current user: public

Query: gi|238922464|ref|YP_002935977.1| hypothetical protein (EUBREC_0038) [Eubacterium rectale ATCC 33656], from E.rectale

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
2 1.000e-57gi|489440960|ref|WP_003346432.1| flagellar biosynthesis protein FliS [Bacillus methanolicus]  clstr ali  20  4.NNPYQSYQQNAVNTASPGELTLMLYNGCLKFIHLAKKAMEEKNIEDRNTNLLKAQKIIQELMVTLNMDIDISKQMMALYDYIHRRLIEANVKNDAAILDEVEGLVTEFRDTWKQVIQVNRQKQFAQGGQ........................... 132
3 2.000e-57gi|704834025|gb|KGR90108.1| flagellar biosynthesis protein FliS [Lysinibacillus massiliensis 4400831 = CIP 108448 = CCUG 49529]  clstr ali  23  5.NSALNAYKQNSVTTASPGELTLMLYNGCLKFLSQAKKAMEDKNIQNKNTNLQKAQAIIHELMSTLNMDYDISKQMLPLYEYMNRRLLEANLKNDTTIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNSQQV......................... 134
4 4.000e-57gi|515282954|ref|WP_016838008.1| hypothetical protein [Ureibacillus thermosphaericus]  clstr ali  22  5.NNAYNAYKQNSINTASPGELTLMLYNGCIKFLNLARKAIEEKHIEEKNTNLQKAQNIINELIVTLNMDYEISKQILPLYEYMNRRLIEANIKNDVEIVDEVIGLVTEFRDTWKEVIKLNR.................................... 124
6 6.000e-57gi|651982465|ref|WP_026694357.1| flagellar biosynthesis protein FliS [Bacillus kribbensis]  clstr ali  20  3LQNPYQAYQNNSVNTASPGELTLMLYNGCIKFIHQAKVAMENRQIEFKNINLQKAQNIIQELMVTLDMKLEVSKNMMSLYDYMNRRLIEANIKNDTSILDEIEALVTEFRDTWKQVIQVNRQKQFSQGG............................ 131
7 7.000e-57gi|704827487|gb|KGR83810.1| flagellar biosynthesis protein FliS [Lysinibacillus odysseyi 34hs-1 = NBRC 100172]  clstr ali  21  5.TNAYNAYKQNSVTTASPGELTLMLYNGCIKFLGKAKVAITDKNIQEKNHNIQRAQAIIAELMSTLNMDIDISKQMLPLYDYMNRRLIEANIQNDIAIIEEVEGLVTEFRDTWKEVIKITRQQQY-GSAQQV......................... 134
8 8.000e-57gi|496690420|ref|WP_009331963.1| flagellar biosynthesis protein FliS [Bacillus sp. 2_A_57_CT2]  clstr ali  18  5..NPYQSYQQNSVNTASPGELTLMLYNGCLKFIHQAKKAIMDNNIEAKNTNIQKAQNIIQELMVTLNMDVEVSQNMMSLYDYMNRRLIEANVKSETGILDEVEGLVTEFRDTWKEVIQVNRQKQFSQGG............................ 131
9 9.000e-57gi|490574689|ref|WP_004439709.1| flagellar biosynthesis protein FliS [Bacillus smithii]  clstr ali  19  4.NNPYQAYEKNAVSTASPGELTLMLYNGCLKFLLQAKKAIEDKNFEKKNTYIQKAQNIIRELMVTLNMDVELSKNLMAVYDYMNRRLIQANVKNDLEILDEVMEFITELRDTWKQAIQEQRKQQY................................ 127
12 2.000e-56gi|491030942|ref|WP_004892629.1| flagellar protein FliS [Anoxybacillus flavithermus]  clstr ali  23  3MNNPYQSYQTNAVQTASPGELTLMLYNGCLKFIAQAKKAIEEKDIEARNTNLLKAQKIIQELMVTLNMEYEVAKSMMTMYDYIYRRLVEANIKSDMSILEEVEGYVKEFRDTWKQVIQINRQRQYAQGGQA.......................... 133
13 3.000e-56gi|560301544|ref|WP_023613774.1| flagellar biosynthesis protein FliS [Bacillus sp. 17376]  clstr ali  17  3LNNPYQSYQQSSVNTASPGELTLMLYNGCLKFINLAKHGIQSKDIQAKNLNIQKAQNIVQELMVTLNMDLEVSQNMMSLYDFMNRRLIDANIKNDLQALEEVEGLVTEFRDTWKQVIQLNRQKQHSQGG............................ 131
14 3.000e-56gi|692164030|ref|WP_032086728.1| flagellar biosynthesis protein FliS [Bacillus aquimaris]  clstr ali  21  4.NNPYAAYQNNSVTTASPGELTLMLYNGSLKFIHIAKKAIEEKNIELKNTNIQKVQAIVRELMVTLNTDLELSQNLMSLYDYINRRLTEANVKNDCAILDEVEGLITEFRDTWKQVIQLNRQKQHAGQGGQA......................... 134
