current user: public

anford Burnham Prebys Medical Discovery Institute

Query: gi|238922464|ref|YP_002935977.1| hypothetical protein (EUBREC_0038) [Eubacterium rectale ATCC 33656], from E.rectale

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
2 4.000e-61gi|489440960|ref|WP_003346432.1| flagellar protein FliS [Bacillus methanolicus]  clstr ali  20  4.NNPYQSYQQNAVNTASPGELTLMLYNGCLKFIHLAKKAMEEKNIEDRNTNLLKAQKIIQELMVTLNMDIDISKQMMALYDYIHRRLIEANVKNDAAILDEVEGLVTEFRDTWKQVIQVNRQKQFAQGGQ........................... 132
4 3.000e-60gi|944527176|ref|WP_055738708.1| flagellar export chaperone FliS [Bacillus shackletonii]  clstr ali  21  1MNKTYEAYQQVSVTTATPGELVLMLYNGCIKFIKIAKNAMNEQDIEKKHLNITKAQNIIKELIVTLNMDYEISKDMRKLYDYMNRRLIEANIKNDTSILDEVEHFVEEFRDTWKEVIKITRKSQF................................ 125
5 3.000e-60gi|1004909843|gb|KYD19302.1| hypothetical protein B4119_3596 [Geobacillus caldoxylosilyticus]  clstr ali  19  27MNNPYQNYQVNAVQTASPGELTLMLYNGCLKFIKLARKAIEENNIPARNENLIKAQNIIQELMVTLNMEYEVAKSMMTMYDYIYRRLVEANVKNDAAILDEVEGYVTEFRDTWKQVIQINRQRQYAQGGQA.......................... 157
6 5.000e-60gi|738222181|ref|WP_036177795.1| flagellar protein FliS [Lysinibacillus massiliensis]  clstr ali  23  5.NSALNAYKQNSVTTASPGELTLMLYNGCLKFLSQAKKAMEDKNIQNKNTNLQKAQAIIHELMSTLNMDYDISKQMLPLYEYMNRRLLEANLKNDTTIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNSQQV......................... 134
9 7.000e-60gi|515282954|ref|WP_016838008.1| flagellar protein FliS [Ureibacillus thermosphaericus]  clstr ali  22  5.NNAYNAYKQNSINTASPGELTLMLYNGCIKFLNLARKAIEEKHIEEKNTNLQKAQNIINELIVTLNMDYEISKQILPLYEYMNRRLIEANIKNDVEIVDEVIGLVTEFRDTWKEVIKLNR.................................... 124
10 7.000e-60gi|496690420|ref|WP_009331963.1| flagellar protein FliS [Bacillus sp. 2_A_57_CT2]  clstr ali  18  5..NPYQSYQQNSVNTASPGELTLMLYNGCLKFIHQAKKAIMDNNIEAKNTNIQKAQNIIQELMVTLNMDVEVSQNMMSLYDYMNRRLIEANVKSETGILDEVEGLVTEFRDTWKEVIQVNRQKQFSQGG............................ 131
12 1.000e-59gi|738199745|ref|WP_036155673.1| flagellar protein FliS [Lysinibacillus odysseyi]  clstr ali  21  5.TNAYNAYKQNSVTTASPGELTLMLYNGCIKFLGKAKVAITDKNIQEKNHNIQRAQAIIAELMSTLNMDIDISKQMLPLYDYMNRRLIEANIQNDIAIIEEVEGLVTEFRDTWKEVIKITRQQQY-GSAQQV......................... 134
16 4.000e-59gi|651950964|ref|WP_026679172.1| flagellar protein FliS [Fictibacillus gelatini]  clstr ali  20  5..NPYQQYQTNSVQTASPGELTLMLYNGCLKFIGLAKAAIKANHIEEKNTNCLKAQKIIQELMVTLDMDIEISKSLMQMYDYFHRRLIEANVKSDIEILEEVEGYVTEFRDTWKEVIQINRRQQYGEGG............................ 131
22 3.000e-58gi|493357133|ref|WP_006313683.1| flagellar protein FliS [Caldisalinibacter kiritimatiensis]  clstr ali  21  3MKNPYSQYQQNSVMTASPEELTLMLYNGAVKFIKQGKVFLEQKDMEKAHNSIVRAQDIISELNITLNMDYEISKNLRSLYTFILERLMDANIKKDIKILDEVLPLVEELRDTWKEAMQLAKK................................... 124
25 6.000e-58gi|674648142|emb|CEA02077.1| Flagellar protein FliS [Lysinibacillus sp. 13S34_air]  clstr ali  22  6..SAHNAYKQNSVTTASPGELTLMLYNGCLKFLTIAKKAMLDKNIEAKNTNLQKAQAIITELMVTLDMNVPISKEIQPLYDYMNRRLLEANIKNDPAIIDEVAGLVTEFRDTWKEVILLNRQQQ................................. 127
29 8.000e-58gi|738243798|ref|WP_036199033.1| flagellar protein FliS [Lysinibacillus sinduriensis]  clstr ali  23  5.NTALNAYKQNSVTTASPGELTLMLYNGCLKFLTKAKNAIDEKNIQEKNTYILRSQAIIAELMSTLNMDIEISKQMLPLYEYMNRRLIEANVKNDTAIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNAQQV......................... 134
30 8.000e-58gi|979841988|ref|WP_059351651.1| flagellar protein FliS [Bacillus coahuilensis]  clstr ali  20  4.KNPYQAYQNNSVNTASPGELTLMLYNGCLKFLHLGKKAIEEGNIQEKNINIQKAQNIIQEFMVTLNMDIPMSKNLQSLYDYMYRQLISANVKSDAAIIDEVEGMIVELRDTWKQVIQLHRQQQHVQGGQ........................... 134
31 8.000e-58gi|498362738|ref|WP_010676894.1| flagellar protein FliS [Bacillus timonensis]  clstr ali  18  5..NPYQTYQDNSVFTATPGELTLMLYNGCLKFMGQAKKSIQEKNIETKHINISKAQNIISELMVTLNMDYEISKEMRRLYDFINRRLIEANIKNDVKLLEEAEDLVIEFRDTWKEVIRLNRAKQF................................ 127
34 1.000e-57gi|495454122|ref|WP_008178816.1| flagellar protein FliS [Bacillus sp. B14905]  clstr ali  20  7...AQNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQAIQEKNIQEKNTNLIKAQAIISELMATLNMDIEISKQMLPLYEYMNHRLVEANIQNDVAVIEEVEGLVTEFRDTWKEVIRINRQQQFGQG............................. 131
36 2.000e-57gi|740272517|ref|WP_038112811.1| flagellar protein FliS [Tuberibacillus calidus]  clstr ali  24  9..NPYKAYEQNSVLTATPGELTLMLYNGCLKFIHQGKKAIEAKDNEAKNTNLQKAQKIIQELMVTLNMDIPISKELLPLYDYIYRRLIEANVKSDTAILDEVDELVTSFRDTWKEVIQITRQQ.................................. 129
37 3.000e-57gi|489425044|ref|WP_003330726.1| flagellar protein FliS [Bacillus azotoformans]  clstr ali  20  4..NPYQTYQNNAVNTASPGDLTLMLYNGCLKFIKQAKIAIENKDVETKHMNLVKAQNIITELMVTLNTDYEVGKNMMQMYDYMKRRLIEANTKSDIAILNEVEGYVAEFRDTWKEVIRISRQQKYAVGGQ........................... 131
38 3.000e-57gi|740343063|ref|WP_038179700.1| flagellar protein FliS [Viridibacillus arenosi]  clstr ali  23  6.QSAHQAYKQNSVTTASPGELTLMLYNGCIKFLHKGKLAIGSKDVEAKNTNLLKAQAIISELMSTLNMDIEISKQMLNLYEYMNRRLVEANIQNDVAIIDEVEGYVVEFRDTWKEVIRLNRQQQFTGN............................. 132
40 4.000e-57gi|926247108|ref|WP_053585386.1| flagellar protein FliS [Lysinibacillus contaminans]  clstr ali  18  5.TSAYNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKTAIHEKNVQEKNTNLLKSQAIIAELMSTLNMDIEISKQMLPLYEYMNHRLVEANIQNDVTLIEEVEGLVTEFRDTWKEVLRINRQQQYGSGNEA.......................... 134
41 4.000e-57gi|738259807|ref|WP_036214787.1| flagellar protein FliS [Lysinibacillus sphaericus]  clstr ali  15  5.TSAHNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKLAIHDKNVQEKNINLQKAQAIISELRATLNMEIEISKNMMALYEYMNNRLVEANIRNDIAIIEEVEGLVTEFRDTWKEVIRINRQQQFGNG............................. 131
42 4.000e-57gi|750071755|ref|WP_040376439.1| flagellar protein FliS [Bacillus psychrosaccharolyticus]  clstr ali  17  5..NPYQSYQQNSVNTASPGDLTLMLYNGCLKFITLGKKAMETGNIQEKNNNLLKAQNIIHELMVTLNMDVAVSKDLLALYDYLNRQLIEANLKNDSAILDEVTEFVTDFRNTWKEAIQLNRQKQFTQSGQA.......................... 133
45 5.000e-57gi|1016267043|gb|AMW98174.1| flagellar protein FliS [Rummeliibacillus stabekisii]  clstr ali  20  7.QNAYNAYKQNSVTTASPGELTLMLYNGCLKFMHQAKKGILEKNIEMKNTNLIKAQNIITELMSTLNMDLAVSNEMMPLYDYMNRRLMEANIKSDPSIIDEVEGLVVEFRDTWKEVIKFNRQKQFVGN............................. 133
46 5.000e-57gi|902800289|ref|WP_049669426.1| flagellar protein FliS [Bacillus sp. FJAT-27916]  clstr ali  15  5..NPYQAYQSNAVTTASPGELTLMLYNGCLKFIKAGRMAMDNKEIEKRNENLLKAQNIINELRVTLNMEIEVSKNMMAMYDYILRRLIEANMKNDPAILDEVEELVVGLRDTWKQAIQLNRQKQFAGG............................. 130
48 8.000e-57gi|653220944|ref|WP_027433501.1| flagellar export chaperone FliS [Lachnospiraceae bacterium MD2004]  clstr ali  21  1MTNPYAVYQKNKIMTASPAELTLMLYDGAIKFCNIALAGIEEKDIEKAHINIRKANNIIDELQSTLNHKYPVAKDFENVYEYIRDCLIEANIKKDPEVLNEALGHIRTMRDTWKEVMKANKVG-----TGGVVAG...................... 132
52 2.000e-56gi|504637535|ref|WP_014824637.1| flagellar protein FliS [Solibacillus silvestris]  clstr ali  20  5.TNAFNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQSIADKNIEERNHYIQRSQAIIGELMATLNMDIGISKQMLPLYEYMSRRLTEANIQNDSSIIEEVEGLVTEFRDTWKEVIKITRQQQYGTAGQ........................... 133
56 3.000e-56gi|953352989|ref|WP_058002949.1| flagellar protein FliS [Bacillus farraginis]  clstr ali  21  1MQNSYETYQQVSVNTATPGELTLMLYNGCIKFIKAAKRAINDKQIEVKHINITKAQKIINELIVTLNMDYAIAKDMRRLYDYMNRRLIEANIKNDVSILDEVEALAIDFRDTWKEVIVINRKGTY................................ 125
58 4.000e-56gi|524311234|emb|CDA67768.1| putative uncharacterized protein [Clostridium sp. CAG:510]  clstr ali  21  5..NAYAQYSNNKVLTASPAELVLMLYDGAIKFCNIAVVAIDAKDIPKAHTNIIKAQKIIDHLRITLDMSYPVAQDFDNIYAYVAKRLVEANVSKDKEILEEVCTHLRSVRDTWKEVMRINH.................................... 123
60 5.000e-56gi|524632891|emb|CDD46296.1| putative uncharacterized protein [Firmicutes bacterium CAG:534]  clstr ali  19  5..NAYAQYKNSKVLTASPAELTLMLYEGAIKFCNIAIAAIEQKEVEKAHVNIRKAQKIIEHLRVTLDMKYPVAKDFDNMYQYIDRRLLEANISKDPEILKEVLTHLHAIRDTWKEVMRINREKGV................................ 127
61 5.000e-56gi|922740928|ref|WP_053356986.1| flagellar protein FliS [Bacillus sp. FJAT-26652]  clstr ali  18  5..NPYQSYQNNSVQTASPGELTLMLYNGCLKFITQAKQAIHNKNLQEKNNNCLKAQKIIQELMVTLNMDAPVSHTLMPMYDYLNRRLIEANIQGSVEILDEVESFVTEFRNTWKEVIQINRRQQYGQGG............................ 131
62 6.000e-56gi|922542678|ref|WP_053348569.1| flagellar protein FliS [Bacillus butanolivorans]  clstr ali  17  4.NNPYQSYQQNSVNTASPGELTLMLYNGCLKFITLSKKAIAEKNFQEKNTNLIKAQKIIQELMVTLKMDLAISKELMSLYDYLNRRLIEANIKSDLDILEEVEGFVMEFRDTWKEAIQLNRQKQFANSGQA.......................... 133
65 1.000e-55gi|654945900|ref|WP_028396064.1| flagellar protein FliS [Bacillus sp. FJAT-14578]  clstr ali  19  4.NNPYQAYRQNSVNTASPGELTLMLYNGCLKFMKLARVAIEQKDIEAKNENLLKAQKIIQELMVTLNMDVAMSKTMMAMYDYINRRLIEVNMTNDLTILDEVEGYVTEFRDTWKQVIQLNRQKAHQGG............................. 130
67 2.000e-55gi|953328935|ref|WP_057983946.1| flagellar protein FliS [Virgibacillus soli]  clstr ali  18  5..NPYQTYQQNAVTTAAPGELTLMLYNGCLKFINLAKVGLEKNKIEEKNTNIQKAQNIVNELMVTLNMELPISKNMMSLYDYLNRRLMEANIKNDIDILTEVEEMIKEFRDTWKQAIQLNRQHQHAAGS............................ 131
69 3.000e-55gi|645063480|ref|WP_025434688.1| flagellar protein FliS [Eubacterium acidaminophilum]  clstr ali  18  3MANPYAKYQEQSVFTATPEELTLMLYDGCIKFINRAAIGIEDKNIEMTNTNIIKAQNIVRELNITLNMDYEVSKGLRPLYDYMHTRLIDANIKKDKEALEEVKGLVTDMRDTWKEAMKLAR.................................... 123
70 3.000e-55gi|498317742|ref|WP_010631898.1| flagellar protein FliS [Sporolactobacillus vineae]  clstr ali  22  3.NNAYKVYQQNSVLTATPGELTLLLFNGCLKFIRQGRGAILNKNYEQKNKVIQKAQAIITELMVSLDSKQPVAKDMMSLYDYIHRRLIEANVKNDITILDEVEKLVADFRDTWKQVIIINRKEQ................................. 125
71 5.000e-55gi|924349947|ref|WP_053484340.1| flagellar protein FliS [Lysinibacillus sp. FJAT-14745]  clstr ali  20  5.NTAYDIYKQNSVTTASPGELTLMLYNGCLKFLTKAKSAINNKKIEQRNYNIQRSQAIISELMSTLNMDIDISKQMLPLYEYILRRLTEANIKNDATIVEEVEGLVTEFRDTWKEVIKITRQQQYGNQNQ........................... 133
72 6.000e-55gi|928969200|ref|WP_053993637.1| flagellar protein FliS [Lysinibacillus macroides]  clstr ali  19  6..SAQNAYKQNSVSTASPGELTLMLYNGCLKFLHLAKIATKEKKIQEKNTNIQKAQAIIHELMVTLNMDYAISKNMLALYEYMNQRLMEANMQDDVAIVEEVEGLVTEFRDTWKEVIRINRQQQFGQGSEQV......................... 136
73 6.000e-55gi|738226614|ref|WP_036182074.1| flagellar protein FliS [Lysinibacillus manganicus]  clstr ali  20  5.NAAFNAYQQNSVTTASPGELTLMLYNGCLKFLTKAKMAIDANDIQEKNTNIQKAQAIIHELMVTLKTDQEVGQQMLSLYDYMNRRLMEANINNNKEIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNAQQI......................... 134
74 6.000e-55gi|652403152|ref|WP_026798929.1| flagellar protein FliS [Pontibacillus halophilus]  clstr ali  20  4.....QAYQSNSVQTASPGELTLMLYNGCLKFIKLARKAIESNQFEAKNTNIQKARNIVQELMVTMNQDYEISKEIMPLYDYMNRRLMEANINNDVNILDEVEGLATEFRDTWKEVVKQTRMEKFGQGGQA.......................... 129
75 7.000e-55gi|501764389|ref|WP_012634560.1| flagellar protein FliS [[Clostridium] cellulolyticum]  clstr ali  21  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDDKNIEKANNSIIRAQDIILEFQVTLDMKYEVSNNLYSIYDYMHRRLVQANIKKDKDILEEVLGMAKELRDTWTQAMKIAK.................................... 123
76 7.000e-55gi|657698984|ref|WP_029497990.1| flagellar protein FliS [Kurthia huakuii]  clstr ali  24  4.QNAYNAYKQNSVTTASPGELTLMLYNGCIKFIHQAKKAIEVKDISNRNKYVQKAQAILNELMSTLNMDIPVSKEMFNLYEYMYHQLTQANINNDVAILDEVEGLVVEFRDTWKQVIQMNR.................................... 123
77 7.000e-55gi|517536148|ref|WP_018706356.1| flagellar protein FliS [Bacillus fordii]  clstr ali  20  4.RNPYEAYQNNSVTTASPGELTLMLYNGCLKFINLAKHAIENKEIENRNTNIQKAQNIVSELMLTLNMDVEISKNMRSLYEYSNRRLMEANFKQDISILEEVEEIMTEFRDAWKQVIQLNRQ................................... 124
79 8.000e-55gi|647281956|ref|WP_025727184.1| flagellar protein FliS [Bacillus ginsengihumi]  clstr ali  17  4.KNPYQAYQNNSVTTASPGELTLMLYNGCLKFIHLAKQAIEQNNIEEKHKNLIKAQNIIRELMVTLEPKFDGAENMMRLYDFMLQELIAANLKNDIKKLNDVEELVTGFRDTWKEVIQLNRKQSYAQGGKA.......................... 133
80 9.000e-55gi|494767821|ref|WP_007503229.1| flagellar protein FliS [Caldalkalibacillus thermarum]  clstr ali  17  4.RNPYQTYKHNAVQTASPGELTLMLYNGCLNFIKQARQAIEEDNIQERNKYMQKAQDIIRELMVTLNTDYAVAKDMLRMYDYILRRLIEANINNDTAILDEVETYVSQFRDTWKEVLRLNRQKQYGGGVP........................... 132
81 1.000e-54gi|913008950|ref|WP_050354033.1| flagellar protein FliS [[Clostridium] purinilyticum]  clstr ali  18  5..NPYQKYQQNSIVTASPEQLTLMLYDGAIKFMNMAKLYMEEKNIQETHNSIMRAQDIINELNITLNMNYGISKNLRSLYTYILEKLIDANLKKDYSILDEVISLVEDLRDTWKEAMQKNRIESVQENSQ........................... 132
82 1.000e-54gi|737346904|ref|WP_035329187.1| flagellar protein FliS [Bacillus firmus]  clstr ali  17  5..NPYKKYKENTVTQASPAELTLMLYNGALKFIKLAKQGIEEQNIELKNTNIQKTQSIIQELMVTLNTDVEISNNLMRMYDFMFRQLVEANVKNDAKLLDEVEGFLVEFRDTWKEMIQQSRKG--VQSGQA.......................... 131
83 1.000e-54gi|737175523|ref|WP_035161717.1| flagellar protein FliS [Caloranaerobacter azorensis]  clstr ali  19  4.KNPYAQYQQDSIMTATPEELTLMLYNGAIKFVKQGKLFIEQKDIQNAHNSIVRAQDIISELNITLNMDYEISKNLRSLYTFILDKLMEANIKKDSKILDEILPIVEDLRDTWKEAMKLAKQ................................... 124
84 1.000e-54gi|654485107|ref|WP_027955058.1| flagellar protein FliS [Halobacillus kuroshimensis]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKAAGKAMEQKDIESKNTNIQKAQRIIQELMVTMDQNTDISAQVLPLYDYMNRRLIEANTKNDPAILDEVEGLVVEFRDTWKQVILQTRKSQYPQGG............................ 127
85 1.000e-54gi|751619347|ref|WP_041087247.1| flagellar protein FliS [Jeotgalibacillus soli Cunha et al. 2012]  clstr ali  16  5..NPYSKYQNNSVTTASPAELTLMLYNGSLKFMKQAKIEIEKKNFQEKNRLIGRTQDIVHELMVKLDMNVEISKNFLRIYDYINRRLIDANINNDMRALEEAEGLMTDIRDTWKEAIQLNRQKQFGQSGQA.......................... 133
