLVRVEKIIEYLRATLDMKYPVAQDFDHMYAYLYKRLVEVNISKDVEILQEINEHLHAIRETWVQVMEKNH.................................... 124
492 3.000e-45gi|551028018|ref|WP_022772102.1| hypothetical protein [Butyrivibrio sp. AE2015]  clstr ali  26  1MTQEKKQEFTLKITQANKTQMITILYEMIIDYLDDALDEISVGQKSDGEKSLLKAQNCLDELIRSVNLYTDLGKMLHKIYIFSKKELIVSGANHSLHRIWRVKKNIKALHEAYRELEKNDNSEPMMNNTQKVYAGLTYGKHSLNEDVTASMNRGYVV 158
493 3.000e-45gi|518757464|ref|WP_019915067.1| hypothetical protein [Paenibacillus sp. HW567]  clstr ali  20  2LTSPYEKYRQSSVQTSTPAQLLIMLYDGAIRFARAGIDGLNKQDYEKTNLNLGKAQTIVSELMSTLDQSYEISKGLYSLYEYMNFLLVEANIRKSVDKAEEAVGYLTELRETWLQASKLAASQTEIANG............................ 130
494 3.000e-45gi|573551186|gb|ETT49978.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL R7-269]  clstr ali  24  4..SPYDKYRQSSVQTSTPAQLVMMLYDGAIRFAKTAIEGLNKQDLEKSNLNFGKAQTILSELMSTLDFKYEVSKNLYSLYEYTNHLLVEANIHKSVDKAQEAIGYLVDLRETWLQASKLAASQTEIANG............................ 130
495 3.000e-45gi|500208514|ref|WP_011878723.1| flagellar biosynthesis protein FliS [Desulfotomaculum reducens]  clstr ali  16  4.KNPYSNYQQNAIMSAGPEELTTMLYNRLVKDLKLAQGHIEQKEIQLAHNNITHAQDILDHLMNTLDTSVEVGKNLELMYDYMSRRLVEGNLKKDKEILQEVAGFAEEIRDTWVQAVKQVKTG.................................. 125
496 3.000e-45gi|547795612|ref|WP_022205541.1| flagellar protein FliS [Eubacterium sp. CAG:248]  clstr ali  18  5.QNMAQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDMEKAHTNIVKAEMIIEEFQATLNHKYPVAEDFDKLYKYIYGLLVDANMKKDLELLEKATDELRGMRDTWKEVMKRA..................................... 123
497 3.000e-45METAHIT MH0006 GL0193733 [Complete] locus=scaffold319812_1:194:574:+  ali  18  5.QNMAQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDMEKAHTNIVKAEMIIEEFQATLNHKYPVAEDFDKLYKYIYGLLVDANMKKDLELLEKATDELRGMRDTWKEVMKRA..................................... 123
498 3.000e-45JGI.Meta JGI_HUM.7025153 7075763148 C4381034__gene_83202 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 686765762]  ali  18  5.QNMAQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDMEKAHTNIVKAEMIIEEFQATLNHKYPVAEDFDKLYKYIYGLLVDANMKKDLELLEKATDELRGMRDTWKEVMKRA..................................... 123
499 3.000e-45gi|490159701|ref|WP_004058366.1| hypothetical protein [Eubacterium plexicaudatum]  clstr ali  37  1MTKEQKQDFTRRITQANRSELVLIKFEMLFVYMDNICEYFQKEDKHELTNHVRYADAVLKSFQETLDFQYEIAGQLYALYDFHRRQLAKVLVRHSLKELEQSRKLLQQLYEAFVRSAKQDKSGPLMKNAQQVYAGYTYGKNNINESYDIQSSRGFFA 157
500 3.000e-45T2D.3665904 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  96  1MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDEADVIMKKLRNSFETAAADDKSAPLMDNAQKVYAGMTYGRGRLTESFINDDNR.... 153
501 3.000e-45gi|547269836|ref|WP_022003966.1| flagellar protein FliS2 [Firmicutes bacterium CAG:194]  clstr ali  31  1MTNEKKQEFTLRITQANKSQLIVLLYEIFLQYMEDAKDALADGQKDAFHRSMEKSIDCLRELTDSVQEKNELGRTVLGLYLYVSRQLGIALGSKKAEPLFEAEKVMRRLYEIYKEDAVNDTSDPVMQKSQQIYAGLTYGREDLTVSSQDSSSRGFYA 158