86 1.000e-54gi|491790494|ref|WP_005601298.1| flagellar export chaperone FliS [Butyrivibrio crossotus]  clstr ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
87 2.000e-54gi|738930957|ref|WP_036817335.1| flagellar protein FliS [Pontibacillus yanchengensis]  clstr ali  17  3.TQAYQAYQSNSVQTASPGELTLMLYNGCLKFMKLAKRGIEEKDYELKNTNIQKAQRIIQELMVTMNPDYDITNEVMPLYEYINRRLMEANLHNDTTILNEASELVTEFRDTWKEVVRQTRQQKFGEGG............................ 130
91 2.000e-54gi|844805682|ref|WP_047943890.1| flagellar protein FliS [Bacillus circulans]  clstr ali  18  4.NQPYQTYKQNAVNTSSPGDLTLMLYNGCLKFITLAKRAIEDKNIEKRNENLGKAQNIINELMITLNLEIDISKNMLQMYDYIYRRLVEANTKNDINILNEVEGYVIEFRDTWKEVIKIAKK................................... 124
92 2.000e-54gi|751592870|ref|WP_041061122.1| flagellar protein FliS [Jeotgalibacillus campisalis]  clstr ali  18  5..NPYAAYQQNSVTTKSPGELTLMLYNGCIKFIQQAKLAIEDQNIEKRNESIQKAQKIIQEFMVTLNMDISVSQNMMVMYDYMNRRLMEANINNDRAILEEVEGMVTELRDTWKTVIQTQRQKQFGAGNQA.......................... 133
93 3.000e-54JGI.Meta 7037836216 SRS014923_WUGC_scaffold_14075__gene_19967 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYRYLQERLVEANMKKDKEILEEVLAHLRTMRDTWKEVMKLAHSK.................................. 125
94 3.000e-54gi|973005871|gb|KUJ89582.1| flagellar protein FliS, partial [Thermoanaerobacter thermocopriae]  clstr ali  25  18MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGAIEKKDYMAANNSIQRAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVTILEEVKGFAIELRNTWSVALNKVR.................................... 138
95 3.000e-54gi|516041931|ref|WP_017472514.1| flagellar protein FliS [Amphibacillus jilinensis]  clstr ali  18  3.QQHYQAYKNNSVNTASPGELTLMLYNGCLKFIKYAKKGIEQGDIQLKNTNIQKAQNIINELMVTLDQGAPIAKEMLPLYDYVNHCLIQANIKNDLESLMEANRVVEEFRDTWKEVLKQTRTQQYTQGAKA.......................... 132
96 3.000e-54gi|524569766|emb|CDC94742.1| flagellar protein FliS [Roseburia sp. CAG:380]  clstr ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
97 3.000e-54gi|849044662|ref|WP_047980829.1| flagellar protein FliS [Ornithinibacillus contaminans]  clstr ali  18  3LNKPYQAYQNNAVNTATGGELTLMLYNGCIKFIKQAIKDVQDHNIEAKNTNIQKAQRIIQELMVTLDQGVEISKQIMPLYDYMHQRLMEANMKNDPSILEEVLGFVTDFRDTWKQVILKTRQKQYAQG............................. 130
98 4.000e-54gi|653188185|ref|WP_027424507.1| flagellar export chaperone FliS [Lachnospiraceae bacterium AC3007]  clstr ali  21  6...AYQQYKNSKVLTASPAELTLMLYDGCIKFCNMGVMAINGKDYAAANKNIQKAERIIGEFKMTLDHKYEVAKDFDNIYDYVLRRLHEANMHKDTEILNECITHMRSLRDTWKEVMKQAGQPAMPEAAQA.......................... 133
99 4.000e-54gi|736769149|ref|WP_034772591.1| flagellar protein FliS [Bacillus thermoamylovorans]  clstr ali  17  5..NPYQAYQENSVLTASPGDLTLMLYNGCLKFLNLAKKAIEEKNITEKNTNLQKAQNIINELMVTLNMDIEISKQMMALYDFVRIKLIEANVKNDLAALEEAESIMIEFRDIWKEVIKLNRQQTYTKDGQ........................... 132
100 4.000e-54gi|640599713|ref|WP_025028345.1| flagellar protein FliS [Bacillus mannanilyticus]  clstr ali  18  4.NNPYQAYQQNAMNTASPGELTLMLYNGCLKFIKQAKLDIEKKNIEAKNTNIIKAQNIIRELMVTLNMDVEISEQLMQMYDYLLNRLIEANLRNNIDILKEVEGFVTEFRDTWKEALQINRR---MQHGQ........................... 129
101 5.000e-54gi|498017899|ref|WP_010332055.1| flagellar export chaperone FliS [Bacillus mojavensis]  clstr ali  18  4.QNPYAAYQQSSVNTATPGELTLMLYNGCLKFIKLACQAIENNDIERKNENLIKAQNIIQELNGTLNRNIELSGSMGAMYDYIYRRLVEANIKSDKSILEEVEGYVTDFRDAWKQAIQIERKDRHGSGG............................ 131
102 6.000e-54gi|548793464|gb|ERM91765.1| flagellar biosynthesis protein FliS [Caldanaerobacter subterraneus subsp. yonseiensis KB-1]  clstr ali  28  8..NPYQQYKENAILTASPEELVLMLYNGIIRFIDEAKTALQKKDYVETNAKIQRAQDIITELMLTLDMNYDISKNLYNLYDYILRRLIDANVKKDIEILDEVRGFVVELRDTWSLALQKVR--------EKVYA....................... 131
103 6.000e-54gi|763302952|ref|WP_044163022.1| flagellar protein FliS [Salinibacillus aidingensis]  clstr ali  19  18....QQAYQNNAVNTASPGELTLMLYNGCLKFIRQAKKAMNETNYETKNTNIQKAQRIIQELMVTMDPESDISDQVMPLYDYINRRLMEANIENDPEILDEASELVTEFRDTWKEVIQITRQQQYGQGG............................ 142
106 7.000e-54gi|524471202|emb|CDC12316.1| putative uncharacterized protein [Roseburia sp. CAG:45]  clstr ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYKYLQERLVEANMKKDKEILEEVLVHLRTMRDTWKEVMKLAHSK.................................. 125
107 7.000e-54gi|736396643|ref|WP_034420343.1| flagellar protein FliS [Clostridiales bacterium DRI-13]  clstr ali  23  5..NPYQQYRQQQVNTATPDKLLIMLYDGAIRFCSQAKIAIESRNLEQAHVNLTKAQNIIIEFMTTLNMDYEISRNLYSLYDYLYNRLVEANMKKDTAIIDELIGFLTDLRKTWAEAATKLKAE.................................. 125
108 9.000e-54gi|503042277|ref|WP_013277253.1| flagellar protein FliS [Acetohalobium arabaticum]  clstr ali  21  3.NNPYQKYKNTQVETASQEKLLLMLYDGAIKFLKQAIKGVEENDYEAANNYLVRTQDIIHELMATLDMEKEIARNLESLYDYMNRRLIEANVNKDIEPMEEVRDMLAELRETWQEAIKKVKQ................................... 125
109 1.000e-53gi|1004128720|gb|KXZ39065.1| flagellar protein FliS [[Clostridium] paradoxum JW-YL-7 = DSM 7308]  clstr ali  16  3MTNPYLTYQSQSINTATPEELTLKLYEGCIKFINLAIIGIEQKNIELANTNIIKAQNIINELNITLNMNYEISKTLRALYDYLYRRLVEANIKKDKKILLEVKEFVVEFRDTWKQAMHIARKG.................................. 125
110 1.000e-53gi|754996875|ref|WP_042350830.1| flagellar protein FliS [Bacillus massiliogorillae]  clstr ali  17  3MNNPYKTYEQNTVNTASPGELTVMLYNGCLKFISKAKQAIEEMKYEDRNLNIQKAQNIIRELMVTLNMDIDVSKNMIILYEYIFDRLTEANIHNDMRALDEATVLVTDFRDTWKQVIQMNRKQQHQGG............................. 130
111 1.000e-53gi|1011410661|ref|WP_062322435.1| flagellar export chaperone FliS [Halolactibacillus sp. JCM 19043]  clstr ali  20  1MMQQHQAYKTNAVNTATPQELTLMLYNGCLKFMKQAKKAMEEKDIPAKNNYIQRAQDIISELIITLDHNAPIAKDILPLYEFINRRLIDANIKNDPEILMEAYALVEEFRNTWKEVMKQAKTMQYSQGAKA.......................... 131
112 1.000e-53gi|966452607|ref|WP_058485985.1| flagellar export chaperone FliS [Defluviitalea phaphyphila]  clstr ali  23  4.NNRYEQYKTNAIMTASPQELTLMLYNGALKFCKQAIEAIKNKNISKAHEYIIRVEDIIQELMITLDKKYPISKDFELLYDYIYRRLVEANVSKNIEVLEEVYGLIKEFRDTWKEAMKKAK.................................... 123
114 2.000e-53gi|655906193|ref|WP_028976506.1| flagellar protein FliS [Sporolactobacillus terrae]  clstr ali  22  4..SAYKSYQQNSVLTATPGELTLMLYNGCIKFIRQAKLAMEQDKIEEKNTYIQKAQKIIRELMVTLDQKQDVAKSMMQMYDYMNRRLIDANIKNDASILDEVEGYAVDFRDTWKQVIEITQKNQ................................. 125
115 2.000e-53gi|558636518|ref|WP_023511351.1| flagellar protein FliS [Sporolactobacillus laevolacticus]  clstr ali  21  4..SAYKTYQQNSILTATPGELTLMLYNGCIKFIRQAKIAITEKNIEDKNKYLQKAQDIIRELMVTLDQKQQVAQSMMQMYDYMNRRLIEANIKNDLKILNEVEGLVTEFRDTWKQVIEITQKNQ................................. 125
117 2.000e-53gi|647307879|ref|WP_025747915.1| flagellar export chaperone FliS [Caldicoprobacter oshimai]  clstr ali  21  3LNNPYQQYQQQSVMTASPGELLVMLYNGCIRFIKQAIECINGKDLEGAHKAIIRAQDIILEFMTTLDMKYEVSHNLMALYDYLHRRLVEANTRKDVAALEEVLGFVTELRDTWAEAVKITRKQ.................................. 125
119 2.000e-53gi|926252029|ref|WP_053590296.1| flagellar protein FliS [Bacillus sp. FJAT-22090]  clstr ali  18  8.....QAYKNNSVSTASPGELTLMLYNGCLKFLGKAKVAIVVKNIQEKNLNLQKAQKIIQELMVTLNMNIEISQSMMQMYEYMNHRLIEANIKNDVSIIEEVEGYVTEFRDTWKQVIQINRQKQF................................ 127
123 4.000e-53gi|1011188586|ref|WP_062109109.1| flagellar protein FliS [Bacillus niameyensis]  clstr ali  18  5..NPYQTYQKNTVTTASPGDLTLMLYNGCLKFIHLAKVAMQTNKIEDKNVNIQKAQNIITELMVTLNMDMDVSKNMMALYDFANRRLIEANIRNDESTLIEVEEIITEFRDTWKQAIQLNRQ................................... 124
124 4.000e-53gi|503063644|ref|WP_013298620.1| flagellar protein FliS [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  19  1MFDPYLEYKRNSIMTASPEELVMMLYNGIIRFVNEAKQAIDDKNIERAHNSITRAQDIVLELMSTLDMKYDISKNLYSIYDYISRRLIEANLKKDKVALDEVESLISDLKDTWGKAMDKVRAKVYSKG............................. 128
125 5.000e-53gi|518072867|ref|WP_019243075.1| flagellar protein FliS [Bacillus massilioanorexius]  clstr ali  19  4.NNPYKAYEQNSVTTASPGELTLMLYNGCLKFIGKAKIAIEQNHIEERNTNIQKAQNIIRELMVTLNMDYEVSKNMMTIYEYINGLLTEANIQSELAKLVEAEGLVKEFRDTWKQVVQMNRKKQYQGGA............................ 131
126 5.000e-53gi|502179011|ref|WP_012726961.1| MULTISPECIES: flagellar protein FliS [Exiguobacterium]  clstr ali  20  4..NPYAAYQNNAVTTANPQELTLMLYDGALKFMRLAKLAIDQGNPDLKNINIQKTQAIFQELRLTLNKDIAISANLDSLYDYMWRRLVDANVKNDTTILDEVLDFTTELRDTWKEAMKLAKQ................................... 123
127 5.000e-53gi|740779264|ref|WP_038564548.1| flagellar protein FliS [Terribacillus aidingensis]  clstr ali  18  6....YQAYQQNSVQTASPGELTLMLYNGCIKFIKFAQQAIEKKDIEAKNTNIQKAQNIVRELMITLDPEVPITNEIMPLYDFINQQLIQANTHNDQQALKSALDLITDFRDTWKEVVKQTRKQQFGTGA............................ 130
128 5.000e-53gi|697199862|ref|WP_033168603.1| flagellar export chaperone FliS [Clostridium sp. KNHs205]  clstr ali  20  4..NAALAYQNNAIQTASPAELTLMLYEGAIKFTNIALMAIEEGNVEKVHLNIVKVENIILELRSTLDHKYPVAEDFDRVYDYIYRCLVDANVKKDKWKLEEALGFIREMRDTWKEVMKTTKKK.................................. 124
129 5.000e-53gi|297141826|gb|ADH98583.1| flagellar protein FliS [ [[Bacillus] selenitireducens MLS10]  clstr ali  18  4.NNPYQQYKQNTVDTKSPGELTLMLYDGCLKFIRRAEEAIKNKNIEVKNENLLKAQNIIRELMLTLNTDVAVSQDMMSMYDYILNQLVEANMKNDLDALKEAAKYTEDFRDTWKEVIKIDRQE.................................. 125
130 5.000e-53gi|653240250|ref|WP_027445884.1| flagellar protein FliS [Pontibacillus marinus]  clstr ali  17  3.TQAYQAYQNNSVETASPGELTLMLYNGCLKFIRLAKKGIEESNYELKNTNIQKAQKIIQELMVTMNPEYKITEEIMPLYDYINRKLMEANLHNDTAMLDEAAELVTDFRDTWKEVVKQTRQQKFGSGG............................ 130
131 6.000e-53gi|495392851|ref|WP_008117552.1| flagellar export chaperone FliS [[Bacteroides] pectinophilus]  clstr ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
132 7.000e-53gi|504822296|ref|WP_015009398.1| flagellar protein FliS [Amphibacillus xylanus]  clstr ali  19  3.QQPYQAYINNSVNTASPAELTLMLYNGCLKFIRYGKKGIEEQNMELKNTNIQKAQNIITELMVTLDQSAPIAKDIMPLYDYINQLLIEANIKNDLNSLDEAANLVEEFRDTWKEVIKQTRTREYKQGVQA.......................... 132
134 7.000e-53gi|651374101|ref|WP_026486328.1| flagellar protein FliS [Caldanaerobius polysaccharolyticus]  clstr ali  23  4.NNPYQQYKANAVMTASPEELTLMLYDGIIRFLNQAKEAISSHDMQTAHERLVRVQDILNELNATLDRNYDISANFASLYDFMIRKTVEANVKKDVSIIDEVLDLARDLRDTWQQAMKKARKE.................................. 125
137 1.000e-52gi|926266062|ref|WP_053604248.1| flagellar protein FliS [Bacillus gobiensis]  clstr ali  17  3MKNPFTAYQQNSVNTASPGELTLMLYNGCLKFIKLAAQSIQEGAIDQKNENLVKAQNIIQELQVTLNRDVTISEQFAIIYDYIYRRLVDANVKNDLSILLEVEGYIIEFRDTWKQAIQIDRQE.................................. 125
139 1.000e-52gi|498333453|ref|WP_010647609.1| flagellar protein FliS [Oceanobacillus massiliensis]  clstr ali  20  4.NKAYQTYQNNAVNTASGGELTLMLYNGCMKFIKQAIKDINDSNYEAKNKNIQKAQNIIQELMITLDPEIEISKQILPLYEFMQFQLKEANIKNDVTKLEEVLGFVTEFRDTWKQVMIKNRKQQYAQGAQ........................... 132
140 1.000e-52gi|797181531|ref|WP_045849720.1| flagellar protein FliS [Domibacillus enclensis]  clstr ali  20  3MNNPQQAYANNSVNTASPGELTLMLYNGCIKFIRYAEKAMIENNIEQKNLHVQKAQAIIRELSITLKADTDLGKNMLALYEFMHERLVEANIKNDPAILKEVEEFVTEFRDTWKQVIQENRR------IQQVGAG...................... 131
141 1.000e-52gi|918991932|ref|WP_052653939.1| flagellar protein FliS [Planomicrobium sp. ES2]  clstr ali  19  5..NPYQAYQQNSVMTASPQELTLMLYNGSLKFMKLAKKAMAENNFQEKNTNIIKAQNITQELRVTLDPDAEISKNMEQLYEYMYTRLIEANTKNDVAILEEVEGLMVELRDTWKQVMGMVKNG.................................. 125
142 1.000e-52gi|497451562|ref|WP_009765760.1| flagellar protein FliS [Sporosarcina newyorkensis]  clstr ali  25  4.NNPYAAYQNNSVTTSTPGELTLMLYNGCLKFIQQGKMALEEGKLEEKNVAIQKAQAIVTELMLTLDTSYPVAENMLVLYEFVNSRLIDGNIKNDPALFDEASGIIKEFRDTWKQVIQVNRSKQY................................ 127
145 2.000e-52gi|748255765|ref|WP_039811122.1| flagellar protein FliS [Jeotgalibacillus malaysiensis]  clstr ali  20  3.RNPQQAYANNQVNTASPGELTLMLYNGCLKFIKQGQMAIEQNNIEQKNINIQKAQAILRELSVTLKTEQEVAKNMLALYDFLISRLMEANVKGSTEILDEVSGFVTEFRDVWKQVIQENRK------LQQVGAGGT.................... 132
146 2.000e-52gi|504457205|ref|WP_014644307.1| flagellar protein FliS [Halobacillus halophilus]  clstr ali  19  4.....QAYQNNSVETASPGELTLMLYNGCLKFIKTAKKAIENHDIEKKNTNIQKAQKIIRELMVTMEQDYEVAKDIMPLYDYMNRRLMEANITNDLGILEEVQGLTEEFRDTWKEVILQTRRVQQGQGGRA.......................... 129
147 2.000e-52gi|652514776|ref|WP_026908985.1| flagellar protein FliS [Paucisalibacillus globulus]  clstr ali  18  3LNKPYQAYQNNAVNTASGGELTLMLYNGCNKFIKQAIRDIQEKNMEAKNTNIQKAQAIIQELMITLDLEVEISKHIMPLYDYMNRRLMEANLKNDIEILAEVQGFVVDFRDTWKQVILKTRQKQYAQG............................. 130
148 2.000e-52gi|518999167|ref|WP_020155042.1| flagellar protein FliS [Caldibacillus debilis]  clstr ali  18  4.QNPYQAYQDNAVTTASPGELTLMLYNGCLKFIAAAKEAMKKKDYAGKNTNLQKAQNIIRELMVTLKPEYEVSKNMMAMYDYIYRRLLEANLKNDLAILEECEGFVTEFRDVWKQVIQINRKQQYKEGGQ........................... 132
149 2.000e-52gi|912591911|emb|CRZ35203.1| hypothetical protein HHT355_2005 [Herbinix hemicellulosilytica]  clstr ali  20  4..NAASVYKDNKILTASPAELTLMLYEGAIKFCNMALIAIEKNDVEKANQNIIKAENIITELRATLDFTYPVANQFEMVYDYIFRRLVEANIKKDKEILEEALKYIRDMRDTWKEVMKAAKTGA................................. 125
150 2.000e-52gi|489616010|ref|WP_003520450.1| flagellar protein FliS [Ruminiclostridium thermocellum]  clstr ali  26  3LKNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQAQMALNDKNIEKANKSIIRAQDIISEFRCTLDMKYDIAHQLDLLYDYMYRRLVDANIKKDGAIAEEVLGFAKELRDTWEQAMKIAKQQ.................................. 125
151 2.000e-52gi|652833144|ref|WP_027116886.1| flagellar export chaperone FliS [Lachnospiraceae bacterium P6B14]  clstr ali  18  3.QNRMSDYQRNAILTATPAELTLMLYEGAIKFCNLAKMAIEKKDIQKAHENIKRAQDIITEFRVTLDRKYPVWEDFERVYDYIYRKLVEANIHKDLEPLEEALKYIREMRDTWKEVMKLAR.................................... 122
153 2.000e-52gi|737578966|ref|WP_035550364.1| flagellar protein FliS [Halobacillus sp. BBL2006]  clstr ali  18  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKIARKAMEQSEIEKKNTNIQKAQNIIRELMVTMNQDYAISQEILPLYDYMNRRLMEANTKNDTAILDEVQGLAEEFRDTWKQVILQTRKVQYGQGG............................ 127