502 3.000e-45JGI.Meta JGI_HUM.0658055 7003569002 C3922552__gene_330589 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159207311]  ali  31  1MTNEKKQEFTLRITQANKSQLIVLLYEIFLQYMEDAKDALADGQKDAFHRSMEKSIDCLRELTDSVQEKNELGRTVLGLYLYVSRQLGIALGSKKAEPLFEAEKVMRRLYEIYKEDAVNDTSDPVMQKSQQIYAGLTYGREDLTVSSQDSSSRGFYA 158
503 3.000e-45gi|652439285|ref|WP_026834330.1| hypothetical protein [Eubacterium xylanophilum]  clstr ali  31  1MEKDKLQEYATRVSQANKSELVVIMMEAILDSLEDGKKCLQEENMEKCRSELNRARGLITELMGSLDFSIEISHYLRQLYIFSYREICQGIATRDSSRFDNAAKVISGLLVGFREVAHEDNTGPVMGNTEAIYAGMTYGRSSLNEMVDIDVNRGYKA 159
504 3.000e-45JGI.Meta JGI_HUM.1668254 7049555576 SRS051031_LANL_scaffold_71172__gene_161743 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  32  1MTKEQIKEYTARVAQANRTELVVIIYELLLDEIQEGNKQYQAGNMDAGEKQIRKAQGYLQELLGSLDFRYEIALQLRQLYRYVNEQLIATLVQRRPVHLDAACEVIRGLMESFEQVAKEDHSGPVMEHSQQLYAGLTYGKGTLNEVSLGEGS..... 152
505 4.000e-45gi|547741467|ref|WP_022154953.1| flagellar protein FliS2 [Firmicutes bacterium CAG:65]  clstr ali  29  1MTKECKQQFTLRITQANATQLVVILYEMTLQYLTDGEQAADD---AELLEAVRRTRGCINELLNSLHRQYSPATELSRLYLYCIRRLAACEAKADRTALQDIRKVIAPLCDAYRQIQDQNSSGPVMNNSQTVYAGLTYGRNQLTENMADQSNRGMLV 155
506 4.000e-45JGI.Meta JGI_HUM.2418179 7013606553 C4552524__gene_251735 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 675950834] :  ali  21  1MKKEYASYANQKVLGATPAELTLMLYDGAIKFCNIAESAIEKKEIEKVHQNLLRAERIIEYLRATLDMKYPIAQDFDNMYSYIYKRLVEVNVTKEVEILQEINGHLHAIRDTWVQVMEKNH.................................... 124
507 4.000e-45gi|647225793|ref|WP_025678749.1| flagellar biosynthesis protein FliS [Paenibacillus massiliensis]  clstr ali  19  3.NSPYEKYQQTQAQTASKPKLLIMLYDGAIRFVQAGIEGVEQRNFELVNRNLVKAQAIIHELISSLDFNYPVAHNLVAVYEYMIRRLIEANIQKKTEPAVEVLEHLKELREAWVEASK....................................... 119
508 4.000e-45JGI.Meta JGI_HUM.2310591 7004866538 C3858453__gene_234798 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 159268001] :  ali  21  1MGNAASLYQGTAINTATPAELTLMLYNGAIKFCNQAAVGIEEKNIEKAHQNLIKAQNIIWELQGTLDFKYPVAKDFDLVYKKIAQNLLMANLRKDIEKLNEALEDIRGLRDVWAQVMKAAKTA.................................. 123
509 4.000e-45gi|639415172|ref|WP_024615665.1| flagellar biosynthesis protein FliS [Clostridium sp. Ade.TY]  clstr ali  20  6.NNPYNAYKNNTINMASKDQLLLMLVDGAVKYTKIAKLAIEKKDIEKAHKELVRVQDIFTELMSTLDRSGEDFENLFNLYDFIKSKLAEANIKKNIQIIDEVLPLIEEVRNTWYEVSKKAK.................................... 126
510 4.000e-45gi|551040306|ref|WP_022783964.1| hypothetical protein [Lachnospiraceae bacterium NK4A179]  clstr ali  35  1MTSEAKQDFMLRISEANKSRMVVILYDMFLTYVKESVKEYTLEDLETYRIGIRNAKAVLRELIESLNMEYDIARRTYQIYRFVERELIMADIRRDPEGLPEVIKIMKSLRDAYEEATEADDSEPLMKNTDMIYAGMTYGKGTLTGSRAAGTNRGFLA 163
511 4.000e-45gi|547200806|ref|WP_021941932.1| putative uncharacterized protein [Clostridium sp. CAG:632]  clstr ali  31  1MTKEQIQVYTKRITQANTSGLAVILYELTSIYIEEGKTAYKADRAEEFERSILQAQSFLQELMSMSKMENQTGYDVMSLYLFINKQLLLSIVKKQPVNLDECAGYLNKLRTSFEKLAETDTEEPLMEHVQQVYAGLTYGRGYLNESVAGDPNRGLKA 159
512 4.000e-45METAHIT MH0065 GL0041764 [Complete] locus=scaffold55112_1:6909:7388:+  ali  31  1MTKEQIQVYTKRITQANTSGLAVILYELTSIYIEEGKTAYKADRAEEFERSILQAQSFLQELMSMSKMENQTGYDVMSLYLFINKQLLLSIVKKQPVNLDECAGYLNKLRTSFEKLAETDTEEPLMEHVQQVYAGLTYGRGYLNESVAGDPNRGLKA 159
513 4.000e-45T2D.1107257 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  31  1MTKEQIQVYTKRITQANTSGLAVILYELTSIYIEEGKTAYKADRAEEFERSILQAQSFLQELMSMSKMENQTGYDVMSLYLFINKQLLLSIVKKQPVNLDECAGYLNKLRTSFEKLAETDTEEPLMEHVQQVYAGLTYGRGYLNESVAGDPNRGLKA 159
514 5.000e-45METAHIT MH0022 GL0002535 [Complete] locus=scaffold8241_11:328:795:+  ali  29  1MTKECKQQFTLRITQANATQLVVILYEMTLQYLADAEQAAED---AQFLEAVRRTRGCINELLNSLHREYSPATELSSLYLYCIRRLAVCEAKCDKAALADVRKVIAPLCEAYRQIQDQNPSGPVMNNSQTVYAGLTYGRNQLTENMADQTNRGMLV 155
515 6.000e-45gi|503041372|ref|WP_013276348.1| flagellar biosynthesis protein FliS [Thermosediminibacter oceani]  clstr ali  19  1MINAYQQYQQNYILSAPPEKLVVMLCEGALKFARLAKKAIEEKNYAEANNYLIRTQDIIMELNASLDMEYEISKNLRSLYNFIYQRLIEANLKKDGGVVEEIEPLLEDLKDTWQRVY........................................ 117
516 7.000e-45T2D.3689064 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  28  1...EKKQAYTVRITQANPTQLCVILYEILLDYLEEAQAAYNRGDRAAFRMALDKSRGALSQLLDSVHSGHPISDNLKELYAFSLREIAKADAGNRVEPLQGVKKCMQQLHDAYADISAKDTRGQVMVNAQTVYAGLTYGRNALNENLTDQGNRGFR. 154
517 7.000e-45gi|551033470|ref|WP_022777319.1| hypothetical protein [Butyrivibrio sp. AE3009]  clstr ali  27  1MTSEKKQEFTLRISNANKTQMITILYEILMCYADEAIDLLGAGKKDDAVAALDKAQNCLDELIRSVDRRFELGKNLHRIYLFSKKELTVAAATGSMNKIWRVEKNIRALHEAYKELETYDNSAPMMENIQTVYAGLTYGRSALNESIAASMNRGY.. 156
518 8.000e-45METAHIT MH0026 GL0009808 [Complete] locus=scaffold2877_3:8653:9045:-  ali  22  6...AAKAYETRKVETATQADLTLMLYEGAVKFCNIAVTALEKKDYEKTNTNIQKCRNIIVELTSTLDMKYPVAEDFKRMYDYIFALLTEANMKKDMDILNRALGELRDMRDIWKEVMKRARGPQL................................ 127
519 8.000e-45JGI.Meta JGI_HUM.0269565 7004312863 C4277663__gene_383792 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160400887]  ali  22  6...AAKAYETRKVETATQADLTLMLYEGAVKFCNIAVTALEKKDYEKTNTNIQKCRNIIVELTSTLDMKYPVAEDFKRMYDYIFALLTEANMKKDMDILNRALGELRDMRDIWKEVMKRARGPQL................................ 127
520 8.000e-45gi|495862450|ref|WP_008587029.1| flagellar biosynthesis protein FliS [Salimicrobium sp. MJ3]  clstr ali  21  4.....QAYENNTVETASQGELVLKLYNGCIKFIKASGKAMENNDIEKKNLNIQKAQRIVQELIITTDPSYDISQQILPLYEYMNRRLLEANTKNDREILDEVRGLAEEFRDTWKEVLIQTRKAEYSKGG............................ 127
521 8.000e-45T2D.4183610 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  28  1MKRESIKTYSYRISQASKTQLVVIMYDMAQEYIQDALELL-PSDKDGFCRNIRQVKRIIDELSSTLDMQYDISKELFVLYMQAGKVLVACLANKNDEGLDKVIYMLKSLRKSFYEISKQDDSGPVLKNTQQVYAGLTYSSGGSNEISTDPSNRGYMV 158