154 3.000e-52gi|1011548752|ref|WP_062441398.1| flagellar protein FliS [Thalassobacillus sp. TM-1]  clstr ali  18  4.....QAYQTNTVETASPGELTLMLYNGCLKFIKLAGKAMETKNYEKKNVNIQKAQKIIQELMITLDPDASISKEILPLYEFINRRLLDANVNNDLVILTEAQELVTELRDTWKEVIRQTRQQQFGEGS............................ 127
156 3.000e-52 GL0156791 unmapped_[Complete]_[mRNA]_locus=scaffold361806_1:404:778:+  ali  20  5..NGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
157 3.000e-52gi|516754026|ref|WP_018084741.1| flagellar protein FliS [Desulfurispora thermophila]  clstr ali  23  5..NPYQQYRQNAVNSAAPGELTLMLYNGAIKFLHQAREAIAAKDVPGAHEALVRAQEIIQYLFDTLDMQYEIAGNLAALYDFILRQLRQANIKKDVGPVEEVLPLLEDLRDTW............................................ 115
158 3.000e-52gi|721321722|ref|WP_033542927.1| flagellar protein FliS [Planococcus sp. CAU13]  clstr ali  18  4.NNPYQTYQQNSVTTASPQELTLMLYNGCLKFIKLAKRAMKEGNFQEKNTNLIKAQNIIQEFQITLDRNIEISEGLAQLYDYIYGRLIEANMKNDLAILEEAEGQVKELRDTWKEAMALVKGK.................................. 125
161 4.000e-52gi|512486119|ref|WP_016429516.1| flagellar protein FliS [Paenisporosarcina sp. HGH0030]  clstr ali  17  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFIRLSKKAMTEKNYEVKNTNIIKAQNIIQELRITLNQEIEISNNMTQLYEYMHTRLVDANIKNNLEILEEVEGYVVELRDTWKQVIELAKK................................... 124
162 4.000e-52gi|515752311|ref|WP_017184911.1| flagellar protein FliS [Alkalibacillus haloalkaliphilus]  clstr ali  22  6..QAYQAYQQNSVSTASPGELTLQLYNGCIKFIKLAKTAIEKEDFQSKNEQLQKAQNIIAELMVTLNPDYDITNQLLPLYDYINYCLREANIHNDVAKLDEAQKMVEQLRDTWKEAIKLDRQNKYAPGAKA.......................... 134
163 4.000e-52gi|1011282413|ref|WP_062199891.1| flagellar protein FliS [Bacillaceae bacterium mt8]  clstr ali  20  4.NNPYQAYKQNTVNTAPPGELTLMLYNGCLKFISAGKQAMKNGDVNGKNENLKKAQDIIQELMVTLNTDISVAANMMQMYDYIHRRLIEANVQNDVEVLEEAEGYVVEFRDTWKAVLKITQQQ.................................. 125
164 4.000e-52gi|524080268|emb|CCY57740.1| flagellar protein FliS [Clostridium sp. CAG:632]  clstr ali  20  3.NNAAQAYGARKVETATPAELTLMLYEGTIKFCNIAMGAIEKKDYEKANINIQKARKIIVELQTTLDHKYPVAEDFDRIYDYIFHKLVQANIKKDPEILEEALVELRDLRDAWKEIMRTAK.................................... 122
165 4.000e-52gi|738895949|ref|WP_036782967.1| flagellar export chaperone FliS [Pontibacillus chungwhensis]  clstr ali  19  3.TQAYQAYQNNSVETASPGELTLMLYNGSLKFMKLAKKGIEEENIELRNTNIQKAQKIVQELMVTMNPDYSITQEVMPLYDYVNRRLMDANLKNDASILEEAFEIMTDFRDTWKEVVKQTRQQQFGAGG............................ 130
167 5.000e-52gi|973058084|gb|KUK30987.1| Flagellar biosynthesis protein FliS [Thermoanaerobacterales bacterium 50_218]  clstr ali  23  6...PYSQYRQTQVLAATPERLVLMLYEGAIRFLGEAKVAIAENNLAKAHEKLVRAQDIFTELQVSLNMDYEISKPLASLYDYFKRRLIEANVKKDVSIIDEILELVRPLKDAWAEV......................................... 118
168 5.000e-52gi|489446590|ref|WP_003352007.1| flagellar protein FliS [Bacillus methanolicus]  clstr ali  21  1MANQQQVYKQNSVSTASPGELTLMLYNGCLKFLAKMKQAIIEKNISERNVNSQKAQRIIQELMVTLNQEYEVAKQMMAMYDYMNRRLIEANVKNDVAIVEEVEGFVTEFRDTWKEVIRLNRQKQF................................ 127
171 7.000e-52gi|982034829|ref|WP_060209253.1| flagellar protein FliS [Sporosarcina koreensis]  clstr ali  19  4.NNPYATYQNNSVNTSTPGELTLMLYNGCLKFIQQAKKAMEQGNIEEKNTATQKAQAIVSELMVTLDMSVPVSENMMVLYDFVNNRLVEGNIKNDIALYNEAAEIITEFRDTWKQVIQINRTKQYAN.............................. 129
173 8.000e-52gi|524840060|emb|CDF42916.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:182]  clstr ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYAVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
174 8.000e-52JGI.Meta 7025242208 C3586802__gene_184747 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 764224817] :  ali  14  9..NPYQKYKETSINTASKEEITLMLYEGCIKFMNLARIGIEEKNIQKANENLIKAQNIVTELDITLNMDIPISKNFHQLYDFVLSRLIDANIKKDVAFIDDAKLVMVDLRDGWKEAMPLMRKAQ................................. 130
175 8.000e-52JGI.Meta 7037865446 SRS014923_WUGC_scaffold_29623__gene_49197 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEVAIEEKDIQKAHNNIRKVQNIIGYLQSTLDTKYPVAQDFINIYDYLSQRLVEANVKKDKEILEEVNMHLHSVRDNWKEVMRVNREK.................................. 125
176 9.000e-52gi|655378615|ref|WP_028783761.1| flagellar export chaperone FliS [Thalassobacillus devorans]  clstr ali  19  4.....QAYQTNAVETASPGELTLMLYNGCLKFIKLAGKAIDNKDYEQKNINIQKAQKIIQELLVTLDPDISISKEIMPLYDYINRRLLDANLKNDAAILEEANELVGELRVTWKEVLRRTRQGQFGKGGSA.......................... 129
177 9.000e-52gi|503861883|ref|WP_014095877.1| flagellar protein FliS [Bacillus coagulans]  clstr ali  20  4.RNPYQAYQNNSIATASPGELTLMLYNGCLKFIHLAKKAIENKNFEEKNKNIQKAQNIIRELMMTLDTKFEDAEKMLSLYDFILRELIQANVKNDMSKLDTAEELVTGFRDTWKQVIQANRRQTYGQGG............................ 132
178 9.000e-52gi|996042265|gb|KXG76354.1| Flagellar protein FliS [Thermotalea metallivorans]  clstr ali  18  3LNNPYAQYKQNTVMTAPPEELTLMLFEGMVKFINQSKLFMQEKKLDKASNANLRAQDIIAELNLTLNMKYDISKNLRTLYDYMSRRLIEANLKKDVDILEEVLGLATELRDTWKEAIKIARKG.................................. 125
179 1.000e-51gi|524497984|emb|CDC37651.1| flagellar protein FliS [Butyrivibrio sp. CAG:318]  clstr ali  18  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQ................................. 127
180 1.000e-51gi|671613750|ref|WP_031583122.1| flagellar export chaperone FliS [Lachnospiraceae bacterium AC2028]  clstr ali  21  5..NAYQQYANNKIMTSSPAELTLMLYDGAIKFLNIALGALEEKDVQKAHTNILKAEHIIDYLRQTLDMKYAVAQDFENIYSYLSQRLVEANLKKDSAILEEVNGHLHSVRDTWKEVMKLN..................................... 122
181 1.000e-51gi|551041191|ref|WP_022784832.1| flagellar export chaperone FliS [Lachnospiraceae bacterium NK4A179]  clstr ali  22  3.KNPYEQYKNNAIATATPAELTLMLYEGAIKFGNIAIKAIEEGDIQKAHTNIMKVQRIISEFRNTLDFKYPVAKDFDRVYEYLERRLVEANVSKDKEIMEEMVMHIRSMRDNWKEVMKRAKQPQ................................. 125
182 1.000e-51JGI.Meta 7025558325 C3976441__gene_155075 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 604812005]  ali  18  5.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQ....................................... 121
185 1.000e-51gi|738949971|ref|WP_036834530.1| flagellar protein FliS [Pontibacillus litoralis]  clstr ali  20  3.TQVHEKYQNNSIQTASPSELTLMLYNGCLKFIKLAKRGIEEGNYESKNMYIQKAQNIVSELMITMDPEYEITKQIMPLYEYLNHRLLEANMQNDVKILDEVEGFVVEFRDTWKEVIKLTKNQQ................................. 125
186 1.000e-51gi|769141432|ref|WP_044918722.1| flagellar export chaperone FliS [Lachnospiraceae bacterium MA2020]  clstr ali  21  4.QNAYAQYNKNKIMTASPAELTLMLYDGCIKFMNVASMAIDEGDVEKAHNNIRKAERIIEEFRATLDMKYPVAQDFERVYKYVARRLVEANMGKDKEILEECITHMRSMRDTWREVMRIV..................................... 122
187 1.000e-51gi|511031625|ref|WP_016285716.1| flagellar export chaperone FliS [Lachnospiraceae bacterium 3-1]  clstr ali  18  4.NKGYNAYARNKILTASPAELTLMLYEGAIKFCNIAIAAIEEKNIEKAHNNITKVENIVAEFLSTLDHKYPVAKDFENVYNYLMERLLEANLKKDKEILEEVLTHLRTMRDTWKEVMEQNKTA.................................. 125
188 2.000e-51gi|652500051|ref|WP_026894455.1| flagellar protein FliS [Clostridiisalibacter paucivorans]  clstr ali  17  5..NPYAQYQQNSVMTASPEELTLMLYNGAIKFIKQAKIFINEKQMENAHKSIVRAEDIIAELNITLNMDYEISENLRSLYTFILDRLTDANVQKSTDVLNEILPLVEDLRDTWQQAMKQAK.................................... 123
191 2.000e-51gi|652814066|ref|WP_027105604.1| flagellar export chaperone FliS [Lachnospiraceae bacterium V9D3004]  clstr ali  21  3.NNAANSYKNNKIMTATPAELTLMLYDGAVKFCNIALMAFEKNDYTKVNDNIIKVENIITEFRSTLDFKYPVANDFEVVYDYIYRRLVDANIKKDPEILNEALKYIKEMRETWQEVMKINKNQ.................................. 124
194 2.000e-51gi|656062496|ref|WP_029100289.1| flagellar protein FliS [Brevibacillus thermoruber]  clstr ali  25  3MYNPVQAYQTNSINTASPGELTLMLYNGAIKFIKQAKAAISEKNIGQAHEYNLRVQDILNELIVTLDRSYPISDQLYQMYDYMLRRMIDANVRKDISILDEVEDFFVQFRDVWKQAMVLAKNQ.................................. 125
195 2.000e-51gi|149948483|gb|ABR47011.1| flagellar protein FliS [Alkaliphilus metalliredigens QYMF]  clstr ali  19  3MQNPYQQYKQNSVMTASPQELTLMLYNGALKFINVSKKNIDEKNIAKANESIQRVQSIIQELNITLDMNYEVSKNLRSLYTYILERLVDANMQKDMNALEEAAQMITELRDTWKDAMKQAR.................................... 123
196 2.000e-51JGI.Meta 7004744558 SRS013705_Baylor_scaffold_91903__gene_112818 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1  ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVRGNLDSDTAKIDEAAGIIRELRDAWAQAMKKARAEKMGEGAEAV......................... 133
197 2.000e-51gi|505173101|ref|WP_015360203.1| flagellar protein FliS [[Clostridium] stercorarium]  clstr ali  23  5...AYNQYRENSVYTASPEELTLMLYNGLIKFIMKAQNAISKKDIEGANENILRAQDIVSELMSTLDKKYEIANNLEMLYDFMLRRLIEANVKKSCEILDEVLEFAKELRDTWEQAMRIARKQ.................................. 124
200 2.000e-51gi|751605443|ref|WP_041073570.1| flagellar protein FliS [Bacillus sp. OxB-1]  clstr ali  22  4.NNPYAAYQNNSVNTSTPGELTLMLYNGCLKFIAQAKKALEDGNIEEKNKSVQKAQAIVTELMLTLDTSMPISENMMVLYEFVNNRLLDGNIKNDSKLFDEAGDIITEFRDTWKQVIQINRQKQYAN.............................. 129
202 2.000e-51gi|515948415|ref|WP_017378998.1| flagellar protein FliS [Paenisporosarcina sp. TG-14]  clstr ali  19  4.KNPYEVYQKNSVMTASPQELTLMLYSGCLKFIKLAKKAMVEKNFEVKNTNIIKAQAIIQELRVTLNQEIEISKNMAQLYDYMYNRLVDANMKNDLETLQEVEGYVVEMRDTWKQVMGLVKK................................... 124
203 2.000e-51gi|500860009|ref|WP_012011420.1| flagellar protein FliS [Bacillus pumilus]  clstr ali  18  4.QNPYAAYQKNSIETATPAELTLMLYEGCLKFIRLAKYAIQKEDAETRNVNLKKAQNIIQELNVTLNRSYDVSKSMASMYDYIYRRLIEANFQNDEEMLNEVEQYVTDFRDAWKEVIQNDRKG.................................. 125
205 3.000e-51gi|754861825|ref|WP_042222459.1| flagellar protein FliS [Oceanobacillus manasiensis]  clstr ali  19  6.TKQYQAYQNNAVNTASSGELTLMLYNGCIKFIKQASRNIENGEFEQKNTNIQKAQNIIQELMITLDQKVEISKQILPLYEYMHFQLKEANIKNDPAILQEVLGLTVDFRDTWKQVILKSRQTTYTQGAQ........................... 134
206 3.000e-51gi|517983601|ref|WP_019153809.1| flagellar protein FliS [Bacillus massiliosenegalensis]  clstr ali  19  4.QQVQNAYKQNSVNTASPGELTLMLYNGCLKFLQKGKQAMKDKNIEEKNKNLQKAQKIIQELMITLNQDYGIAKEMMQMYEYMNRRLIDANVQNSVEILEEVEGYVNEFRDTWKEVIRLNRQKLYQGN............................. 130
207 3.000e-51gi|671534319|ref|WP_031518062.1| flagellar protein FliS [Desulfotomaculum alkaliphilum]  clstr ali  22  5..NPYAQYQQNAVNSADPGQLTLMLYNGALKFNKQAMVQLEAKNIEQTNYYIQRVQDIITELMVSLNQEYEISKNLLSLYDYINRRLVDANVKKDMAILEEVQGMLEELRNTWAEALKQVK.................................... 123
208 3.000e-51JGI.Meta 7027265228 C5287224__gene_287182 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765074482]  ali  18  24.QRAINAYQKNAIMTASKAELTLMLYDGAIKFCNIALSGFENKDYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAG.................................. 145
209 3.000e-51gi|740433612|ref|WP_038265923.1| flagellar protein FliS [[Clostridium] litorale]  clstr ali  19  3MANPHLKYQQQAVMTAPPEELTLMLYDGCVKFLSRAEIGLEDNNIEMINNNLVKAQNIISELNSTLNMDYEVSKGLRPIYNYLHSRLLDANIKKDRAIVEEVKGFIIELRDTWKEAMKIAR.................................... 123
210 3.000e-51gi|1017176540|gb|KZE64246.1| flagellar protein FliS [Fictibacillus phosphorivorans]  clstr ali  18  5..NANKAYQNNSVQTASPGELTLMLYNGCLKFIGLARTGIELKNTEQKNTNLLKAQKIIQELMVTLNMDLEVSQSLMQMYDYIHRRLIEANIHSDAAILDEVEDYVLDFRNTWKEVIQINRR---MQHGET.......................... 130
214 4.000e-51gi|667771721|ref|WP_031391062.1| flagellar export chaperone FliS [Clostridium sp. KNHs209]  clstr ali  19  5..NGYAQYNNNQVLTASPAELTLMLYNGAIKFCNIAIAAIEKKEIEKAHINIVKVEKIVEYMRITLDMKYPIAQDFDNIYAYLDRRLVEANVKKDIGILEEVCEHFRSVRDTWKEVMRLNKEK.................................. 125
215 4.000e-51JGI.Meta 7058202701 SRS049959_WUGC_scaffold_28224__gene_53652 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYEGAIKFCNVAIDAVERKDIAKAHTNIVKVENIIDYLRKTLDMKYPVAQDFERMYVYLDQRLVEANVKKDVEILEEIRDHLHAIRDNWKEVMRVNREK.................................. 125
218 4.000e-51gi|939725360|ref|WP_054957472.1| flagellar export chaperone FliS [Paenibacillus sp. FF9]  clstr ali  17  3.TSPYDKYRQSSVQTASPAQLVLMLYDGAIRFVKIGIDGISNNDLPKANQYLGKAQTIVSELMSTLNHSYDISKNLFAMYEYINYLLIQANIKKSKEPAEEALGYLTDLYETWIQASKLAVSG.................................. 124
219 5.000e-51gi|651366683|ref|WP_026478988.1| flagellar export chaperone FliS [Alkaliphilus transvaalensis]  clstr ali  19  1MQNPYSQYKENSIKTASPQELTLMLYNGALKFINQGKLFIEQKNFASANEALKRAQDVITELNITLDMNYEISQNLRGLYTYLLDQVIEANITKNIAPLDEAASMVTELRDTWKEAMKLAK.................................... 121
220 5.000e-51gi|974234940|gb|KUO74804.1| flagellar protein FliS [Clostridia bacterium BRH_c25]  clstr ali  19  5.NNAYDQYKKNMINTATPQEITLMLYNGLVRFLKQAAAGIEERNIEKANNNIIRAQDIIYEFMRTLDMNYEISSNLLALYDYMNRRLVEANVKKDNEIVTEIIGLSEELRDTWAQAMKLVKQQ.................................. 126
221 5.000e-51gi|653215065|ref|WP_027427702.1| flagellar export chaperone FliS [Lachnospiraceae bacterium AD3010]  clstr ali  21  5..NAYAQYNRNKILTASPAELTLMLYDGCIKFINIAIMGIDEKDIAKANTNIKKAERIILELQSTLNEKYEVAKDFNAVYSYVKRRLLEANLSKDKEILEECAGHMRTMRDTWKEVMKTAH.................................... 123
224 5.000e-51gi|657824676|ref|WP_029541219.1| flagellar export chaperone FliS [Selenomonas ruminantium]  clstr ali  20  1MVNAAEAYRRQQIMTATPEALTLMLYNGCLKFINEGTEAIERKDYEQANISLQKAQNIISEFRITLNMDYEISHQLMPLYNYCYDRLVEGNLKNDTKQIGEAKDIITELRDAWAQAMKKARQEKQPQKA............................ 129
225 6.000e-51gi|497211720|ref|WP_009525982.1| flagellar protein FliS [Peptostreptococcaceae bacterium ACC19a]  clstr ali  17  4..NPYAKYKENSVNTATKEELTLMLYDGCIKFMNLAKIGIEEKNIEKANDNLLKAQAIITELDITLNMDIEISKNMHSLYDFALSRLVDANLKKDASLIDDAKSVIVDLRDAWKEAMNIVKRG.................................. 124
226 6.000e-51gi|524129294|emb|CCZ04082.1| flagellar biosynthetic protein FliS [Eubacterium sp. CAG:603]  clstr ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
227 6.000e-51gi|656248297|ref|WP_029194907.1| flagellar export chaperone FliS [Paenibacillus alginolyticus]  clstr ali  25  1MIQPARNYKQNQVETAPSEELTLMLYNGAITFVKRAKQAIEKKDFNFAHQHNIRVQDIVDELIITLDRKYPISEQLLSLYDYMKRRLIEANISKDTAILDEVESFFVEFRDTWKQAMTLARSQ.................................. 124
230 7.000e-51gi|524183395|emb|CCZ52532.1| flagellar protein FliS [Clostridium sp. CAG:75]  clstr ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
231 7.000e-51gi|498366998|ref|WP_010681154.1| flagellar export chaperone FliS [Acetivibrio cellulolyticus]  clstr ali  21  4.NNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQSQMGINEKNIEKANNCIIKAQNIISEFRCTLDMKYEISKQLELIYDYMNRRLIEANIKKDVTIVEEILGYARELRNTWEQAMKIARQQ.................................. 125
232 7.000e-51gi|922764136|ref|WP_053365307.1| flagellar export chaperone FliS [Bacillus sp. FJAT-27245]  clstr ali  24  1MLNPSEIYQRNQVTTARAEELTLMLYNGGIKFLQQAKAAIEKKDVAQAHSHITRVQDIVTELMVTLNMDYEISKTLLPLYEYMKRRLIEANIGKDSEMLTEVEGMFQELRTTWAQAMKQAKS................................... 122
233 7.000e-51gi|517953062|ref|WP_019123270.1| flagellar protein FliS [Brevibacillus massiliensis]  clstr ali  21  2LQNPAQVYQNNQVTTATPGELTLMLYNGAIRFIKQTRQAILDKKLEKAHECNIRVQDILHELMSSLNRDVPISEQFITMYDYMLRRMVEANVRKDVEILDEVESLFGEFRDTWKEAMILAKKQ.................................. 124
234 8.000e-51gi|737662395|ref|WP_035632039.1| flagellar export chaperone FliS [Lachnospiraceae bacterium ND2006]  clstr ali  21  4.QQVYERYGKNRILTATPAELTLMLYDGCLKFINMAISAVDENDVERAHNNIRKAERIIDEFQATLDHKYQVAEDFDRIYVYVKRRLVEANLKKDRDILDECAEHVRSLRDTWREVMRKAGNGS................................. 126
235 8.000e-51gi|652787766|ref|WP_027092636.1| flagellar export chaperone FliS [Cohnella thermotolerans]  clstr ali  20  1MITPQDQYLMMQVQTASPGELTLMLYNGCIRFLKLALAGIEAKDAANKHLNIIKAQNILEELQSTLNMNYEISANLFSLYDFIRSQLIHANLHMDAESIRTCIGLMTELRDTWAQAVKQVKSGQA................................ 125
236 9.000e-51gi|765539448|ref|WP_044746270.1| flagellar protein FliS [Anoxybacillus sp. ATCC BAA-2555]  clstr ali  21  8.....QIYQQNSVSTASPGELTLMLYNGCLKFLNKGKQAIKENNIQERNINLQKAQRIIQELMVTLDQKYEVAHQMMAMYEYMNRRLVEANVTNNIAIVEEVEGFMTEFRDVWKEVIRLNRQKQF................................ 127
237 1.000e-50gi|502886625|ref|WP_013121601.1| flagellar protein FliS [Thermincola potens]  clstr ali  23  1MQNPYSQYKQISVQTASPEQLVVMLYDGAIKFLHLAKEAVARKNMEDTNKYIGKTQDIINEFIVSLDMSAEIAHNLYNIYDYWNRRLIQANIKKDPDIIAEVLGQVQELREVWAEAAVKSKEG.................................. 125
239 1.000e-50gi|501110735|ref|WP_012160328.1| flagellar protein FliS [Alkaliphilus oremlandii]  clstr ali  19  3MNNPYGQYKQNSVMTASPQELTLMLYNGALKFIGMAKINIQEKDIPKANESIKRAQDIIQELNITLNMDYPISTNLRSMYTYILEKLVDGNIYKEIQYLDEAAEIITELRDTWKEAMKISKGG.................................. 125
240 1.000e-50gi|490756810|ref|WP_004619108.1| flagellar protein FliS [[Clostridium] papyrosolvens]  clstr ali  19  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDQRKIERANNSIIRAQDIVREFQVTLDMKYEVSKHLDSIYDYMYRRLIQANIKKDKAILEEMLEMAKDLRDTWTQAMKLAKRQ.................................. 125
241 1.000e-50gi|504023012|ref|WP_014257006.1| flagellar export chaperone FliS [[Clostridium] clariflavum]  clstr ali  23  4.NNGYEQYRESSVYTATPEELVLMLYNGLVKFLMQAQMAINKKNIEKANNCIIKAQNILTEFRCTLDMKYDIAHQLDSLYDYMLSRLIDANIKKDNTIIEEILGYARELRNTWEQAMKIAKQQ.................................. 125
242 1.000e-50JGI.Meta 7068730639 SRS015065_WUGC_scaffold_32618__gene_82136 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  18  9..SAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAELSVEKNDIPRAHENIRKVQNIIGYLHSTLDMKYEVSKDFDNIYSYLERRLVEANVKKDKEILEEINTHLHSIRDNWKEVMK....................................... 124
244 1.000e-50gi|928940846|ref|WP_053965665.1| flagellar protein FliS [Clostridiales bacterium mt11]  clstr ali  20  1MTSALNQYKQNTVLTATPEELTLMLYDGAIKFMNIAKYSIKNNDKERAHKSLIRAQDIVVELNSTLNMDYEVSKNLETLYDFVIDKLIDANINKQGEPIDEALDILTELRDTWKEAMKDVRKK-VYQNRQ........................... 130
245 1.000e-50gi|755607587|ref|WP_042530189.1| flagellar protein FliS [Oceanobacillus oncorhynchi]  clstr ali  18  4.NKAYQTYQNNAVNTASGGELTLMLYNGCIKFIKQARKEMDNDHFAAKNTNIQKAQKIINELMVTLDMNMEISHQMMPLYDYMHNLLTEANIKNDTEKLEEALSYAEEFRDVWKQVILKDRQQKYSQGA............................ 131
246 1.000e-50gi|654495559|ref|WP_027965387.1| flagellar protein FliS [Halalkalibacillus halophilus]  clstr ali  20  5..QAYQAYQENSISTASPEQLTLQLYNGCIKFIKLSKRAIENESIEEKNINIQKAQNIISELRATLNMDYDISHQLMPLYEYINHRLTQANFKSDVSMLNEAQQMVEQFRDTWKEVMKANRVQSQKAGVQ........................... 132
247 2.000e-50JGI.Meta 7078983616 C3331390__gene_218949 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763678604]  ali  16  16..NGYAAYANSKIMTASPAELTLMLYDGAIKFCNIAIAGIEENNIEKAHNNIRKVENIISEFQATLNHKYATADDFNNVYVYLKERLIEANMKKDKEILEEVLKHLRTMRDTWKEVMKLAAGQ.................................. 136
249 2.000e-50gi|503119093|ref|WP_013353774.1| MULTISPECIES: flagellar protein FliS [Bacillus subtilis group]  clstr ali  15  4.NNPFAAYQQTSVFTAAPEELTLMLYNGCLRFIKLARQAMKQNNPEAKNENIVKAQNIIQELSITLNREIEISEQMSSIYDYIRRRLIEANVQNNEGFLDEAEKLVTEFRDTWKQAMQSERK................................... 124
250 2.000e-50gi|499379315|ref|WP_011066893.1| flagellar protein FliS [Oceanobacillus iheyensis]  clstr ali  22  4.NNAYQVYQNNSVNTASNGELTLMLYNGCMKFIKQAKKDMEADNFAEKNKNIQKAQNIIQELMITLDAKMDISKQILPLYEYMQYQLKEANIHNDTSKLDEVLGFVTEFRDTWKQVIIKNRQQQYNEGA............................ 131
251 2.000e-50gi|497214887|ref|WP_009529149.1| flagellar export chaperone FliS [Peptostreptococcaceae bacterium CM5]  clstr ali  19  4..NPYAKYKENSINTASKEELTLMLYDGCIKFMNLAKIAIEEKNIQKANDNLLKAQAIVTELDITLNMDIEISKNLHSLYDFVQNRLIEANLTKKASFVDEAKLIITDLRDAWKEAINLVRRG.................................. 124
252 2.000e-50gi|524331596|emb|CDA86155.1| flagellar protein FliS [Clostridium sp. CAG:230]  clstr ali  19  5.RNAAQLYQKNSVQTASPSKIILMLYDGAIKFCHMAQVAIDEKNIEKANLNIQKAQKIIVQLRVSLDTKYPVSQEFDKVYDYIYRRLVEANMKKDNEILEEALKHIKTMRETWIEVMKKTHS................................... 125
253 2.000e-50JGI.Meta 7070285893 C4471001__gene_327217 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 2 of subject 16015  ali  16  2..NPYAKYKENSINTATKEELTLMLYDGCIKFMNLAKIGIEEKNIQKANDNLLKAQAIITELDVTLNMDIEISKNMHSLYDFALSRLVDANLKKDTSFIDDAKIVIVDLRDAWKEAMNIVKRG.................................. 122
254 2.000e-50gi|503138713|ref|WP_013373374.1| flagellar export chaperone FliS [Paenibacillus polymyxa]  clstr ali  21  3.TSPYEKYRQSSVQTSTPSQLVVMLYDGAIRFVKAGLVALDSKDYQKVNLNLGKAQTIISELMSTLDHSYDISKSLFALYEYMNYLLIQANIKKSADPANEALGYLTELRETWVQASKLTAGAA................................. 125
255 2.000e-50gi|524812880|emb|CDF07774.1| putative uncharacterized protein [Firmicutes bacterium CAG:95]  clstr ali  18  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYTYLQQRLAQANIKKDPEILEEVCEHLRSVRDTWKEVMAKNQHK.................................. 125
256 2.000e-50gi|503548211|ref|WP_013782287.1| flagellar export chaperone FliS [Mahella australiensis]  clstr ali  21  3LNNPYHQYQQNSIMTASPGDLILMLYDGAIKFIKQAKVYIDEKDMQKANNAILKAEDIVAELMADLDPAYDISHDLYSLYEFINDCLVRANIKKDKVLLDQSLDLISDMRQTWAQVVKQYR--------QQEYAGI..................... 130
257 2.000e-50gi|1005381749|gb|AMQ07523.1| flagellar protein FliS [Sporosarcina psychrophila]  clstr ali  22  4.NNPYATYQNNSVNTSTPGELTLMLYNGCLKFILQAKRAMNDNNIEEKNKAVQKAQAIISELMLTLDKSYPVSQNMLVLYEFANSRLIDGNIKNDSALFDEASAIITEFRDTWKQVIQINRQKQYAN.............................. 129
262 2.000e-50gi|524618863|emb|CDD34733.1| flagellar protein FliS [Roseburia sp. CAG:309]  clstr ali  17  3.QRAINAYQRNAVMTASKAELTLMLYDGAIKFCNIALSGFEKKEYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAGS................................. 125
263 2.000e-50gi|651996699|ref|WP_026700734.1| flagellar export chaperone FliS [Bacillus aidingensis]  clstr ali  20  7.KQAANPYQQNALDTASSGDLTLLLYNGCIKFIDKADKAMEENNIEDKNKFIKRAQDIIRELMITLKTDSDIGQNMYSLYDFIHRRLIDANVQNDREALQEARGFVVDFRDTWKEIIKLDRQQRFGEGGQA.......................... 136
266 3.000e-50gi|827087443|ref|WP_047184747.1| flagellar protein FliS [Bacilli bacterium VT-13-104]  clstr ali  19  4.NKAYSTYQNNTVNTASSGELTLMLYNGCMKFIKQAMKDIGSNNFEAKNTNIQKAQNIIQELMITLDPKAEISKQIMPLYEYMHFQLKEANVKNDPVILEEVLGFVTEFRDTWKQVLIETRKQNYVKQGAQI......................... 134
267 3.000e-50JGI.Meta 7012167621 SRS055378_LANL_scaffold_76977__gene_92803 flagellar protein fliS [Human Supragingival plaque microbiome from visit numbe  ali  23  3.NNAAEVYKKQQVMTATPEALTLMLYNGCLKFIKEGLEALDEKNYENANIFFQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKGDPAIIKEADDIMLGLRDAWSGAMKKAREEKGMQGAEGVYAG...................... 138
268 3.000e-50gi|518372553|ref|WP_019542760.1| flagellar export chaperone FliS [Selenomonas bovis]  clstr ali  21  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGIQGVKEKQWEAANNSLQKAQSIISEFRITLDMDYEISHQLMPLYNYTYDRLVEGNIKSDVAMLEEAKGIIKELRDAWAQAMKKARKEKGTQGVQ........................... 131
269 3.000e-50gi|913007223|ref|WP_050352323.1| flagellar protein FliS [Virgibacillus pantothenticus]  clstr ali  16  4.NKQHQAYQNNAVNTASSSELTLMLYNGCIKFIKQAMRDIEGNQFEAKNTNIQKAQNIIRELMITLDVEVDISHQFMSLYEYMFHRLTEANMHNDKTALEEVLEFAIEFRDTWKQVILQTRKNQYTKGA............................ 131
270 4.000e-50JGI.Meta 7006916546 SRS063215_LANL_scaffold_23823__gene_27119 flagellar protein fliS [Human Subgingival plaque microbiome from visit number  ali  19  4.NSAAEAYKKQQVLTATPEALTLMLYNGCLKFIKEGVDALAEKKYENANICLQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKSDPAIIQEATDIITELRDAWVQAMKTAREEKGAQGMEGVYAG...................... 139
273 4.000e-50 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYSYLQQRLAQANIRKDPEILEEVCEHLRSVRDTWKEVMAKNQHK.................................. 125
274 4.000e-50gi|740244667|ref|WP_038085659.1| flagellar protein FliS [Tumebacillus flagellatus]  clstr ali  19  2MKNPYQSYSNTQAMTATPGELTLMLFNGAIRFLKQASIGLEDKDYETVNTNLLKAQNILLELMSTLKMEYEVAQGLMPLYQFMYEQLVQANIKKNQTPIQDVIGLLEELRDTWNEAIKLARVQQAGG.............................. 128
275 4.000e-50gi|769124347|ref|WP_044906438.1| flagellar export chaperone FliS [Lachnospiraceae bacterium MC2017]  clstr ali  19  6...AYAQYNRNKILTASPAELTLMLYEGCIKFINIAIKAVEDKDTQKANLNIQKAEKIIDEFRRTLDFKYPVAKDFDVVYEYVGRRLVEANISKEKEILEECATHMRTMRDAWKEVMRTAPQDLAGNRRQA.......................... 133
276 4.000e-50gi|497332127|ref|WP_009646340.1| flagellar protein FliS [Selenomonas sp. CM52]  clstr ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVQGNLSSDTGKIDEAAGIIRELRDAWAQAMKKARAE.................................. 124
277 5.000e-50gi|551037069|ref|WP_022780814.1| MULTISPECIES: flagellar export chaperone FliS [unclassified Lachnospiraceae]  clstr ali  20  5..NPYAQYKNSKILTASPAELTLMLYEGAIKFGNIAIEAIENKEIEKAHNNIIRVQKIIDEFRATLNRKYPVAEEFDKIYRYLLRRLLEANATKDEEIMKEVVEHLRSMRDNWKEVMKKVKEE.................................. 125
279 5.000e-50gi|502257470|ref|WP_012744009.1| flagellar export chaperone FliS [[Eubacterium] rectale]  clstr ali  18  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKNDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMR....................................... 120
281 5.000e-50gi|639198127|ref|WP_024536572.1| flagellar protein FliS [Sporosarcina sp. EUR3 2.2.2]  clstr ali  20  5..NPYQAYQQNSVMTASPQELTLMLYNGCLKFIKLAKKAMADNKYEDKNTNMIKAQAIIQELRYTLDPDIELSASMAQLYDYMYNRLVEANMKNDAVVLEEVEGYVVELRDTWKQAMSQMKN................................... 124
283 6.000e-50gi|916715238|ref|WP_051322329.1| flagellar export chaperone FliS [Alicyclobacillus contaminans]  clstr ali  20  1MNSAYAAYRQTAIQTASPDKLIIMLYDGLILALERAKTAIATKDAAGAHQQLLKAQSILSELRAPLDMRYEVSKSLAALYDYWHRRLVEANIQKDAAPIDEVLVYVRDFRDTWVQVAEKARQEQAAAAPQGLSSG...................... 136
285 6.000e-50 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  1MNNGYAAYANSKIMTATPAELTLMLYEGAIKFCNIAIMGIEEKDIEKTHNNIKKVENIITEFQVTLDHKYPVADDFDNVYKYLKDRLLEANVKKDKDILEEVLGHLRTMRDTWK........................................... 116
286 6.000e-50gi|654955697|ref|WP_028405610.1| flagellar export chaperone FliS [Bacillus sp. J13]  clstr ali  19  1MQQAVNRYYETQIKTATPEELTLMLYNGCIRFLKQAQISIANKDYKSKNLNITKAINIIDELQVTLDMKYDISQNLASLYEFFKQRLVFASMRLDQDVLQEVIDMVTDLRDTWHEAIKMVKQQ.................................. 123
287 6.000e-50gi|494500710|ref|WP_007290173.1| flagellar export chaperone FliS [Thermosinus carboxydivorans]  clstr ali  21  1MNNMANAYKTQQIMTAPPEQLTLMLYNGAIKFVDESIQAIEQRDFPKAHASNLRAQDIVRELMVTLDMQYEIAKTWYQLYDYILYRLIQGNIKKDKDQLQEARGMLQEFRDTWVEAMKRARAGQAAVG-QAV......................... 133
289 6.000e-50gi|651936533|ref|WP_026672359.1| flagellar protein FliS [Bacillus bogoriensis]  clstr ali  18  8....AAAYKQNTLNTASPGELTLMLYNGCLKFIKQGKTGIENNDIEMRNINIKKAQDIIRELMVTLETNSDLGKNMMRIYDFVLSRLVDANIKNDVQALNEAEQFVTEFRDTWKQVIQIDRQQRHGSGGQA.......................... 134
291 7.000e-50gi|524296299|emb|CDA56950.1| flagellar protein FliS [Roseburia intestinalis CAG:13]  clstr ali  15  4.NRGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVERIIEEFQSTLNHKYPVAKDFDEVYNYLLVHLQEANIKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
294 7.000e-50gi|492391867|ref|WP_005829829.1| flagellar protein FliS [Brevibacillus agri]  clstr ali  25  4.QQSLQAYQTNSVNTANPGELTLMLYNGALKFLKQSKAAIAEKKFDKANEYNKRVQDIVGELMVTLDQKYPIAQQMMSLYEYMQTRLIEANLKKETSILDEVEGLLTQFRDTWKQAMVLAKTQ.................................. 125
296 9.000e-50 GL0002506 [Complete] locus=scaffold7399_1:2107:2493:-  ali  20  6...AYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEMAVEKSDVPKAHENIRKVQNIIGYLHSTLDMKYEVAKDFDNIYNYLERRLVEANVKKDKEILEEINMHLHSIRDNWKEVMK....................................... 120
297 9.000e-50gi|873894915|ref|WP_048601363.1| flagellar protein FliS [Bacillaceae bacterium mt6]  clstr ali  20  3MRNPQQIYQQNAVTTATPAELTLMLYNGAIRFVRQSKQALEHKELEKAHQANVRAQDIINELMVTLNMDVDLSKQLLQLYDYLRNRLIEANVQKDGEILNEVEEFLIQFKATWEQAMKLAK.................................... 123