522 9.000e-45gi|545060589|ref|WP_021433684.1| flagellar protein FliS [[Clostridium] bifermentans]  clstr ali  21  5..NPYNTYKQNSINMASKEQLLLMLVDGAVKYTKIAKIAIEKKDIQRAHKELIRVQDIFTELMATLDMSSSFVQDLFNLYEFIKNKLADANMKKDINIIDEVLPLIEDVRDMWHEVSKKAK.................................... 124
523 9.000e-45gi|551018796|ref|WP_022763012.1| hypothetical protein [Butyrivibrio sp. AD3002]  clstr ali  29  1MTKEKKHAYTRRITLANKTQMITILYEMVLDYISEAEECLEYDDKTGFIEGLRRAMNCIDELIHSLNVNYELGNNLLALYLFEKKQIIRSIGKLSKDGLSHVTGTFEQLHEAYLSLEKEDGEDALMINVPKVYAGLTYGKGRLQESISGDVSRGYMA 158
524 9.000e-45T2D.3978099 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  5.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIKKQDYEKANTNIKKAENIITEFKVTLNHKYAVAKDFENVYNYIYSLLVDANIKKDPDILNKALDEIRGMRDTWKEVMNQTRS................................... 125
525 9.000e-45T2D.3872177 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  2....AQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDIEKAHTNIVKAELIIEEFQASLNHKYSVAEDFDKIYNYIYGLLVEANMKKDLDILEKATEELRGMRDTWKEVMKRA..................................... 117
526 9.000e-45METAHIT MH0014 GL0077655 [Complete] locus=scaffold31160_3:2097:2573:+  ali  40  1LKKEQIVDFTRRISQANRSGLVVVMYDIFFTYLDDARAAYDAADWDAYKEALRRAQRAIDELISALNFSYDMAKNLYSIYVFCRDSIAKSLYKRDLADAEDACRLMKKLYDGFLHAAEQDHSEPLMKNTQQVYAGYTYGRDNLVETCQDDSSRGFLV 158
527 9.000e-45JGI.Meta JGI_HUM.0746614 7045190956 C3791890__gene_317053 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 158337416]  ali  40  1LKKEQIVDFTRRISQANRSGLVVVMYDIFFTYLDDARAAYDAADWDAYKEALRRAQRAIDELISALNFSYDMAKNLYSIYVFCRDSIAKSLYKRDLADAEDACRLMKKLYDGFLHAAEQDHSEPLMKNTQQVYAGYTYGRDNLVETCQDDSSRGFLV 158
528 1.000e-447070782352 C3885178__gene_270913 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 3 of subject 159510762]  ali  16  10MINAASLYQGAAINTASPAELTLMLYNGAIKFCNLAAAGIEEKDIMKAHNNLMKAQKIIRELQATLNFKYEVSKDFDLIYTRILKNLIAANVKKDIDKLNEALEDIRGIRDVWAQVMKVAK.................................... 130
529 1.000e-44JGI.Meta JGI_HUM.1310501 7070782352 C3885178__gene_270913 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 3 of subject 159510762] :  ali  16  10MINAASLYQGAAINTASPAELTLMLYNGAIKFCNLAAAGIEEKDIMKAHNNLMKAQKIIRELQATLNFKYEVSKDFDLIYTRILKNLIAANVKKDIDKLNEALEDIRGIRDVWAQVMKVAK.................................... 130
530 1.000e-44gi|556511101|ref|WP_023355998.1| flagellar protein FliS [Catonella morbi]  clstr ali  17  3MTNAASLYQGAAINTASPAELTLMLYNGAIKFCNLALIGMEEEDIMKAHNNLMKAQRIIRELQATLNFKYEVSKDFDLIYTRILNSLLAANIKKDTDKLNEALEDIRGIRDVWTQVMKVAK.................................... 123
531 1.000e-44METAHIT unmapped GL0249133 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold255197_2:1:447:-  ali  39  1MQKEKIQEFTRRVSQDNRTSLIVTMYDIMLTYLDEAKAALEAEDREGFKAGLRHADRVLVQLQDSLNFKYSPADTLYALYVYCREELALAMAKQDLTGIGHAQTVLCGLRGGFAEAAAKDTSEPLMHNTEQVYAGITYGKNNLNESFQS........ 149