299 1.000e-49gi|489558106|ref|WP_003462653.1| flagellar export chaperone FliS [Gracilibacillus halophilus]  clstr ali  16  4..QQYQAYQNNSVETASPSELTLMLYNGCIKFIKQAKKAIDEGNIQDRNNYIQRAQNIIRELMVTLDQDAPIAQEIMPLYDFVHYNLTQGNVNNNKEALQEAEDIVVDFRDTWKEVIKQERKRTYGQGT............................ 130
300 1.000e-49gi|656012561|ref|WP_029052510.1| flagellar protein FliS [Sporosarcina ureae]  clstr ali  20  4.NNPYATYQNNSVITSTPGELTLMLYNGCLKFIQQAKMELAKGNLEQKNIAIQKAQAIVTELMLTLDTSYDVSKNMLVLYEFVNSRLIDGNIQNDPAMFEEAAGIITEFRDTWKQVIQINRTKQY................................ 127
301 1.000e-49gi|506236525|ref|WP_015756300.1| flagellar export chaperone FliS [Desulfotomaculum acetoxidans]  clstr ali  20  5..NPYQQYQQNSITSAKPGQLTLMLYNGAIKFIKTAILGMEKKDIGTANGAVIRAQEIIRYLDHTLDPQYEISQNLSSLYDYIYRRLVEANINKNAAVLEEVVSMVEELRDTWMSVLKKT..................................... 122
302 1.000e-49gi|654670062|ref|WP_028129579.1| flagellar export chaperone FliS [Selenomonas sp. AE3005]  clstr ali  20  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMNEGKDAVEAKQYENANNLLQRAQQIISEFRITLNMDYEISHQLMPLYNYCYDRLVEGNIKSDTAMIQEAIDIIKELRDAWAQAMKKARQDGGTKNVQ........................... 131
303 1.000e-49gi|960364435|ref|WP_058257348.1| flagellar protein FliS [Herbinix sp. SD1D]  clstr ali  21  4..NAAAIYRDNKILTATPAELTLMLYEGAIKFCNIALMAIEKDDIVKANTNLQKAQKIILELRATLDFNYSVANQFDMVYDYIYRRLVESNIKKDKEILEEALGYIREMRDTWKEVMKQAK.................................... 122
305 1.000e-49gi|927079676|ref|WP_053779536.1| flagellar export chaperone FliS [Paenibacillus sp. A59]  clstr ali  22  3.TSPYDKYRQSSVQTSNPAQLVIMLYDGAIRFVKTAIDGLAQKDNEKISLNLGKAQTIISELMSTLDRSYDISKNLHSLYEYTNYLLVEANIRKDVAKAEEAVGYLTDLRDTWLQASKIAAGQ.................................. 124
306 1.000e-49gi|501153642|ref|WP_012198343.1| flagellar protein FliS [Lachnoclostridium phytofermentans]  clstr ali  19  3.QNAASIYQGTKINTASPAELTLMLYEGAIKFCNKALYGLEQNDIAKVNENLLKAQKIVTELRSTLDFKHPIAREFDTVYDYINRRLVDANIKKDTEILEEALDYIRQMRDTWKEVMKKNN.................................... 122
309 1.000e-49gi|518207541|ref|WP_019377749.1| flagellar protein FliS [Virgibacillus halodenitrificans]  clstr ali  21  3LNKQYQTYQNNAVNTASGGELTLMLYNGCMKFIKQAIKDLENKNYEAKNTNIQKAQNIIQELMLTLDQKVEISKQILPLYEFMQFQLREGNIKNDPSLLIEALEFITEFRDTWKEVMLKNKKAQPVQGAQ........................... 132
310 1.000e-49gi|517490146|ref|WP_018660723.1| flagellar protein FliS [Bacillus acidiproducens]  clstr ali  16  4.QNPYQAYQNNSISTASAGELTLMLYNGCLKFIHLARVAMQNKNIEEKNKNIQKAQNIIRELMVSLDTEKAAAEKMLAIYEFMLHELIAANIKNDPGKLDTVEELVTGFRDTWKQVIQLNRRQTFGSGGRA.......................... 134
312 1.000e-49gi|653619916|ref|WP_027630251.1| flagellar protein FliS [[Clostridium] cellobioparum]  clstr ali  20  4.NNGYDQYKSNSINTATPEELTMMLYNGLVKFLMQAQSAIDAKNIERANNSIIKAQAIIIEFMTTLDMNYEVSQNLELLYDYMYRQLTQANLKKDNVIVGDVLGMAKELRDAWSQAMKLAKHPAPVQ.............................. 129
313 2.000e-49gi|654584991|ref|WP_028052082.1| flagellar export chaperone FliS [Carboxydothermus ferrireducens]  clstr ali  23  1MNNPYAQYQTQNIATAPPEKLLIMLYDGAIKFLKQGLKALDEKKYDDFSYYISRTQDIISELMVTLDMDYEISKNLYQLYDYFMYRLIHGSVKKDRQSIEEVQKHLEELREAWVQAA........................................ 117
318 2.000e-49gi|524653689|emb|CDD66177.1| flagellar biosynthetic protein FliS [Firmicutes bacterium CAG:882]  clstr ali  18  1MNTPYQQYEKSKILTASPAELTLMLYEGAIKFANIAVMAIEKGDVEKAHNNIRKVERIIEEFQVTLNHKYPVAKDFDEVYKYLQQRLLEANIKKDKVIMEEVLRHLRTMRDTWKDVMRLAKTQ.................................. 125
319 2.000e-49gi|739065206|ref|WP_036936616.1| flagellar export chaperone FliS [Pseudobacteroides cellulosolvens]  clstr ali  17  4.NKATEQYKENSIFTASPEELTLMLYNGLIKFIMQAQMAIDEKNIQKAHNCIIKAENIICEFQATLDKNYDVSNNLALIYDYMNRRLVDASIKKDKEILNEVLGFAKDLRDTWTQAMKLAKQQ.................................. 125
322 2.000e-49gi|653088798|ref|WP_027339040.1| flagellar protein FliS [Halonatronum saccharophilum]  clstr ali  21  4.NNPYQKYKSTKYETASPEKLLLMLYEGGIRFAKRGKIAMEKKDIQEVNKSLQKVQQVINELMVTLNMDKEISQNLYSLYEYINRRLIEANIKKDPLILDEVINLLTELKEGWEEASKKVNN................................... 126
323 2.000e-49gi|648228602|ref|WP_026009751.1| flagellar protein FliS [Bacillus endophyticus]  clstr ali  20  3MNNAYQAYQQGSVNTATPGELTLMLYNGCLKFIRRAKTAIENREVEEKNKNLIKAQNIITELMVTLRTGSELSDQMRTMYDYINQRLMKANIESSVDILEEVESYVMEFRDTWKEVIQKTRS................................... 124
326 2.000e-49gi|511038544|ref|WP_016292562.1| flagellar export chaperone FliS [Lachnospiraceae bacterium 28-4]  clstr ali  19  5..NRYEQYSSNKVMTASPAELTLMLYEGAIKFCNIAIMGLEQSDIEKAHNNMIKTEKIIRYLRETLDMKYPVAQEFENIYVYLDRRLVEANMKKDKEILDEICEHLRSVRDTWKEVMRINREK.................................. 125
328 2.000e-49JGI.Meta 7037942878 SRS014923_WUGC_scaffold_59614__gene_126629 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  15  4.NKGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVEHIIEEFQSTLNHKYPVAKDFDEVYNYLMMRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
331 3.000e-49gi|495157836|ref|WP_007882639.1| flagellar export chaperone FliS [Roseburia inulinivorans]  clstr ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
333 3.000e-49gi|769175519|ref|WP_044946921.1| flagellar protein FliS [Lachnospiraceae bacterium NC2004]  clstr ali  19  4.RNAAQIYGQNKILTATPAELTLMLYEGAIKFCNKAIDAVDNNDVVEAHKNIRKVENIIIEFQATLDHKYEVAKDFDIIYDYVYRKLVEANIKKDRETLEEVLKELRDLRDSWKIIMKTANSPA................................. 126
334 3.000e-49gi|517760788|ref|WP_018930996.1| flagellar export chaperone FliS [Gracilibacillus lacisalsi]  clstr ali  18  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQAKKAIESQNHQSKNEMIQKTQDIIRELMVTLDQDAPIANEIMPLYDFVYHALTQANIKNDLEQLEQAREIIENFRDTWKEVIKQERIRQHGQGV............................ 130
335 3.000e-49gi|490200466|ref|WP_004098960.1| flagellar export chaperone FliS [Acetonema longum]  clstr ali  18  7....ANAYKNQQIMTASPEELTLMLYNGALKFMTESVQAIEEKKYEKAHETNIRSQNIIREFMTTLDMQYELSHNLYEIYDYMHRSLIEANLKKDAAKLKEIRDLLRELRDAWAEAMKRARQDRV................................ 127
336 3.000e-49gi|524262138|emb|CDA24599.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:197]  clstr ali  18  4.NQAYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKHDIEKAHNNIVKTERIILEFQATLDDKYPVAKDFDAVYTYLIQRLREANLKKDSEILEEVLKHLRTMRDTWKEVMAKA..................................... 122
338 4.000e-49gi|495707141|ref|WP_008431720.1| flagellar protein FliS [Planococcus donghaensis]  clstr ali  19  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFMKLAKRAMADKKIEEKNTNIIKAQNIIQELRSTLKADIEMSAGLEQMYEYMYSRLVEANMKNDVSALEEVEELMTDIRNTWKQAMALVKK................................... 124
340 4.000e-49gi|489483333|ref|WP_003388312.1| flagellar export chaperone FliS [Brevibacillus borstelensis]  clstr ali  20  4..NAAQTYQSNQVTTATPGELTLMLYNGAIKFIKQAKSAIDEKNVVKAHENCLKVQNILYELLSTLNKDYPISGELEKMYDYMLHRMIEANMRKDASILTEVEDYFVQFRDTWKEAMLLAKKQ.................................. 124
341 4.000e-49gi|651957150|ref|WP_026682018.1| flagellar export chaperone FliS [Bacillus megaterium]  clstr ali  21  4.NKQHQAYKNNAVNTASGAELTLMLYNGCIKFIKQAMKDLDSKNYEAKNTNIQKAQKIIQELMITLDPKIEISNQFLPLYEYMLFQLKEANIKNDTSLLEEVLGYTIEFRDTWKQVILETRKKQYAQGA............................ 131
342 4.000e-49gi|518247286|ref|WP_019417494.1| MULTISPECIES: flagellar protein FliS [Anoxybacillus]  clstr ali  19  5..QAHRAYQQNSVSTASPGELTLMLYNGCLKFLNKAKEAIHENRINERNENLQKAQKIIQELMVTLNQEYEIAKQMMIMYEYMHYRLIQANIKNDVLMVEEVENLVMEFRDTWKEVIRLNRQK.................................. 125
343 5.000e-49gi|524155216|emb|CCZ29304.1| flagellar protein FliS [Firmicutes bacterium CAG:194]  clstr ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
344 5.000e-49gi|489639562|ref|WP_003544002.1| flagellar export chaperone FliS [Desulfotomaculum nigrificans]  clstr ali  19  4.KNPYQNYQQNAIMSAGPEELTTMLYNRLVKDLKLAREHVENRDIEGAHSSIVHAQDILSHLMHTLDTSYEVGQNLMAMYDYMYRCLVQANLKKDANLIQEVTGYAEEIRDTWIQAVKLAKSSAAMGN............................. 130
345 5.000e-49gi|515113298|ref|WP_016742351.1| MULTISPECIES: flagellar export chaperone FliS [Bacillales]  clstr ali  19  2LQNAAQTYQSNQVTTATPADLTLMLYNGALKFIKQAKGAIEEKDVARAHEASLKVQNILYELMSTLNSDYTISKEFIKLYEYMLHRTIEANMRKDIEILSEVESLFLQFRDTWKEAMQLAKSQ.................................. 124
351 7.000e-49gi|493741206|ref|WP_006690311.1| flagellar export chaperone FliS [Selenomonas flueggei]  clstr ali  19  3.NSAAEAYKKQQILTATPEALTLMLYNGCLKFIKEGSDALAEKNYEAANISLQKAQNIISEFRVTLNMDYEISHQLMPLYNYAYDRLVEGNLDNNFDAIKEATDIITELRDAWAQAMKKAREEKGRQGTEGVYAG...................... 138
352 7.000e-49gi|671563641|ref|WP_031544064.1| flagellar export chaperone FliS [Lachnospiraceae bacterium AC2014]  clstr ali  17  4.QQAFNAYNNSKILTASPAELTLMLYDGAIKFTNIAILALEKKDIEKAHNNIRKTERIVIEFQTSLDHKYEVAKDFEKVYLYLISRLREANIKKDAEILEEVLKHLRTMRDTWKEVMTIAGNG.................................. 125
353 8.000e-49 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  22  4LRNAANIYQQNAINTASPARLTLMLYEGAIRFCNIAREAMAEDDYEKINTNVKKAQNIIVELRSTLDMKYPVAKEFDNVYDYVYRRLYEANMQKDMEAMDEVIKHLKTMRDTWKEVMKINH.................................... 127
355 8.000e-49gi|974582219|ref|WP_059172707.1| flagellar protein FliS [Bacillus sp. FJAT-27445]  clstr ali  20  4..KPNEIYQRNQVTTARPEELTLMLYNGGIKFLQQARVAIDKKDIPKAHSLITRVQDIVTELMVTLNMDYEISKTLLPLYEYMKNRLVEANVAKDSEILSEIEEMFQELRTTWAQAIKQSKS................................... 123
361 1.000e-48gi|502941062|ref|WP_013176038.1| flagellar export chaperone FliS [Syntrophothermus lipocalidus]  clstr ali  22  6..NAYQQYRNSTVETASPGALLLMLYDAAIQNLEGAKRAIEGNDMAGAHNYLTRAQDIVLELMSTLNMEYQISKSLWSLYDYLYRQLVQANVKKSVELVEEVYGFMTELRDTWREAVRKARTAAVSGGKSQ.......................... 135
363 1.000e-48gi|495793681|ref|WP_008518260.1| flagellar protein FliS [Dethiobacter alkaliphilus]  clstr ali  18  4..NPYQKYKQNQVETSSPQQLIIMLYNGAIKFLKLAQMGITEQSIEKAHTNIIKTQDIINELMASLDMNQEVASHLYSLYDYMNSRLLEANLKKDTQILSEVENMLTELRDSWVQALK....................................... 120
365 1.000e-48gi|996048563|gb|KXG78774.1| Flagellar protein FliS [Fervidicola ferrireducens]  clstr ali  22  1MVNPYQQYQENQVMTAPPERLVLMLYEGALRFLRLAKKAVEEKNYADANNYIVRVEDIIMELNMSLDMNYELSKNLRSLYNFIYEKLIEANIKKDLSKLEEVEGLLEGLKEAWQEVMKAKKTA.................................. 127
368 2.000e-48gi|489420996|ref|WP_003326733.1| MULTISPECIES: flagellar export chaperone FliS [Bacillus subtilis group]  clstr ali  17  4.QNPYTAYQQNSINTATPGELTLMLYNGCLKFIKLANQAIHLGDMESKNVNLIKAQNIIQELNITLNRDIELSGSMGAMYEYIHRKLVEANIQSDKDILAEIEGYITDFRDAWKQAIQIERKDRHGSGG............................ 131
369 2.000e-48gi|764887749|ref|WP_044481004.1| flagellar export chaperone FliS [Paenibacillus sp. GD11]  clstr ali  20  3.TSPYEKYKQSSVQTSTPAQLLIMLYDGAIRFIRGAVEAINAEDIQKKNELIGKAQAIVSELRATLNHSYEISAQLDKLYEYINYLLIEANIRKDAAKATEAVDYLVDLRESWIQASKVVISGQEQVNS............................ 130
371 2.000e-48gi|506403703|ref|WP_015923422.1| flagellar export chaperone FliS [Halothermothrix orenii]  clstr ali  17  4..NPYQKYKKTRFETANREKLILMLYEGAIKSLNHAKKGMEEDNIELINESLKKSQDIINELMVSLNPEAEIATNLYSLYDYMQRRLIEANLKKEIEPVKEVKKMVEELHETWKEAMLQVHKTKYAGQKKQ.......................... 133
372 3.000e-48gi|653148638|ref|WP_027397829.1| flagellar export chaperone FliS [Anaerovibrio lipolyticus]  clstr ali  23  2MNNAAEAYKRQQVMTATPEALTLMLYDGCLRFMKEGLEAMEQKKWEQCNTSLQKAQNIINEFRVTLDMKYDIAHQLMPLYDYVYNSLVEANMRSKPEKVTECMDIIKELRSAWAQAMIKARKE.................................. 124
373 3.000e-48gi|503588819|ref|WP_013822895.1| flagellar protein FliS [Desulfotomaculum kuznetsovii]  clstr ali  20  6..NPYQQYLQNAVLTADPGRLTLMLYTGAVRFIRQASDCLAARDIPGAHRACLRAQDIIVYLLETVNREMEVGKNLSALYDYMYRRLVEANVKKDAAVLDEVAGLLEELADTWEQALKL-KGQQVAGG............................. 130
375 3.000e-48gi|304551882|gb|EFM39825.1| flagellar protein FliS [ [[Eubacterium] yurii subsp. margaretiae ATCC 43715]  clstr ali  13  6..NPYQRYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDAWREAMIIVRKGQ................................. 127
376 3.000e-48gi|738718092|ref|WP_036612461.1| flagellar export chaperone FliS [Paenibacillus sp. FSL H7-689]  clstr ali  20  3.KSPYEKYRQSSVQTSTPAQLVIMLYDGAIRFVKVGLEGLNNQDIEKANLNLGKAQTIISELMSTLDQSYDVSKNLFALYEYTNYLLIEANIRKSPEKAEEAIGYLTDLRETWMQASKLASTQ.................................. 124
377 3.000e-48JGI.Meta 7001900127 SRS022725_LANL_scaffold_9219__gene_23667 flagellar protein fliS [Human Supragingival plaque microbiome from visit number  ali  13  6..NPYQKYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDGWKEAMIIVRKGQ................................. 127
379 4.000e-48gi|524741466|emb|CDE45858.1| flagellar protein FliS [Clostridium sp. CAG:411]  clstr ali  20  7...AANAYQGTRINTASPAELTLMLYDGAIKFCNIGMVALEKGDYEKANLNIQKAKKIIVQFRNDLDFNYPVAQDFDRVYEYIYYTLVDANVKKDKELLEEALGRIREMRDTWKQVMDKVKNG.................................. 126
380 4.000e-48gi|657022410|ref|WP_029266215.1| flagellar export chaperone FliS [Virgibacillus alimentarius]  clstr ali  19  4.NKGYQTYQHNAVHTASSGELTLMLYNGCIKFIKQAMKDIDEHNYEAKNNNIQKAQNIIQELMLTLDPKIEISKQILPLYEYMHHLLKEANIQNEITELEEVLQLVSEFRDTWKQVILKNRKEQSVQGAQ........................... 133
381 4.000e-48gi|767003997|ref|WP_044878807.1| flagellar export chaperone FliS [Paenibacillus sp. IHBB 10380]  clstr ali  21  1MKSPYDKYRQSSVQTSTPEQLVIMLYDGAIRFIRIAVDGMDKRNYEITNLNVSKAQTIISELMSTLDYTYDISKNLYSLYEYIYHLLIQSNIKKEKALAEEALGYIQELKDTWLEAIKM...................................... 119
382 4.000e-48gi|504864176|ref|WP_015051278.1| flagellar protein FliS [Thermacetogenium phaeum]  clstr ali  24  7..NNYDQYRQIAVQTAGPGKLLLMLYDGLTVFLKQAVQAVKDGEFGEAHRCLIRAQDIITELMCTLDMKYEVAKNLFRIYDYLKGRLVEANVKKDSSIIEEVLGLVAELKETWEQIIEPSK.................................... 125
383 5.000e-48gi|754767066|ref|WP_042131330.1| flagellar export chaperone FliS [Paenibacillus sp. FSL R5-0345]  clstr ali  21  2MTSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFARTAMDGLSKQDYEKTSLNFGKAQTIISELMSTLDYSYEVSNNLYSLYEYTNFLLVEANIRKSPEKAEEAIGYLTELRETWLQASKIAAGQ.................................. 124
384 5.000e-48gi|740812035|ref|WP_038597318.1| flagellar export chaperone FliS [Paenibacillus sp. FSL H7-0357]  clstr ali  21  3.NSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFIRAGLDGLKRNDLEKTNINLGKAQTIVSELMSTLDRSYEVSEGLYSLYEYTSFLLVEANIRKDAVKAEEAVGYLTELRETWLQASKIAAGQ.................................. 124
387 6.000e-48gi|544876082|ref|WP_021289102.1| flagellar export chaperone FliS [Virgibacillus sp. CM-4]  clstr ali  16  4.NKQHQAYQENAVNTASGAELTLMLYNGCMKFVKQAIKDVEANHFEEKNTNIQKAQNIIQELIITLDPKIEISNQFLPLYDYMLFRLKEANINNNVEYLQEVLELITDFRDTWKQVILEIRKKQYAQGA............................ 131
388 6.000e-48gi|518465419|ref|WP_019635626.1| flagellar export chaperone FliS [Paenibacillus fonticola]  clstr ali  18  3.TSPYDKYRQSSVQTSTPSQLLLMLYDGAIRFVRGGIEGIKEGDYDKVNTLLNKAQSIVTELTVTLDYSYEVSKGLASLYEYINHLLIDANIKKTAPPAEEALGYLLDLRDTWAQAAKLA..................................... 121
390 7.000e-48gi|655111622|ref|WP_028559285.1| flagellar export chaperone FliS [Paenibacillus pinihumi]  clstr ali  22  3.TSPYDKYRQSSVQTSTPGQLLLMLYDGAIRFVRGGIEAITGQDYQKANTLLGKAQAIISELRITLDYSYEISQQLSSLYEYMNHLLIDANVKKQTAPAEEALGYLLDLRESWAQAAKAA..................................... 121
391 7.000e-48gi|490159443|ref|WP_004058108.1| flagellar export chaperone FliS [Eubacterium plexicaudatum]  clstr ali  19  4.NSGYAAYAKNKVTTASKGELTLMLYDGAIKFCNMAIVAIKEHDIQKAHTNIIKVERIIEEFQSTLNFKYPVAKDFNNVYQYLQETLRNANIKKDEKMLEEVLKHLRTMRDTWKEVMRKNAS................................... 124
392 8.000e-48gi|736626021|ref|WP_034634099.1| flagellar protein FliS [Bacillus okhensis]  clstr ali  16  5MYNA-NAYKQNAMKTASPGELTLMLYNGCLKFINQAKKAIEAGNVEQRNTSITKAQNIIRELMVTLKTDSEVGQNMMRMYDFIMSQLVDANVKNDVQALTNAEELVTEFRNTWKEVIQLDRQQRHGAGT............................ 132
393 8.000e-48gi|921221741|ref|WP_053166741.1| flagellar protein FliS [Planomicrobium glaciei]  clstr ali  20  5..NPYQAYQQNSVMTASPQELTLMLYNGCLKFMKLSKRAMEDKKYEDKNTNMIKAQAIIQELRYTLDPAIELSAGLGQLYDYIYGRLVEANMKNDLMILEEVENLVKELRDTWKLAMDQLKNK.................................. 125
394 8.000e-48gi|510895194|ref|WP_016228327.1| flagellar export chaperone FliS [Lachnospiraceae bacterium 10-1]  clstr ali  17  5..NAFAQYNNNKIMTASPAELTLMLYEGAIKFCNIAIDAAEQKNVMKAHSNIVKVENIIAYLRNTLDMQYAVAKEYDRMYDYLQRRLFQANMKKDVEILKEVNTHLRSIRDTWKEVMRINRGK.................................. 125
395 8.000e-48gi|503041372|ref|WP_013276348.1| flagellar export chaperone FliS [Thermosediminibacter oceani]  clstr ali  19  1MINAYQQYQQNYILSAPPEKLVVMLCEGALKFARLAKKAIEEKNYAEANNYLIRTQDIIMELNASLDMEYEISKNLRSLYNFIYQRLIEANLKKDGGVVEEIEPLLEDLKDTWQRVY........................................ 117
399 1.000e-47gi|545666077|ref|WP_021772468.1| flagellar export chaperone FliS [Mitsuokella sp. oral taxon 131]  clstr ali  18  3.NSAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGTAAVAEKKWEQANIALQKAQNIISEFRITLNMEYDISKQLMPLYNYAYDRLVEGNMKSSVEKIQEARDIISELRDAWAQAMKKARQDQGTRNVQ........................... 131
400 1.000e-47gi|852227234|ref|WP_048311271.1| flagellar protein FliS [Anaerobacillus macyae]  clstr ali  20  3MKNPYQTYQQNAVTTSSPQELTLMLYNGCIKFIRLSAIAMEKKNIEAKNTNIIKAQNILQELRSSLNMDIALSESMDSLYEYMISQLVSANITNDASKLKEVEELAEEFRNTWKTAMEQMK.................................... 123
401 1.000e-47gi|504784103|ref|WP_014971205.1| flagellar export chaperone FliS [Exiguobacterium antarcticum]  clstr ali  22  1MANPYATYQTNSVTTALPQDLTLMLYEGLIKFSMLAKRAIEQGLIEQKNTNIQKAQAIILELQLTLNQSIALSKELNNLYDYMQGRLIDANVKNDVVAIDEVIGFAEEFRETWKEAMKLARQ................................... 122
402 1.000e-47gi|1011128332|ref|WP_062050189.1| flagellar protein FliS [Bacillus sp. JCM 19034]  clstr ali  17  3.TNLQNAYKQNSLKTASPGELTLMLYNGCLKFIKQTKQAIEAGEIEQRNTANMKAQNIIRELMVTLKVDSEVGQNMLTMYDFILNRLVEANIKNDVQMLLEAEEMVTSMRDTWKEAIQLDRKQRHGSGA............................ 130
403 1.000e-47gi|737757405|ref|WP_035725959.1| flagellar export chaperone FliS [Gracilibacillus boraciitolerans]  clstr ali  18  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQANKAIEDKDYETKNEMIKKTQNIVRELMITLDQEAAITKEIMPLYDFVNHALMQANIKNNVDQLEQARAIIQDFRDTWKEVIKQER---IRQHGQGVKA....................... 132
404 1.000e-47gi|517807567|ref|WP_018977775.1| flagellar export chaperone FliS [Saccharibacillus kuerlensis]  clstr ali  19  4..SPYQKYQQTQAQTASKPKLLIMLYDGAIRFVKAGIDGISEKNYEAANNNLCKAQAIVHELVSSLNFDYAIADELVRLYEYMLRRLIEANVKKDAAPAEEVLEHLSDLREAWVEASKIS..................................... 121
406 1.000e-47gi|517532060|ref|WP_018702268.1| flagellar export chaperone FliS [Anaeromusa acidaminophila]  clstr ali  16  3MMNPAAAYRNQQIMTASPEQLTLMLYDGAIRFLRASITAIEAKEMEKAHEMNMRTQEIIREFRQTLNMDIELSENWDKLYEFMEYRLMEGNVKKDKAMLQEVLDLLKEMRDTWAEAMKLAK.................................... 123
407 1.000e-47gi|406980427|gb|EKE02025.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  23  1MNPYLKQYQQTEVQTASPEKLLIMLYDGAIQFLNKAKTGIANKNIEEIHNNIIGAQKIISEFMNTLDMEVEVAQNLYNLYEYLHYRLVQANIKKDNDMVDEVLTHLKDLKQTWEEAIRIAAREKSM............................... 128
408 1.000e-47gi|312180985|gb|ADQ41155.1| flagellar protein FliS [Caldicellulosiruptor kristjanssonii I77R1B]  clstr ali  17  27...AAARYQEEVIMTKPPEELTLMLYDGCIRFIKLAMQAIDEKKLDKANENIIKAENIITELMSTLDMSYEISKNLMSLYDFVYRWLIQANLKKDKKYLEEALEIVQDLRNTWAEAIKIARQQ.................................. 146
409 2.000e-47gi|499958959|ref|WP_011639693.1| flagellar export chaperone FliS [Syntrophomonas wolfei]  clstr ali  23  6..QAYNQYKKSVVETVAPEKLLLMLYDAAIKNINNAKKAIKEKDINRAHEQIMRTEEIIVELMSTLNMEYEISGRLFALYEYFYHRLTQANAQKDIVILDEVEGFLLELRGTWQEAINALKTAPSQDN............................. 131
410 2.000e-47gi|754818735|ref|WP_042181257.1| flagellar export chaperone FliS [Paenibacillus sp. FSL R7-0331]  clstr ali  19  3.TSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFVKMALDGLSKQEYEKSNLNFGKAQSIISELMGTLDHSYEVSKGLFSLYEYTNHLLIEANIHRNPEKAHEALGYLGELRETWLQASKLPNAQ.................................. 124
411 2.000e-47gi|500959444|ref|WP_012033250.1| flagellar export chaperone FliS [Pelotomaculum thermopropionicum]  clstr ali  18  6....YSQYSLNAVMTASPGELTLMLFNGAVRFIRQGLNFAEEKNIEGAHNAIIRAQEIIQHLNGTLNMDYEVSKNLAMLYDYIVRRLTEANIKKDGQILKEALDLVEDLRNTWAEALKLA..................................... 121
412 2.000e-47gi|652370461|ref|WP_026766474.1| flagellar export chaperone FliS [Selenomonas ruminantium]  clstr ali  20  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMNEGKEAVEAKQYEQANTSLQKAQQIISEFRVTLNMDYEISHQLLPLYNYTYRCLVDGNMQSNPALIQEAIDIIRELRDAWAQAMKKARQDNSLQNAQ........................... 132
413 2.000e-47gi|950267104|ref|WP_057303291.1| flagellar protein FliS [Paenibacillus sp. Root444D2]  clstr ali  22  1MLHAQNQYLNTRVQTSSPGELTLMLYNGCILFIKQGITCLEKQDFAGKHTNFSKAQNIIEELQSTLNMEYEISHNLNSLYAFLQSKLFEANVKLDSESAQYCVTMFTELRDTWNEALKNLKSG---EKVQKV......................... 129
414 2.000e-47gi|544869518|ref|WP_021282973.1| flagellar protein FliS [Clostridium sp. BL8]  clstr ali  19  5.NNGYNAYKNNSINFASKEQLFLMLLDGAVKFSKIARQAIEDKEIIKAHENIIKTQNIFYELMVTLDTSSPWLKDLFNIYDFITRRLIDANVKKDVKIIDEIIPLIEDIRDTWNEAYRLSKSG.................................. 128
415 2.000e-47JGI.Meta 7072814211 C2773271__gene_106554 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 1 of subject 63875  ali  18  3.NNPYNKIKNSSIMTASPAELTLMLYEGAIKFGNQAVAAIKAKDVSEAHRLIVRVQDIIDELRGTLNFDFPIAEQMDRMYEFISFTLVEANMEKSAEKVETALTFIREFRDTWKEAMGLAKK................................... 123
416 2.000e-47gi|737313012|ref|WP_035295863.1| flagellar export chaperone FliS [Brevibacillus thermoruber]  clstr ali  19  4..NAAQTYQSNQVTTATPAELTLMLYNGAIKFIKQAKNAIHANEVAKAHEYCLKVQSILYELIATLNTEVPISQDFEKMYDYMLRRMIEANMRKDVAILTEVEDFFVQFRDTWKEAMVLAKN................................... 123
417 3.000e-47gi|738803651|ref|WP_036694680.1| flagellar export chaperone FliS [Paenibacillus sp. FSL R7-269]  clstr ali  24  4..SPYDKYRQSSVQTSTPAQLVMMLYDGAIRFAKTAIEGLNKQDLEKSNLNFGKAQTILSELMSTLDFKYEVSKNLYSLYEYTNHLLVEANIHKSVDKAQEAIGYLVDLRETWLQASKLAASQTEIANG............................ 130
418 3.000e-47gi|503077362|ref|WP_013312277.1| flagellar export chaperone FliS [Paenibacillus polymyxa]  clstr ali  17  3.NTPYQKYRQTQAQTASKPKLLIMLYDGAIRFVRAGIEGIENKDNEKANNNLCKAQAIVHELISALNFEYPISHDLLRIYEYMLHELIEANIHKIAAPAQEVLEHLTDLREAWLEAMKM...................................... 120
419 3.000e-47gi|518757464|ref|WP_019915067.1| flagellar export chaperone FliS [Paenibacillus sp. HW567]  clstr ali  20  2LTSPYEKYRQSSVQTSTPAQLLIMLYDGAIRFARAGIDGLNKQDYEKTNLNLGKAQTIVSELMSTLDQSYEISKGLYSLYEYMNFLLVEANIRKSVDKAEEAVGYLTELRETWLQASKLAASQTEIANG............................ 130
422 3.000e-47JGI.Meta 7051999134 SRS047014_WUGC_scaffold_71662__gene_111195 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  36  3..KEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCRDSLAAAMYKRSLTEIETAEKMLRKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQ......... 148
423 3.000e-47gi|737363204|ref|WP_035345387.1| flagellar protein FliS [Bacillus hemicellulosilyticus]  clstr ali  15  3.TQLQSVYKKNSMQTASPGELTLMLYNGCLKFIKQANKAIEENNVEARSHSIQRAQDIIRELMVTLKMDSEASENMMRLYDFILNRLIEANVKNDVKALHDAEELVIQFRDMWKEVIQLDRKERHGEGGKA.......................... 132
424 3.000e-47gi|939701678|ref|WP_054937817.1| flagellar protein FliS [Moorella glycerini]  clstr ali  22  4.NNPYQAYQQNQVQTLSQEKLVLMLYDGALRFCRQGLAAMEKKDYAGVSNNLGRVQDILSELMVTLNRDVEIAENLYKLYDFMYRHLVQANVKKSATMINEVIDLLQQLRDTWEEATRI...................................... 122
425 3.000e-47gi|780811072|gb|KJS15916.1| flagellar biosynthesis protein FliS [Peptococcaceae bacterium BRH_c4b]  clstr ali  17  5..NPYQQYKANSINSASPGELTLMLFNGVIKFIKAAIAAVEEKTYEKVNENLISAQDIISYLSSTLNMNYEIAKNLSSLYDFMYSHLVTANIKKDGAAMKEVAELIEGLRDAWAEMLKQNNNQ.................................. 125
426 3.000e-47gi|973033183|gb|KUK11645.1| Flagellar biosynthesis protein FliS [Clostridia bacterium 41_269]  clstr ali  25  14.NNSYRAYMQSQVMTAPKEKLVIMMYDGILRFARGAKEACLRNDIEEANRNLIKAQSIVGELMGSLNFEADIAKSLFLLYDYMHRRLIEANVKKDPEIIEEVCGMAAELKEAWQQSLKALKEAP................................. 137
427 3.000e-47gi|652439969|ref|WP_026835008.1| flagellar export chaperone FliS [Eubacterium xylanophilum]  clstr ali  18  3.TNMADSYKTNAILTASPAELTLMLYDGAIKFCNIALIALEKNDYGKCNENLKRAQDIILEFRITLDHKYPVWEDFDRVFEYIYNCLIDGNIHKDKEMIEEGLGRIREMRDTWKEVMQLNNQK.................................. 124
428 4.000e-47gi|939706252|ref|WP_054942257.1| flagellar export chaperone FliS [Paenibacillus sp. GD6]  clstr ali  19  3.KSPYEKYRQSAVQTSTPAQLVLMLYDGAIRFVRAGMDGLEKNDYEKANTNLGKAQTIISELMSTLNYSYDVSNNLFTMYEYTNFLLVEANIRKDKTKAEEALGYLTEIRETWLQASKIAAGQS................................. 125
429 4.000e-47gi|754776167|ref|WP_042140223.1| flagellar export chaperone FliS [Paenibacillus sp. FSL P4-0081]  clstr ali  19  3.KSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFVKTALDGMSKQDLEKSNLNFGKAQTIISELMSTLDHSIEVSKGLYSLYEYTNYLLIEANIHKNPAKAEEALGYLTDLRETWLQASKLAATQTEIANG............................ 130
431 5.000e-47gi|780918002|gb|KJS85397.1| hypothetical protein JM58_08780 [Peptococcaceae bacterium BICA1-8]  clstr ali  17  5.QNPYAQYKQQAVTTAGPEKLLIMLFDGAIRFAGQARKTIEDKDIEKSNYHLIRCQDIIFELISSLNMDFEISHSLLPMYEYINYNLQQANIHKDLKYLDEAESYLREFREIWIQTAKLAKSPQPNQSG............................ 132
435 6.000e-47gi|749691324|ref|WP_040287076.1| flagellar export chaperone FliS [Sporosarcina koreensis]  clstr ali  22  3MHNPYATYQNNTVTTSSPGELTLMLYNGCLKFIQQAKQAVVSGTIEEKNTAVQKAQAIISELMITLDVKAPAGKEMLVLYEFANSRLIDGNIKNDIALFEEASEIITEFRDTWKQVIQLNRQKQYGNVSE........................... 133
437 6.000e-47gi|493881808|ref|WP_006828066.1| flagellar protein FliS [Planococcus antarcticus]  clstr ali  15  5..NPYQTYQQNSVMTASPQELTLMLYSGSVKFIKIAKRAMNDKNFQEKNTNIIKAQNIILELRSTLNSDIDMSTGLEQMYEYMYSRLLEANMKNDLEALEEVETLMTDMRNTWKQAMALARK................................... 124
438 6.000e-47gi|938911049|ref|WP_054693897.1| hypothetical protein [Syntrophomonas palmitatica]  clstr ali  20  1MNQAYDQYRKTSVESASPGRLLLMLFEGAIRFVDNAKRSIDEKDIESAHNNIIKAQNIMLQLMSSLNMEYEISNQLFNLYEYIYYQLMMANTKKDLAILAEVRELLSDFQKTWDEAIKKAGSSKSV-----VESGMTEG.................. 135
439 6.000e-47gi|654780187|ref|WP_028234322.1| flagellar export chaperone FliS [Pseudobutyrivibrio sp. MD2005]  clstr ali  18  1MTNGYDAYAKNRILTASPAELTLMLYEGAIKFCNIAIVACENRDIEKAHINIRKTDRIIEEFELTLDEKYEVAKDFHAVYSYLRSCLRHAMIDKNPETLQEVLKHLRTMRDAWKDVMKLTANGKNLNSRQTTIAG...................... 137
440 6.000e-47gi|500208514|ref|WP_011878723.1| flagellar export chaperone FliS [Desulfotomaculum reducens]  clstr ali  16  4.KNPYSNYQQNAIMSAGPEELTTMLYNRLVKDLKLAQGHIEQKEIQLAHNNITHAQDILDHLMNTLDTSVEVGKNLELMYDYMSRRLVEGNLKKDKEILQEVAGFAEEIRDTWVQAVKQVKTG.................................. 125
442 7.000e-47gi|928930956|ref|WP_053955795.1| flagellar export chaperone FliS [Clostridiaceae bacterium mt12]  clstr ali  18  3MRNPYQQYKQNTVNTAPPEELTLMLYNGAVKFMNQAILYIDQKNIQKSHEVIIRASDILIELNATLDMKYDISKGLRPIYDFLIDQLAQANLKKDKKVIEDILPIVNDLRDTWKQAIELAKKK.................................. 129
444 7.000e-47gi|647225793|ref|WP_025678749.1| flagellar export chaperone FliS [Paenibacillus massiliensis]  clstr ali  19  3.NSPYEKYQQTQAQTASKPKLLIMLYDGAIRFVQAGIEGVEQRNFELVNRNLVKAQAIIHELISSLDFNYPVAHNLVAVYEYMIRRLIEANIQKKTEPAVEVLEHLKELREAWVEASK....................................... 119
446 8.000e-47gi|516336231|ref|WP_017726264.1| flagellar protein FliS [Bacillus ligniniphilus]  clstr ali  16  5..NMQTAYKQNAMKTASPAELTLMLYNGCLKFMKQAKQAIEEKNVEHRNLYTNKAQDIIRELMVTLKTDSEVGKNMLRLYDFALDRLIEANVKSDLKALEDAEDIMVQFRDTWKEAMQLDRQQRHGAGGQA.......................... 133