532 1.000e-44T2D.2345331 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  39  1MQKEKIQEFTRRVSQDNRTSLIVTMYDIMLTYLDEAKAALEAEDREGFKAGLRHADRVLVQLQDSLNFKYSPADTLYALYVYCREELALAMAKQDLTGIGHAQTVLCGLRGGFAEAAAKDTSEPLMHNTEQVYAGITYGKNNLNESFQS........ 149
533 1.000e-44gi|647360213|ref|WP_025774195.1| flagellar biosynthesis protein FliS [Moorella thermoacetica]  clstr ali  21  5..NPYQAYRQNQVQTLSQEKLVLMLYDGALRFCRQGLVAMEQNDYAAVSNNLGRAEDILSELMATLNRDVDISENLYKLYDFMYRHLVQANVKKSVKMINEVIELLQQLRDTWEEAIKI...................................... 122
534 1.000e-44gi|493881808|ref|WP_006828066.1| flagellar biosynthesis protein FliS [Planococcus antarcticus]  clstr ali  15  5..NPYQTYQQNSVMTASPQELTLMLYSGSVKFIKIAKRAMNDKNFQEKNTNIIKAQNIILELRSTLNSDIDMSTGLEQMYEYMYSRLLEANMKNDLEALEEVETLMTDMRNTWKQAMALARK................................... 124
535 1.000e-44gi|639453596|ref|WP_024631602.1| MULTISPECIES: flagellar biosynthesis protein FliS [Paenibacillus]  clstr ali  19  3.TSPYEKYKQSSVQTSTPGQLVIMLYDGAIRFVKVGLEGISSKDYMKANVNLGKAQTIISELMSTLDHSYPVSKNLFSMYEYMNHLLIQSNIKKVTQPAEEALNYLQELRETWIVANKQ...................................... 120
536 1.000e-44gi|494375362|ref|WP_007200458.1| flagellar biosynthesis protein FliS [Fictibacillus macauensis]  clstr ali  19  4.QNPNLLYQNNAVATASPGDLIVMLYNGCLKFITTAKQAIINHDIPLKNTMIQKAQKIIQELMVTLNPEVMLSESLLSLYDYMHRRLIQANIETNIRYLEEVESYLVDLRDTWKEVVRM...................................... 121
537 1.000e-44gi|503002646|ref|WP_013237622.1| flagellar biosynthesis protein FliS [Clostridium ljungdahlii]  clstr ali  22  5..NAYKTYKTNSVNYASKEQLLLMLVDGAVKFSKIGRQAIVDKDIKKAHENIIKAENIFNELIISLDVSKKWGQSLMSLYDFIVRRLIDANMKKDVKVIDEVIPLIEDVRNTWEEAYKISK.................................... 125
538 1.000e-44T2D.3566638 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  41  1MKKEQIVDFTRRISQANRSGLVVVMYDIFFTYLDDARAAYDAADWDAYKEALRRAQRAIDELISALNFSYDMAKNLYSIYVFCRDSIAKSLYKRDLADAEDACRLMKKLYDGFLHAAGQDHSEPLMKNTQQVYAGYTYGRDNLVETCQDDSSRGFLV 158
539 1.000e-44METAHIT MH0011 GL0034681 [Complete] locus=scaffold116248_1:1228:1701:-  ali  30  1LTGEERKEYGMKVTQAGGSGLVVITYDIIAKYLDDAMAALNKSDNAEYRRCLGLARALLAELTGALDMQYEVSKKLMALYIFMNKVIVRADITKDVTELVRIKEMLSKLREAFAKVCEECPQEPVMDNVETVYTGYTYSKTAMNEEIYSNTNRGFTV 157
540 1.000e-44METAHIT unmapped GL0425760 unmapped_[Complete]_[mRNA]_locus=scaffold656958_1:234:635:-  ali  55  1........................MYDIYFAYSDDAKKALEMGDDQAFKKGIENAQAGLDELIGALDFKYPITDQLFSLYSYCKKQLSKAIYEKTVEKIAEADTIMKKLRGSFKIAAEQDTSGPIMENTQKVYAGITYGRTQLNENCIDDTHRGFFA 133
541 1.000e-44T2D.2465530 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  55  1........................MYDIYFAYSDDAKKALEMGDDQAFKKGIENAQAGLDELIGALDFKYPITDQLFSLYSYCKKQLSKAIYEKTVEKIAEADTIMKKLRGSFKIAAEQDTSGPIMENTQKVYAGITYGRTQLNENCIDDTHRGFFA 133
542 1.000e-44gi|547292934|ref|WP_022025666.1| putative uncharacterized protein [Clostridium sp. CAG:75]  clstr ali  32  1MTKEQIKEYTARVAQANRTELVVIIYELLLDEIQEGNKQYQAGNTDAGEKQIRKAQGYLQELLGSLDFRYEIALQLRQLYRYVNEQLIATLVQRRPIHLDAACEVIRGLMESFEQVAKEDHSGPVMEHSQQLYAGLTYGKGTLNEVSLGEGS..... 152