447 9.000e-47gi|495862450|ref|WP_008587029.1| flagellar export chaperone FliS [Salimicrobium jeotgali]  clstr ali  21  4.....QAYENNTVETASQGELVLKLYNGCIKFIKASGKAMENNDIEKKNLNIQKAQRIVQELIITTDPSYDISQQILPLYEYMNRRLLEANTKNDREILDEVRGLAEEFRDTWKEVLIQTRKAEYSKGG............................ 127
448 9.000e-47gi|1015840310|ref|WP_062837015.1| flagellar protein FliS [Paenibacillus amylolyticus]  clstr ali  21  4..SPYEKYKQSSVQTSTPGQLVIMLYDGAIRFTKTGLEGIEARDYSKANVNLGKAQTIISELMSTLNQSYPVAKTLFSLYEYMNYLLIQANIKKETKYGEEVLGYMQELRETWVVASKQVT.................................... 122
449 1.000e-46gi|738759215|ref|WP_036652635.1| flagellar export chaperone FliS [Paenibacillus wynnii]  clstr ali  20  3.TSPYEKYRQSSIQTSTPAQLVIMLYDGAIRFVRTGLDGLKQQDVEKTNLNFGKAQAIVSELMSTLDQSYEISKSLSSLYEYTNFLLIEANIRKNPEKAEEAIGYLTDLRETWLQASKLASGQTQAEGA............................ 130
452 1.000e-46gi|1011370095|ref|WP_062282952.1| flagellar export chaperone FliS [Moorella mulderi]  clstr ali  19  4.NNPYQAYRQQQVFTLSQEKLVLMLYDGALRFCRLGVSCLEKKDYAGVNNNLLRAQDIIKELMITLNHDAEIASNLHRLYDFMLWHLIQANLKKDAKMINDVIDILQHLRDAWEEAARIYRT................................... 125
453 1.000e-46gi|550548983|ref|WP_022629127.1| flagellar protein FliS [Bacillus marmarensis]  clstr ali  15  6....QSAYKQNAMKTASPGELTLMLYNGCLKFIKQTRLAMEENDLEKRNLNSTKAQNIIRELMVTLKTDNEVGQNMMRMYDFILNRLIEANVKNDANALTEAEGLVVEFRDTWKEVIQLDRKQRHGAGGKA.......................... 132
454 1.000e-46gi|749559525|ref|WP_040191246.1| flagellar protein FliS [Clostridium sp. CL-6]  clstr ali  25  5..NPYIAYKQNTINMASKEQLLLMLVDGAVKYTKIAKMAIEKRDIQAAHKELTRVQDIFTELMSTLDMNAETAENLFNLYDFIKRQLVQANMKKDVQIIDETLPLIEEVRDMWYEVSKKAK.................................... 124
456 2.000e-46gi|1015558748|gb|KYZ76502.1| flagellar protein FliS [Anaerosporomusa subterraneum]  clstr ali  19  1MNNMANAYKNQQIMTASPEELTLMLYNGAIRFTSESILALEQGDISKSHAANVRAQDIVREFMITLDMKIELSKNWMSLYDYIEYNLVQGNVKKDKTMLENAKGILSDMRDTWVEAMKQARQQRLQ............................... 128
457 2.000e-46gi|639453596|ref|WP_024631602.1| MULTISPECIES: flagellar export chaperone FliS [Paenibacillus]  clstr ali  19  3.TSPYEKYKQSSVQTSTPGQLVIMLYDGAIRFVKVGLEGISSKDYMKANVNLGKAQTIISELMSTLDHSYPVSKNLFSMYEYMNHLLIQSNIKKVTQPAEEALNYLQELRETWIVANKQ...................................... 120
458 2.000e-46gi|490766306|ref|WP_004628540.1| flagellar export chaperone FliS [[Clostridium] termitidis]  clstr ali  20  4.NSGYDQYVSNSINTATPEELTLMLYNGLVKFIMQAQSAAIVRDLEKANEAMKRAQAILVEFRSTLNMNYEVSKYLESIYEYMHRQLLQANIKKDKDILEEVLGYAKDLRDTWTKAMKLAKQQ.................................. 125
459 2.000e-46gi|495688434|ref|WP_008413013.1| flagellar export chaperone FliS [Desulfotomaculum hydrothermale]  clstr ali  18  4.KDPYKSYQQNAVLSAAPEELTTMLYQRLVKDLKLARESVEKKDIEAAHRCITHAQDIIAHLLDTLDTSYEVGQNLQLMYDYMNRRLVEANIKKDPEILREIAGYAAELRDTWVQAVKQVKTG.................................. 125
460 2.000e-46gi|1007492516|gb|KYH34803.1| flagellar protein FliS [Clostridium tepidiprofundi DSM 19306]  clstr ali  19  7..NAYNVYKNNSVNYASKEQLLLMLVDGAVKFSKIARQAIVDKDIPKAHNNITRTQDIFYELMASLNVEAEWGQQLMSIYDFIVRRLTDANIKKDLKVIDEVIPLIEEIRDMWYEAEKLSKNK.................................. 129
462 2.000e-46gi|849069289|ref|WP_047987150.1| flagellar protein FliS [Bacillus pseudalcaliphilus]  clstr ali  19  3MRNPYQTYQNNKVETSSPAELTLMLYNGALKFSGLAKKAMNDGHIAESNTNILKVQNIVRELMVTLKVDTELGKNMLALYDYTLNLLIEANMEKDITKLDSATDMITQFRDTWKEALQIDRKQ.................................. 125
463 2.000e-46gi|916592413|ref|WP_051199504.1| flagellar export chaperone FliS [Butyrivibrio fibrisolvens]  clstr ali  21  6..NPYAQYANNKVLSASGPELTLMLYEGAIKFCNRAENACEKKDIEGTHNNIRKVQNIIAYLRETLNMKYATAQDFENIYSYLDRRLVEANVSKDIEILKEVNKHLHSVRDTWIGVMKANNVPSYMNHSDAV......................... 138
464 2.000e-46gi|748291025|ref|WP_039832683.1| flagellar export chaperone FliS [Paenibacillus sonchi]  clstr ali  18  3.TSPYQKYQQTQLQTASPAQLLLMLYDGAIRFIRMGTSGIDEKNYEKANTNLCKAQAVINELIAALNHDYPVSKSLYQVYEYMIFQLIQSNLKKDKKPATEVLEYLMELREAWYEASKSMNSTAEQAQ............................. 129
466 2.000e-46gi|1011515726|ref|WP_062410130.1| flagellar protein FliS [Paenibacillus naphthalenovorans]  clstr ali  17  8.....NKYLEASVHTATPAQLLILLCDGAIRFCRAAIEAIKQNKYDEANSNLCRAQDIISEFMITLDPQSPISDNLMKLYEYFNYRLIQANTKKNIEPAEEVLGYLIELKETWFQASKLVHQGSA--------AGVTHG.................. 133
470 2.000e-46gi|489428699|ref|WP_003334320.1| flagellar export chaperone FliS [Brevibacillus laterosporus]  clstr ali  20  1MNQAAQIYQQNQVKTASPGELTLMLYNGGIRFSKEAKIALEKQDVQKAHQSIIKVQDIIRELMVTLDQNVAISEQFMLMYDYMYNRTIEANLKKDGAIITEVEEFFVQFRDTWKQAILIARRQP................................. 125
471 3.000e-46gi|496185442|ref|WP_008909949.1| flagellar export chaperone FliS [Caloramator australicus]  clstr ali  21  1MNNALNAYQQNSIFTASKEKLLLMLYDGLVKFIKLAIVGIEEKDIKKAHENFIKAQNIILEFMATLNMEVEIAKSLMLLYDYMYRRLVEANTKKDKAIAEEVLGFAEELKETFEEAYRRLKK................................... 126
473 3.000e-46gi|928958643|ref|WP_053983208.1| flagellar export chaperone FliS [Lachnospiraceae bacterium mt14]  clstr ali  20  3.TNPYQQYQNNSIMTASPGELTLMLYNGAIKFCNLTLEAMEQKDVQKANQSNLRVQDIITELQATLDTKYEVGQEMDRLYTFIRQLLIEGNIQKNPQKVIDARELIREYRDTWQQVIKMAK.................................... 122
474 3.000e-46gi|737691779|ref|WP_035660804.1| flagellar protein FliS [Bacillus akibai]  clstr ali  15  4.NNPQQAYQQNKAVTSSPGELTLMLYNGCLKFINVAKKSIEENNIATRHENLVKAQNIIRELMVTLKTDTKLGKDMLALYDFILSRLTDANTENSMEKLSEAEEMVKDFRDTWKEALQIDRKKRHQ............................... 128
475 3.000e-46gi|494375362|ref|WP_007200458.1| flagellar export chaperone FliS [Fictibacillus macauensis]  clstr ali  19  4.QNPNLLYQNNAVATASPGDLIVMLYNGCLKFITTAKQAIINHDIPLKNTMIQKAQKIIQELMVTLNPEVMLSESLLSLYDYMHRRLIQANIETNIRYLEEVESYLVDLRDTWKEVVRM...................................... 121
476 3.000e-46gi|972425993|ref|WP_059041708.1| flagellar protein FliS [Paenibacillus sp. MT18]  clstr ali  21  3.NSPYQKYQQTQLQTAPPAQLLLMLYDGAIRFVRTGISGIDEKNYEKTNTNLCKAQAVIHELIAALNFDYPIAKNLSQIYEYMLHQLIVANLKKNTTPANEVLSYLLELREAWDTAAK....................................... 119
477 3.000e-46gi|517579769|ref|WP_018749977.1| flagellar export chaperone FliS [Paenibacillus sanguinis]  clstr ali  18  3.TSPYEKYKQSSVQTSTPAQLLIMLYDGAIRFTRGAMEAIHAEDYQKKNELIGKAQAIVSELRASLNHSYEIAAQLDKMYEYINYLLIEANIRKEATRAEEALGYLLELKESWVQASKEVAGGQANANG............................ 130
478 3.000e-46gi|738705927|ref|WP_036604482.1| flagellar export chaperone FliS [Paenibacillus sophorae]  clstr ali  22  3.TSPYEKYRQSSVQTSNPAQLVIMLYDGAIRFVRTGLDALKKQDYEKTSLNFGKAQTIVSELMSTLDFTYEISKNLYSLYEYTNHLLIEANIRKNEEKANEAIGYLTELRETWLQASKLSGNQ.................................. 124
479 3.000e-46JGI.Meta 7055223932 C3669430__gene_208949 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 765013792] :  ali  19  25MTNAASLYQGASINTATPAELTLMLYNGAIKFCNQAMAGIEEKNVEKANNNLIKAQNIIWELQGTLDFKYKVAKDFDIIYQRILRNLLMANIRKDADKLNEALEDIRGMRDVWVEVMKAAKN................................... 146
480 3.000e-46gi|833815357|gb|KLU40156.1| hypothetical protein AA931_00485 [Peptococcaceae bacterium 1109]  clstr ali  22  4..NAYQVYRQTQVNTASQGELILMLFDGAIRFANQAQELIAEGDLEGANGKLIRAQDIMTELMVSLDMDQEIAQNLYQLYDYIHDCLLRANIRKDVGLIEQAVRLLAELRDTWRQVVAKS..................................... 122
482 4.000e-46gi|655103249|ref|WP_028551012.1| flagellar export chaperone FliS [Paenibacillus sp. UNC451MF]  clstr ali  18  3.QTPFNKYRETSIQTMTPGQLLIMLYDGAIRFARKGVEGVKQKNYQEANNCFIRVQEIINELVASLDHSYPISKDLLQLYDYFLRKMVEANIKKDIQPALEVIDHLVELKETWIQASKLSTS................................... 123
483 4.000e-46gi|930606466|ref|WP_054258633.1| flagellar export chaperone FliS [Propionispora sp. Iso2/2]  clstr ali  18  5..NSAATYKMQQVMTASPEELTLMLYNGAIRFVTESMLALEARDFEKSHNTNIKTQKIVREFMATLDMDYEISHNWMQLYDYIEYCLVQGNLKKDAGKLKEAKDMLVQLRDTWYQAMKKAREEKAMMKS............................ 131
485 4.000e-46JGI.Meta 7031886519 SRS056259_LANL_scaffold_55701__gene_126069 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  29  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDACESDSAKQ---AHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQVVYSGLTYSRGGINETQTDN....... 148
486 4.000e-46gi|843082882|ref|WP_047912359.1| flagellar export chaperone FliS [Paenibacillus sp. TCA20]  clstr ali  22  4..SPYEKYRQSSVQTSNPAQLVIMLYDGAIRFVRASMKGLEEKDLEQVNTNLGKAQTIISELMSTLNQDFEVSKSLYSLYEYMNHLLVQANIKKSLEPAQEALDMLTDLRDTWLTASKL------------VMTGSTY................... 127
487 5.000e-46gi|917666386|ref|WP_052220223.1| flagellar protein FliS [Clostridium homopropionicum]  clstr ali  21  1MNNAYSAYKNNSINYASKEQLLLMLLDGAVKYAKIAKQAMIDKDIQKAHDNIRKTQDIFYELMITLDVNQEWGQQLMSIYEFTVRRLGDANIRKDVHIIDEVLPLIEDLRDTWEQAYKISK.................................... 125
488 5.000e-46gi|972377957|ref|WP_059031423.1| flagellar export chaperone FliS [Tepidanaerobacter syntrophicus]  clstr ali  17  5..NGYQQYRYNSIMSASPERLMIMLFEGAIKFVRLAKKAVDEKDIESANYNIARAEDIIAELEASLDMSYEVSEDLVKIYDFLYRQLIEANIKKDVNILDTVESMLTDLKDTWSEA......................................... 118
489 5.000e-46gi|754807009|ref|WP_042170063.1| flagellar export chaperone FliS [Paenibacillus sp. G1]  clstr ali  15  2LNSPYQVYQQSSVQTATGGKLIVMLFEGAIRFTKAGIEGIHERNFEKGNTNLKKAQAIINELIASLDFQYEISNELFRIYEYMVFQLIQSNLKKNAKLAEEVLEHLQGLLETWRQVVKT...................................... 120
490 5.000e-46gi|517491150|ref|WP_018661727.1| flagellar protein FliS [Thermobrachium celere]  clstr ali  20  5..SALNIYQQNSVNTASKEKLLLMLYDGLVKFIRQAITSLEEKDLQKAHTNLIKAQNIILEFMSTLNMEVEIAKSLMALYDYMYRRLVEANIKKDAKIAEEILGFAEELKETFEEAYKRIKK................................... 126
492 5.000e-46gi|492909592|ref|WP_006039998.1| flagellar export chaperone FliS [Paenibacillus curdlanolyticus]  clstr ali  18  1MLQAQANYANTQIQTASPGELTLLLYNGCIKFIKKALQSMENQNVHGKHENFIKAQNIIDELQSTLNMEYELSNGLFQLYTYIQEKLSFANVKMDRAAAEECIQLISELRDTWLEALKSLKRG.................................. 123
494 6.000e-46 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKTHNNIVKVENIIEEFQATLNHKYPVAEDFDKIYRYIYDLLIEANIKKDKELLERALDELRGMRDTWKEVMVKAK.................................... 126
495 6.000e-46gi|653056071|ref|WP_027307542.1| flagellar protein FliS [Caloramator sp. ALD01]  clstr ali  19  4.NNALNAYQQNSVFTASKEKLLLMLYEGLVRFIKQAISSLEEKDYQKAHTNLIKAQNIILEFMATLNMEVELSKSLMALYDYMYRRLVEANIKKDINIAKEILEFAEELKDAFEEAYKKIKK................................... 126
496 6.000e-46gi|1011418293|ref|WP_062329741.1| flagellar protein FliS [Paenibacillus pabuli]  clstr ali  16  3.NSPYQKYQQTQAQTASKPKLLIMLYDGAIRFVQAGIEGIKQKDYEVANRNLIKAQAIVHELISSLNYDYSISNNLVAVYEYMLHRLIESNVNKKTDPAEEVLEHLKELRDAWVEASK....................................... 119
497 6.000e-46gi|651418653|ref|WP_026521623.1| flagellar export chaperone FliS [Butyrivibrio sp. VCB2001]  clstr ali  23  11...AYAQYKSNKVMSASGPELTLMLYDGAIKFLNIASYAIENKDIQKSHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYSYIARRLVEANISKDKEIVDEINGHMHAIRDNWVEVMKANH.................................... 128
498 6.000e-46gi|568324364|ref|WP_024092917.1| flagellar export chaperone FliS [Paenibacillus larvae]  clstr ali  14  4..SPYQKYQQTKVQTASPAQLLLMLYDGAIRFVKLGIEGIQEHNMEKTNTNLCKAQSILHEMIASLNFNYEISNNLLRIYEYMLHQLIQSNVNKSAKPAEEVLSQLMELKEAWTEAGKQA..................................... 121
500 7.000e-46gi|1012044946|gb|KYO64100.1| Flagellar protein FliS [Thermovenabulum gondwanense]  clstr ali  19  1MINAYQQYQQNAILSSPPEKLVLMLYEGALKFLKLAKKSIEERNFVEANNNIIRVEDIVIELNMSLDMNYEISKNLRSLYNFIYEKLIQANIKKDARILEEVEGILIGLKEAWQEAY........................................ 117
501 7.000e-46gi|1008193400|ref|WP_061856971.1| flagellar export chaperone FliS [Clostridium colicanis]  clstr ali  20  5..NAYNTYKNNSINYASKEQLLLMLVDGAVKFAKIGRQAIIDKDIPKAHANIVKAQDIFYELMATLDVRQDWGNQLMSIYDFIVRRLTDANIKKDVNILDEVLPIIEDVRNTWHEAYKLSK.................................... 125
503 8.000e-46gi|506373825|ref|WP_015893544.1| flagellar export chaperone FliS [Brevibacillus brevis]  clstr ali  20  2LQNAAQTYQSNQVTTANPADLTLMLYNGALKFIKQAKVALEEKDVIKSHEASLKVQNILYELISTLKSDYEISKEFAKLYEYMLQRTIEANMHKDVNILLEVEDLFIQFRDTWKEAMLLAKKQ.................................. 124
504 8.000e-46gi|528199328|gb|EPY09490.1| flagellar protein FliS [Paenibacillus alvei A6-6i-x]  clstr ali  22  1MQQAMNRYYQTQIMTATPEELTLMLYNGCIRFLKQTEASMNNKNFSEKSTFVSKALDILDELQVTLDMKYEISSQLLSLYEYFKERLTYASIHMNTDVLREVITMMEELRDTWQEAIKLVKQ................................... 122
505 8.000e-46gi|808054986|ref|WP_046216409.1| flagellar export chaperone FliS [Paenibacillus wulumuqiensis]  clstr ali  21  3.KSPYQKYQQTQAQTASKPKLLIMLYDGAIRFVRAGIEGIEERDYGKANTNLCKAQAIVHELVSALNFDYPIANDLVTIYDYSLRLLIEANVKKDAAPAREVLEHLSELREAWVEASKM...................................... 120
506 8.000e-46gi|506218527|ref|WP_015738302.1| flagellar export chaperone FliS [Ammonifex degensii]  clstr ali  21  3...AANKYLEMAVSTAPPERLLLMLYDGAINFLSRAVEAIEARDFAEANRLIIRVEEIVTELKNSLDPQYEISQHLDRLYDYFLSRLFAANVAKDTEVLQEVQKHLRELRDTWAEVI........................................ 116
507 9.000e-46gi|524753973|emb|CDE53213.1| putative uncharacterized protein [Roseburia sp. CAG:303]  clstr ali  21  5..NAYKAYSNSKLMTASPAQLTLMLYDGAIKFTNIAIEAIENKNYEKANTYIQKTHRIIDEFRSTLNFKYPVAQEFENVYVMISEKLVYANMKKDVEVLQDVLKHLRSMRETWEEVMRLAK.................................... 123
508 9.000e-46gi|516426106|ref|WP_017815468.1| flagellar export chaperone FliS [Paenibacillus sp. A9]  clstr ali  21  4..SPYEKYRQNAVQT-SPGQLLIMLYDGAIRFTLAAIDGINQKDYAKSNTNFGKAQAIVSEFRASLDRSYDVAENLDRLYEYMGYLLIQANIKKDVASAEEALGYLKDLRETWVEANKLA..................................... 120
509 9.000e-46gi|921145705|dbj|BAS28791.1| flagellar biosynthesis protein FliS [Limnochorda pilosa]  clstr ali  21  11...GYQAYRRTQIETAPPEQLILMLYDGAIRFGRSARRAIEVGDRQKAHHDLTRAQDVISELIGSLDMAAEIAANLHELYRYLYQRLVQANVGKKVEPIDEVIHLVSELREGWYEGVVQGKGQPA................................ 134
511 9.000e-46gi|902975199|ref|WP_049693885.1| flagellar export chaperone FliS [Planococcus sp. L10.15]  clstr ali  17  5..NPYQTYQQNSVMTASPQELTLMLYNGSLKFMKMAKRAMNDKNFQDKNTNIIKAQNIVQELRSTLNSEMSMSAGLEQMYEYMYNRLIEANMKNDVTALEDVEALMTDMRNTWKQAMALAKS................................... 124
512 1.000e-45gi|545654748|ref|WP_021762209.1| flagellar protein FliS [Desulfovibrio gigas]  clstr ali  22  1MQKAATAYLQTSVGTTSQGEILLMLYEGAIKFLRQAQEKIKERDYAQKGILISKALDIISELECSLNMNKDIAGNLHRLYFFCQKRLLQANINMDVAMVEEVVTILSGLRSAYQEVIK....................................... 120
513 1.000e-45 GL0475776 unmapped_[Complete]_[mRNA]_locus=scaffold485658_1:2:382:-  ali  21  5..NPYNAYKQNSVKMASKQQLLLMLVDGAVKYTKIARLAIEKKDITRAHNELVRVQDIFTELMVTLDKSAQVYEDLYKVYEYIKSRLIEANIKKDVAIIDEVLPLIENVRDTWYEVSKKSK.................................... 124
514 1.000e-45gi|973242282|ref|WP_059103405.1| flagellar protein FliS [Bacillus shacheensis]  clstr ali  20  6....QAAYKQQSIQTASPGELTLMLYNGCLTQLKQAKRALEAKDIEARHLHIGKAETIIRELMVTLKQDAHIAGEMLRMYEYILHQLIEANVKQDEQALDEAILYVTEFRDTWKQVIQRDRQ................................... 123
516 1.000e-45gi|652965129|ref|WP_027218212.1| flagellar export chaperone FliS [Butyrivibrio fibrisolvens]  clstr ali  20  8.QNAYAQYKNNKILGASGPELTLMLYDGAIKFLNIADLAIEKKDIQKAHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYVYIARRLVEANVGKDREIIAELNGHMHAIRDTWIGVMKANN.................................... 127
518 1.000e-45gi|737306958|ref|WP_035289842.1| flagellar protein FliS [Clostridium sp. KNHs214]  clstr ali  19  7..NAYNAYKNNSVNFASKEQLLLMLVDGAVKFSKIARQAMVDKDIKKAHENIVKTQDIFYELMVTLDVNKEWAKNLMAVYQFIVDRLVQANLKKDVQIMNEVIPLIEEVKDMWDQAYKVSKGA.................................. 129
520 1.000e-45gi|523998678|emb|CCX81513.1| putative uncharacterized protein [Eubacterium sp. CAG:86]  clstr ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKVHNNIIKVENIIEEFQATLNHKYPVAEDFDKIYKYIYNLLVEANIKKDKELLEQALTELRGMRDTWKEVMVKAKQG.................................. 128
521 1.000e-45gi|738787231|ref|WP_036678499.1| MULTISPECIES: flagellar export chaperone FliS [Paenibacillus]  clstr ali  16  3.NSPYEKYRQSSVKTSTPSQLLIMLFDGAIRFVRAGMEGIDSVDYQKTNINLGKAQTIVSELMSTLDPTYDISKSLNDLYEYINHLLIQANVKKDKVPAEEALQYLTEFRVTWLEASKLV..................................... 121
522 1.000e-45gi|503423886|ref|WP_013658547.1| flagellar export chaperone FliS [Cellulosilyticum lentocellum]  clstr ali  17  6....YQKYQQNSVLTASPQELTLMLYNGAIKSCNQGIEAIEEGKIEKAHQYITKTQDIILELKCTLDDKYPISKNFEELYDYIMMLLVDANITKNGERLLEAKAFITDFRDLWKEAMKASKS................................... 123
523 1.000e-45gi|772286393|ref|WP_045244636.1| flagellar export chaperone FliS [Paenibacillus polymyxa]  clstr ali  19  3.NSPYQKYQQTQAQTASKPKLLIMLYDGAIRFVQAGIEGIEQRDYEKTNVNLCKAQAIVHELISALNFDYPLANDLVKIYEYMLHCLIQANIHKEAASAEEVMLHLKELREAWVEASKSVGAG.................................. 124
525 1.000e-45gi|928969199|ref|WP_053993636.1| flagellar export chaperone FliS [Lysinibacillus macroides]  clstr ali  21  13.........QNHVATASPGELTLMLYEGCLKFLHQARVAIQDENRQGKDANIQKAQAIIHELMTTLNMDYDMSKNMFALYEYMNHRLLEVHMQDDLVILEEVEGLIREFHDTWKKVI........................................ 120
526 2.000e-45JGI.Meta 7013606553 C4552524__gene_251735 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 675950834] :  ali  21  1MKKEYASYANQKVLGATPAELTLMLYDGAIKFCNIAESAIEKKEIEKVHQNLLRAERIIEYLRATLDMKYPIAQDFDNMYSYIYKRLVEVNVTKEVEILQEINGHLHAIRDTWVQVMEKNH.................................... 124
527 2.000e-45gi|906972780|ref|WP_049740948.1| flagellar export chaperone FliS [Brevibacillus reuszeri]  clstr ali  18  2LQNAAQTYQSNQVTTATPGELTLMLYNGALKFIKQAKIATEEKNVAKAHEASIKVQNILYELMSTLNNDIPLSKELVKMYDYMLHRMIEANIQKEITILTEVEEYFIQFRDTWKEAMILAKNQ.................................. 124
531 2.000e-45gi|808070181|ref|WP_046231376.1| flagellar export chaperone FliS [Paenibacillus algorifonticola]  clstr ali  14  2LNSPYQVYQQSSVQTATPGQLVIMLYEGAIRFTKGGIEGIKKQNYEMANTNLKKAQAVINELLASLNYDFEVSKNLSQIYEYLLHLLIEANLKKNDAFAQEALGYLQEFRDTWKQAMKASAGQ.................................. 124
532 2.000e-45 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  5.QQAYAKYGNNKVLTASPGELTLLLYEGAIKFCNIAIIGVEHNDIQKVHNNLKKAQAIIEELRSTLNHKYPVAKDFDKIYEYIYSLLVDANISKKTEDIEAALVEIRGMRDTWKQVMQKTK.................................... 124
533 2.000e-45gi|780897319|gb|KJS65392.1| flagellar biosynthesis protein FliS [Peptococcaceae bacterium BICA1-7]  clstr ali  20  5..NPYLQYQHNAVQSANPGDLVIMLFDGLIKYLKIAINAIEENDISNSNNALVRSQDIIDYLNNTLDMQFELSRNLSSLYDFMKGQLISANIKKETELVEEVLGLAAEMRDTWRQALQLAKTQ.................................. 125
534 2.000e-45 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  44...........KVLTASPAELTLLLYEGAIKFCNIAMMGLEEKNIQKTHDNIKKAQAIIEELQSTLNHSYKVAEDFDNVYHYIYSLLTDANIHKDKETLERALTEIRGMRDTWKEVMKKAKS................................... 154
535 2.000e-45gi|783149413|ref|WP_045669944.1| flagellar export chaperone FliS [Paenibacillus beijingensis]  clstr ali  18  3.QSPYQKYQQLSAQTATPIQLVLMLYDGAIRFTKQGISGIETKQYEHANEYLCKAESVIHELTAALDFNYPISKDLARIYEYLLYQLIQANIKKEARIATEVLGLLQELRDAWKQISKTA..................................... 121
536 3.000e-45JGI.Meta 7060367354 C3667938__gene_201283 hypothetical protein [Human Tongue dorsum microbiome from visit number 3 of subject 158883629]  ali  21  6..NAYETYANQKVMGATPAELTLMLYDGAIKYCNIAEAAIEKKDIERSHQNLVRVEKIIEYLRATLDMKYPVAQDFDHMYAYLYKRLVEVNISKDVEILQEINEHLHAIRETWVQVMEKNH.................................... 124
538 3.000e-45gi|831185596|gb|AKL93790.1| flagellar biosynthesis protein FliS [Clostridium aceticum]  clstr ali  17  73....ANNYLESKILTAPPENLTLMLYEGAIRFMNQAVIYISAKNNEKTNVAIQRAQDIFIELMSTLNQEIEMSKNLFSLYEFMNYRLVEANIEKDPEKLREVITMTKELRDTWEEAMKQYKA................................... 190
539 3.000e-45gi|503002646|ref|WP_013237622.1| flagellar protein FliS [Clostridium ljungdahlii]  clstr ali  22  5..NAYKTYKTNSVNYASKEQLLLMLVDGAVKFSKIGRQAIVDKDIKKAHENIIKAENIFNELIISLDVSKKWGQSLMSLYDFIVRRLIDANMKKDVKVIDEVIPLIEDVRNTWEEAYKISK.................................... 125
540 3.000e-45gi|825885975|ref|WP_047153536.1| flagellar export chaperone FliS [Aneurinibacillus tyrosinisolvens]  clstr ali  19  2..NAQQTYQQNSVNTATPAELTLMLYKGGVRFINAAKRALEEGNVQDSHKYNVKAQEIVSELIITLNTEYAISNNLLSMYDYMRIRLIEANVKKDVVILDEIKGYFEEFAITWAEAMKSVKK................................... 121
541 3.000e-45gi|970427091|ref|WP_058710900.1| flagellar protein FliS [Paenibacillus jamilae]  clstr ali  20  3.NSPYQKYQQAQLQTASPGQLLLMLYDGAIRFIRAGIKGIEEINHEKANTNLCKAQAVINELIAALNHDYPISATLYQVYEYMLHQLINANLKKNIIPAEEVISHLTELRGAWDTAIK....................................... 119
542 3.000e-45gi|647569458|ref|WP_025847754.1| flagellar export chaperone FliS [Paenibacillus ehimensis]  clstr ali  20  4.QQGQETYLRMQVTTAAPWELTLMLYNGCIKFMKQALDGIQKSDYEAKNMNIKKAIRIIDELIATLDKKYEISKNLDALYVFMKDKLFEANVKLNVEALQVSIELMTDLRDTWVKAMKSLKSPAKVQ.............................. 129
543 3.000e-45gi|502237255|ref|WP_012738512.1| flagellar export chaperone FliS [[Eubacterium] eligens]  clstr ali  17  5.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIEKQDYEKANINIKKAENIITEFKVTLNHKYPVAKDFENVYNYIYSLLVDANIKKDTEILNRALDEIRGMRDTWKEVMNRTRS................................... 125
546 4.000e-45gi|780908882|gb|KJS76639.1| flagellar biosynthesis protein FliS [Desulfotomaculum sp. BICA1-6]  clstr ali  16  5..NPYQKYQQNSVMSASPEELTQMLYSGGVRFIRQGIECIENKEVENAHKAIVKAQEIYTHLADTLNNEIELAKQLSSLYDFMLRQLMQANSQKDAALLMEVLALAEELRDTWQEAMQHARRQA................................. 126
547 4.000e-45gi|505066074|ref|WP_015253176.1| flagellar export chaperone FliS [Thermobacillus composti]  clstr ali  20  2LTTPHQIYQQSAVNTSNPLQLIIMLYDGAIKHVKLGIEGIETNDFQKANTHLVKAQSVINELISSLNFQYPIAELLLQIYDYLVRNLIEANVKKQKDPALEVLGHLSNLRDAWQQVAKRGSAAP................................. 125
548 4.000e-45gi|261286099|gb|ACX68070.1| flagellar protein FliS [Paenibacillus sp. Y412MC10]  clstr ali  21  7..QAQYNYLHTKIQTSSPGQLTLMLYTGCIKYLKLAVQSIEIHDMEGKHLNFVKAQNIIDELQSTLNMEYEISKQLYSLYTYINEKLFEANVKLDVKSAEDCIQLLTELRDTWAEALK------LISNGEQV......................... 130
549 4.000e-45gi|749572081|ref|WP_040201493.1| flagellar protein FliS [Geoalkalibacter subterraneus]  clstr ali  20  1MNAYLKNYQNTQVQTASPEQILIMLYDGAIRFLEQASEAMGSGDYAVKIKNIDKTLAIISELNATLDHEIEVAANLASLYDFMMREIPRANARNDATVLAPVISILRELREAWVEAAEIVRKERASQ.............................. 129
550 4.000e-45gi|515242254|ref|WP_016822930.1| flagellar export chaperone FliS [Paenibacillus polymyxa]  clstr ali  21  4..SPYEKYKQSSVQTSTPGQLIIMLYDGAIRFVRAGLDGISSNDIAKANINLVKAQSIISELMSTLNYSYDISKNLYALYEYMNYLLIQTNIKKKIESGEEVLGYLQELRETWITVNKLT..................................... 121
551 4.000e-45gi|493568815|ref|WP_006522096.1| flagellar export chaperone FliS [Desulfotomaculum gibsoniae]  clstr ali  14  3LNNPYQRYQQNSVSSAPPQELTNMLYSGGVRFIRQAMQSIEENEMEKAHQELVRAQEIYKHLQDTLNMDIKISNNLYNLYDFMIRQLLQANIKKDIAILHEILGLAEELRNTWKEAMVKARGQ.................................. 125
552 4.000e-45gi|808066454|ref|WP_046227679.1| flagellar export chaperone FliS [Paenibacillus dauci]  clstr ali  20  4..SPYEKYRQNAVQT-SPGQLLIMLYDGAIRFILAAIDGVDQKDHIKSNTNFGKAQTIISELRATLNHSYEIAGSLEKLYEYMNYLLIQANIKKNVEPAEEVLGYLRDLRESWVEANKIA..................................... 120
553 4.000e-45gi|938960805|ref|WP_054739614.1| flagellar export chaperone FliS [Cellulosilyticum ruminicola]  clstr ali  16  4..NPYAKYQENSINTASGPELTLMLYNGAIKFCNIAVEAINNKNVAKAHENIIKVENIIMELRATLNKKYPIALEMDQIYEYIYEILVQGNIKKDPEKVEEACKLIRTYRDAWQIAMKSRR.................................... 122
554 5.000e-45gi|498182636|ref|WP_010496792.1| flagellar export chaperone FliS [Paenibacillus elgii]  clstr ali  21  1MNQQAQQYLRTQVSTAAPGELTLLLYNGCIKFMKQAHEALVTKNYNEKNVNLKKAQDIIDELMITLNMDYEISKNLKMLYVFIKEQLFEANFKLNVECLETSISLVTELRDTWVEALKILKNKA................................. 125
556 5.000e-45gi|506327557|ref|WP_015847292.1| flagellar export chaperone FliS [Paenibacillus sp. JDR-2]  clstr ali  17  1MQQPRNPYMQTSVQTANPAALLIMLYDGAIRFCRQGIEALKEQRNADAHTSLMKTQEIISEFIITLDRSNPVSESLLLLYDYFNHRLIEANTRKDAEPAEEVLGHLIDLKATWVEAAKQVNQMAGQANG............................ 130
558 5.000e-45gi|1020670680|gb|KZL94061.1| flagellar protein FliS [Clostridium magnum DSM 2767]  clstr ali  18  4.TNAYNAYKTNSVNYASKDQLLLMLVEGAVKFAKIGRQAILDKDVKRAHENIVKTQNIFYELMATLDVNKEWAKGLMSVYEFITRRLMDANIKKDVEIMNEVIPLIEDIKDTWEQAYKVAK.................................... 125
559 6.000e-45gi|524417856|emb|CDB66123.1| flagellar protein FliS [Eubacterium sp. CAG:248]  clstr ali  18  5.QNMAQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDMEKAHTNIVKAEMIIEEFQATLNHKYPVAEDFDKLYKYIYGLLVDANMKKDLELLEKATDELRGMRDTWKEVMKRA..................................... 123
561 6.000e-45gi|302394328|gb|ADL33233.1| flagellar protein FliS1 [Butyrivibrio proteoclasticus B316]  clstr ali  20  20.QRAYAQYKNNKVMSASGPELTLMLYDGAIKFLNIADFAIEKNDIYKAHENIVKTEKIIDYLRNTLDMKYAVAQDFENMYSYIARRLVEANIGKDREIIAEVNKHMHAIRDNWIEVMKANH.................................... 139
562 6.000e-45gi|737397635|ref|WP_035379050.1| flagellar protein FliS [Fervidicella metallireducens]  clstr ali  19  4.TNALNVYQQNSVNTASKEKLLIMLYDGLVRFIKQGIAGIEEKDINKSNTNLVKAQSIILEFMATLNLEIEMATSLMALYDYMHRRLIEANIKKDIEIAKEVLGFAEELKETFEEAYRITKKG.................................. 127
564 8.000e-45gi|939328084|ref|WP_054874817.1| flagellar export chaperone FliS [Oxobacter pfennigii]  clstr ali  20  7..NAYQVYRDNEVLMASRGKLLVMLYEGAMKFLRYAQLSIDDKNYEEANKYFQKTQDIISELMVTLNMDFEVSKGLYSLYDYMKYRLVQANIKKDKEMIDEVYKMLSELKETWEKAM........................................ 121
565 9.000e-45gi|315475238|gb|ADU31841.1| flagellar protein FliS [Bacillus cellulosilyticus DSM 2522]  clstr ali  17  5.NNPYANYKQKAAETKTPGELTLMLYEGCLKFIKQAGKAMDEENYQDKNTNLIKAQNIVKELMVTLKTDTEVAIGMLQMYDFILSRLTDANINNDVDALKEAEEFVVEFRDTWKQVIQIDRKQ.................................. 126
566 1.000e-44gi|544740288|ref|WP_021169185.1| MULTISPECIES: flagellar export chaperone FliS [Sporomusa]  clstr ali  18  1MNNTANAYKNQQIMTASPEELTLMLYNGAIRFIMESMMAVDKGDLEKANNANLRAQNIVREFMCTLDMQYEMSQGYYKLYDYIEYRLTQANLKKDKDQLEEAKNLLSELRDTWVQAMKLARTQ.................................. 125
567 1.000e-44gi|557698398|ref|WP_023438642.1| flagellar protein FliS [Clostridium tetani]  clstr ali  19  4.NNAYNTYKTNSVNYASKEQLLLMVLDGAVKFSKIAKQGIEEKNIIKAHENIIKTQNIFYELMATLDVEQQWAENLMRIYDFIIQKLLEANIKKDVKIMNEIIPIIEDIRDTWHEAYKISK.................................... 125
568 1.000e-44 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  2....AQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDIEKAHTNIVKAELIIEEFQASLNHKYSVAEDFDKIYNYIYGLLVEANMKKDLDILEKATEELRGMRDTWKEVMKRA..................................... 117
569 1.000e-44gi|653218300|ref|WP_027430890.1| flagellar export chaperone FliS [Lachnospira multipara]  clstr ali  17  15....AEQYKRSKILTASPAELTLMLYEGAIKFCNIAIMAIEKGDMERAHIYIKKTEDIIIEFRSTLDRKYKVAEDFERVYVYIYDLLVEGNIKKDTEILTRALNEIRGMRDTWKKVMEKTKGQS................................. 134
570 1.000e-44gi|736440620|ref|WP_034462578.1| MULTISPECIES: flagellar export chaperone FliS [Butyrivibrio]  clstr ali  21  5.QKAYAQYKNNKVMGASGPELTLMLYDGAIKFLNIADYAIENNDVPKAHENIMKTERIIDYLRSTLDMKYAVAQDFENMYSYIGRRLVEANMSKDREIVAEVNKHMHAIRDNWVEVMKANN.................................... 124
571 1.000e-44gi|551222531|ref|WP_022850052.1| flagellar export chaperone FliS [Geovibrio sp. L21-Ace-BES]  clstr ali  19  1MSNPYQNYIKQEVEGATKGKLVLLLYDGAIKFMKLAIIAVNEENVPEAHNNIMKAENIIYELMSTLNMDAEISDNLMRLYDFMIWQLIEANKTKDKQKIESVIELMASLREAWKEVVKQ...................................... 120
573 1.000e-44gi|491758137|ref|WP_005587123.1| flagellar protein FliS [[Clostridium] ultunense]  clstr ali  23  2..NASQVYQEQQVLTASPQELVLMLYNAGIRFSKMAKKAIEEKRY