543 1.000e-44METAHIT V1 GL0054614 [Complete] locus=scaffold3854_1:2018:2494:-  ali  32  1MTKEQIKEYTARVAQANRTELVVIIYELLLDEIQEGNKQYQAGNTDAGEKQIRKAQGYLQELLGSLDFRYEIALQLRQLYRYVNEQLIATLVQRRPIHLDAACEVIRGLMESFEQVAKEDHSGPVMEHSQQLYAGLTYGKGTLNEVSLGEGS..... 152
544 1.000e-44T2D.3311717 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  32  1MTKEQIKEYTARVAQANRTELVVIIYELLLDEIQEGNKQYQAGNTDAGEKQIRKAQGYLQELLGSLDFRYEIALQLRQLYRYVNEQLIATLVQRRPIHLDAACEVIRGLMESFEQVAKEDHSGPVMEHSQQLYAGLTYGKGTLNEVSLGEGS..... 152
545 1.000e-44gi|547246470|ref|WP_021982200.1| putative uncharacterized protein [Eubacterium sp. CAG:603]  clstr ali  27  1MTREEINQFSVRISQSNRTQIVVITYEIIINYLDSARDSFDNSNVTDFVRNVRKARQFVNELSSVLDFRYKISFELMNLYMFANECLLKSELRREDVNLEVVRDMMIKLRDSFETVSKQDNSKPVMQVREKVYEGLTYGKNGM.............. 143
546 2.000e-44JGI.Meta JGI_HUM.0934131 7067708345 C3168610__gene_257322 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 159571453]  ali  22  1MNPYLKQYRQTQIDTAPKEQILLMLYDGAVRFLNQAKAGFAEKNIEKIHNNIVKVQNIITEFESTLDMKTEFAQNLFALYEYINNQLLLANIKKREECLDEALKHMTELRDTWRQAVKQFKAA.................................. 125
547 2.000e-44gi|503044914|ref|WP_013279890.1| flagellar biosynthesis protein FliS [Butyrivibrio proteoclasticus]  clstr ali  20  20.QRAYAQYKNNKVMSASGPELTLMLYDGAIKFLNIADFAIEKNDIYKAHENIVKTEKIIDYLRNTLDMKYAVAQDFENMYSYIARRLVEANIGKDREIIAEVNKHMHAIRDNWIEVMKANH.................................... 139
548 2.000e-44gi|551004868|ref|WP_022749555.1| flagellar biosynthesis protein FliS [Lachnobacterium bovis]  clstr ali  20  4.NQGYAAYANNKVLTASPAELVLMLYEAAIKFTNIAIAAVDKKDIQKAHDNIIKVERIIDELQLSLDKRYPVAQDFDNVYQYIQERLVVANMDKDKEVLEEILKHLRKMRDTWKEVMKKA..................................... 128
549 2.000e-44JGI.Meta JGI_HUM.1976583 7017293942 C3350401__gene_199191 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 160765029]  ali  29  1MTKECKQQFTLRITQANATQLVVILYEMTLQYLADAEQAAED---AQFLEAVRRTRGCINELLNSLHREYSPATELSRLYLYCIRRLAACEAKADRTALQDIRKVIAPLCDAYRQIQDQNSSGPVMNNSQTVYAGLTYGRNQLTENMADQSNRGMLV 155
550 2.000e-44JGI.Meta JGI_HUM.3197194 7005526659 SRS013687_Baylor_scaffold_59246__gene_123125 flagellar protein fliS [Human Stool microbiome from visit number 1 of subje  ali  30  1LTGEERKEYGMKVTQAGGSGLVVITYDIIAKYLDDAMAALNKSDNAEYRRCLGLARALLAELTGALDMQYEVSKKLMALYIFMNKVIVRADITKDVTELVRIKEMLSKLREAFARVCEECPQEPVMDNVETVYTGYTYSKTAMNEEIYSNTNRGFTV 157
551 2.000e-44gi|653223111|ref|WP_027435652.1| hypothetical protein [Lachnospiraceae bacterium AB2028]  clstr ali  33  1MTGEKKQEFMLRISEANRSRMVVILYDMFLTYVKEAEEEFTLEDMNTYKTGIRNAKAVLRELIDSLNMEYDLARRTYQIYRFVERELIMADIRRDPAGLGEAEKIMKSLRDAYASAAESDSSEPIMKNTDTIYAGMTYSRGKLTDSAASCTNRGFLV 163
552 2.000e-44gi|547795191|ref|WP_022205132.1| putative uncharacterized protein [Eubacterium sp. CAG:248]  clstr ali  29  1MNNDMIRTYSYRISQATRSQLVVITYDIITDYLN---EALNDDASTGYKEKLHMAMRGIDQLITGLDMEYEISVQLYQLYNYMKRTLISAQVSGERDSVSRVITMLGKLRTAFLEVSQLDDSKPLMKNTEKVYSGLTYSRYGANETAQDTKSRGYKV 155
553 3.000e-44CGD_mc16a.530859 GB7X7UD01EDNFD|GB7X7UD01EDNFD|metagene|gene_1  ali  95  1....................................KNALVSEDREALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDEADVIMKKLRNSFETAAADDKSAPLMDNAQKVYAGMTYGRGRLTESFINDDNRGFLA 121
554 3.000e-44METAHIT MH0006 GL0214352 [Complete] locus=scaffold318350_1:28:495:-  ali  29  1MNNDMIRTYSYRISQATRSQLVVITYDIITDYLN---EALNDDASSGYKEKLHMAMRGIDQLITGLDMEYEISVQLYQLYNYMKRTLISAQVSGERDSVSRVITMLGKLRTAFLEVSQLDDSKPLMKNTEKVYSGLTYSRYGANETAQDTKSRGYKV 155
555 3.000e-44T2D.2601611 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  29  1MNNDMIRTYSYRISQATRSQLVVITYDIITDYLN---EALNDDASSGYKEKLHMAMRGIDQLITGLDMEYEISVQLYQLYNYMKRTLISAQVSGERDSVSRVITMLGKLRTAFLEVSQLDDSKPLMKNTEKVYSGLTYSRYGANETAQDTKSRGYKV 155
556 3.000e-44JGI.Meta JGI_HUM.1842032 7015017758 C2862008__gene_282438 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject 763536994]  ali  29  1MNNDMIRTYSYRISQATRSQLVVITYDIITDYLN---EALNDDASSGYKEKLHMAMRGIDQLITGLDMEYEISVQLYQLYNYMKRTLISAQVSGERDSVSRVITMLGKLRTAFLEVSQLDDSKPLMKNTEKVYSGLTYSRYGANETAQDTKSRGYKV 155
557 5.000e-44T2D.357903 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  29  1MTKECKQQFTLRITQANATQLVVILYEMTLQYLADAEQAAED---AQFLEAVRRTRGCINELLNSLHREYSPATELSKLYLYCIRRLAACEAKADRTALQDIRKVIAPLCDAYRQIQDQNSSGPVMNNSQTVYAGLTYGRNQLTENMADQSNRGMLV 155
558 7.000e-44JGI.Meta JGI_HUM.7345218 7073755069 SRS023468_LANL_scaffold_17240__gene_35376 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  28  1MTDEKIKIYTEKIAKANRTELIVLLYDMFLDYISDARDCFKKDDMFEFTLNIKRAEKVLMHLEDSLDFTYPISNNLYSLYVYCQRVITQTIYKKDIFYLPEAEKVITSLRGSFEEIAKTDKSESIMKNTENIVYGMTYGKNDINKMTDSXKS..... 152
559 2.000e-43gi|548219082|ref|WP_022438274.1| putative uncharacterized protein [Clostridium sp. CAG:411]  clstr ali  28  1MEREKRQEFSARITQANRSELLVIVYEIVQEELTEALAEFEKQELQKFDISLQNAQKFLNELMGTLNYEYEISYQLLSIYRFVNKIIIEARIKRQDKDIEACIRLLEKLRHAYAEVASKDQAGPMMSNVQKLYSGLTYGKGALSEVSVNGGHRGLYA 159
560 2.000e-43METAHIT MH0030 GL0011471 [Complete] locus=C3925771_1:93:611:-  ali  28  14MEREKRQEFSARITQANRSELLVIVYEIVQEELTEALAEFEKQELQKFDISLQNAQKFLNELMGTLNYEYEISYQLLSIYRFVNKIIIEARIKRQDKDIEACIRLLEKLRHAYAEVASKDQAGPMMSNVQKLYSGLTYGKGALSEVSVNGGHRGLYA 172
561 2.000e-43T2D.555838 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  28  14MEREKRQEFSARITQANRSELLVIVYEIVQEELTEALAEFEKQELQKFDISLQNAQKFLNELMGTLNYEYEISYQLLSIYRFVNKIIIEARIKRQDKDIEACIRLLEKLRHAYAEVASKDQAGPMMSNVQKLYSGLTYGKGALSEVSVNGGHRGLYA 172
562 2.000e-43gi|548230363|ref|WP_022449058.1| putative uncharacterized protein [Roseburia sp. CAG:303]  clstr ali  31  1MTEEKIREFSLRISQTSRTGLVAITDEIIITYIEDAKKALGENDKEAFLFNIGKAKQFVDDLSSSLDMRFKISYELQRLYSFIRGRLIIAEGRENAEYLDVCIEMLEKLRSAFEKVAESDHSGNVIQGSQKVYAGLTYGPGSLNEVV.......... 148
563 3.000e-43gi|651396274|ref|WP_026507975.1| hypothetical protein [Butyrivibrio sp. MC2013]  clstr ali  33  2...............ANSTQMITIIYDIALSYLDEASDALDRDDKEALSLALKRVQKCIDELMRSLNRKVEVADNFLQLYIFAKRELIKVDIRGKRESLDSIRGIFLKMRDCYRELEQRTDEPPLVSGAQEVYAGLTYGPGSLNESVQDYLSRGYNA 144
564 3.000e-43gi|653225415|ref|WP_027437935.1| hypothetical protein [Lachnospira multipara]  clstr ali  34  1MNNDLIRTYSYRISQANRTELVVIIYDLALDYL---KEACEVEEIEEKRHAIVGAQRAIDELIVGLNMEFDLSKNLFVIYNFVKRRLISNFARFDRDEVCKLQNILLKLRQSFYEVSKVDESASLMKNTQNVYAGLTYSKAGYCESISGNANRGYIV 154
565 3.000e-43gi|651423385|ref|WP_026526272.1| hypothetical protein [Butyrivibrio sp. VCD2006]  clstr ali  27  1MTKEKIRGYTRRITMANKTQMITILYEMVLDYICEAEDSLELQDEKGFTNSLSRATSCIDELIHSLNIKYELGKNLLALYLFEKKQIIKASARISSEELIHVKKTFERLHEAYLQLETKNNEEALMMNVPKVYAGLTYGKGRLEESIANFMSRGYMA 158
566 3.000e-43T2D.3376964 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]  ali  38  1MTAETIATFTRKIVASNRSELICVLYEIYFSYEQEAIEALTGEGKEAYTKALRQCGQVVRHLKDALDFSYKISYSLYALYDFVERQLAKAMYEQRVERIQSAGKIMRDLEESFVQVAKQDASGPMMGNAQQVTAGLTYGKGQLNESMGAESNRGFFA 161
567 4.000e-43gi|505363458|ref|WP_015550560.1| Flagellar protein FliS [Butyrivibrio fibrisolvens]  clstr ali  30  1MNKDKISAFTLKIASSNGCGLISILYDIYGEYEQDALDQFAAGQVDDAIVALKKCAEVVNHLQKDLNFNYRVSSNLYALYDYVQRNVSKSIYKANEEGLLEAKKVMDELGDAFDQVAKKDSSAPIMQNTQYVRAGVTYGREALNESLMNGTSRGFWV 158
568 5.000e-43gi|651399326|ref|WP_026510976.1| hypothetical protein [Butyrivibrio sp. LC3010]  clstr ali  26  1MTQDLILAYTRRITMANKTQMITILYEMILDYISEGERKLEEGDEKGFAEELSKSMNCIDELIHSLNLGYELGKNLLSLYIFEKGQILKSIAKRSKDDLTHVKKTFDSLHEAYLKLEEQNKEEALMTNVPKVYVGLTYGKSRLTESVSNYTSRGYMA 158
569 5.000e-43JGI.Meta JGI_HUM.2280040 7004639927 SRS013705_Baylor_scaffold_7854__gene_8187 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of  ali  35  1LKAESVKIFTRRITSANKSEIIVIIYDIIEENLALAKKALAEGDRETYRNEIKQAISFVKELLVSLDMKYEVSKNLASLYIYVSRCLNFALVSGKKEEIEAAEKVLRKLGDSFREVAKTDESKPVMENTQRVYAGITYGRGDLDETLVAPESRGFRA 160
570 6.000e-43JGI.Meta JGI_HUM.0533326 7058491991 C3970206__gene_342942 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765701615]  ali  24  4LTREQLKDYGIKVTQANGTELVKLTLELAAEYVGEAEKSV--DDRDLFTARINKARAFIAHLISSLNMWYEISSQLLNIYLYLNSELLKAGIKGDATLLPRFRGILLSLSEAFGEICKEDTNGPVMENAEPVYVGLTYSKGKLNESYIGEKSRGF.. 157
571 7.000e-43gi|546463519|ref|WP_021865594.1| putative uncharacterized protein [Eubacterium sp. CAG:86]  clstr ali  28  1MKKDEIQTFSYRISQANKTQLIVIMYDMAIQYVSDAIEYETQAEKDEYESDVVQVKRVVDSLVTSLDMQYEVSVQLYNIYLVMQRYLVKAVAKKDKNLLESVKKMLETMRKSFYELSKQDDSEPLMKNTQQVYAGFTYSNGGSNEYSKGYENRGYKV 163
572 9.000e-43gi|547249239|ref|WP_021984888.1| putative uncharacterized protein [Clostridium sp. CAG:127]  clstr ali  28  1MTQEQKQEFTRRISQENHSGLILVLCDIFHTYGMDAMAAYEAENMTTYLQTIGQARRAMQELIECFSKEDPLGRNVIAILRFIYGKLVRSEVRRQPDELDRCVQMVDDLRVGFVHLHELDNEGAVMQNVHQVYAGLTYGKGTLNESIVNYEKRGYQV 159
573 9.000e-43T2D.2653480 [KEGG:K02422] flagellar protein FliS;|[eggNOG:NOG299229]