16 4.000e-56gi|493357133|ref|WP_006313683.1| Flagellar biosynthesis protein FliS [Clostridiaceae bacterium L21-TH-D2]  clstr ali  21  3MKNPYSQYQQNSVMTASPEELTLMLYNGAVKFIKQGKVFLEQKDMEKAHNSIVRAQDIISELNITLNMDYEISKNLRSLYTFILERLMDANIKKDIKILDEVLPLVEELRDTWKEAMQLAKK................................... 124
18 2.000e-55gi|500218056|ref|WP_011888199.1| flagellar biosynthesis protein FliS [Geobacillus thermodenitrificans]  clstr ali  22  3MNNPYQQYQTNAVQTASPGELTLMLYNGCLKFIKLARQAIETGDVTARNENLIKAQNIILELMKTLKMEYEVAKSMMTMYDYIYRRLIEANVKHDAAILDEVEGYVTEFRDTWKQVIQLNRQRQYAEGGQA.......................... 133
21 3.000e-55gi|651950964|ref|WP_026679172.1| flagellar biosynthesis protein FliS [Fictibacillus gelatini]  clstr ali  20  5..NPYQQYQTNSVQTASPGELTLMLYNGCLKFIGLAKAAIKANHIEEKNTNCLKAQKIIQELMVTLDMDIEISKSLMQMYDYFHRRLIEANVKSDIEILEEVEGYVTEFRDTWKEVIQINRRQQYGEGG............................ 131
22 5.000e-55gi|704819942|gb|KGR76464.1| flagellar biosynthesis protein FliS [Lysinibacillus sinduriensis BLB-1 = JCM 15800]  clstr ali  23  5.NTALNAYKQNSVTTASPGELTLMLYNGCLKFLTKAKNAIDEKNIQEKNTYILRSQAIIAELMSTLNMDIEISKQMLPLYEYMNRRLIEANVKNDTAIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNAQQV......................... 134
23 5.000e-55gi|498362738|ref|WP_010676894.1| flagellar biosynthesis protein FliS [Bacillus timonensis]  clstr ali  18  3LHNPYQTYQDNSVFTATPGELTLMLYNGCLKFMGQAKKSIQEKNIETKHINISKAQNIISELMVTLNMDYEISKEMRRLYDFINRRLIEANIKNDVKLLEEAEDLVIEFRDTWKEVIRLNRAKQF................................ 127
25 7.000e-55gi|666908856|gb|KEZ48745.1| flagellar biosynthesis protein FliS [Bacillus indicus LMG 22858]  clstr ali  16  3LTNPYQAYQQNSVSTASPGELTLMLYNGCLKFIKQARTAMEQKQVQEKNINLQKAQRIIQELMITLNPEAEVSGSMMQMYEYINRRLVEANISNDPEILSEAEGYVTEFRDAWKQVIQSARRQQFGQGGP........................... 132
26 2.000e-54gi|654943378|ref|WP_028393550.1| flagellar biosynthesis protein FliS [Bacillus sp. FJAT-14515]  clstr ali  17  4.NNPYQSYQQNSVNTASPGELTLMLYNGCLKFITLGKKGMTEGNIEEKNKNLLKAQNIIHELMVTLNMDVAVSKDMMALYDFMNRRLIEANTKNDLGAIEEVEGLVKEFRDTWKEAIQMNRKNQFTQSGQ........................... 132
27 2.000e-54gi|489425044|ref|WP_003330726.1| flagellar protein FliS [Bacillus azotoformans]  clstr ali  20  4..NPYQTYQNNAVNTASPGDLTLMLYNGCLKFIKQAKIAIENKDVETKHMNLVKAQNIITELMVTLNTDYEVGKNMMQMYDYMKRRLIEANTKSDIAILNEVEGYVAEFRDTWKEVIRISRQQKYAVGGQ........................... 131
28 2.000e-54gi|653071330|ref|WP_027322495.1| flagellar biosynthesis protein FliS [Bacillus sp. URHB0009]  clstr ali  18  4.QNPYQSYQQNSVNTASPGELTLMLYNGCLKFVHQAKKAIEDKNIEARNINIQKASKIITELMVTLNQELEITKQILPLYDFMNRRLIEANLKNDLTALSEVEDLLVDFRDTWKQVIQLNRQKQFAKGGQA.......................... 133
29 2.000e-54gi|653220944|ref|WP_027433501.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium MD2004]  clstr ali  21  1MTNPYAVYQKNKIMTASPAELTLMLYDGAIKFCNIALAGIEEKDIEKAHINIRKANNIIDELQSTLNHKYPVAKDFENVYEYIRDCLIEANIKKDPEVLNEALGHIRTMRDTWKEVMKANK.................................... 123
31 4.000e-54gi|495454122|ref|WP_008178816.1| flagellar biosynthesis protein FliS [Bacillus sp. B14905]  clstr ali  20  7...AQNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQAIQEKNIQEKNTNLIKAQAIISELMATLNMDIEISKQMLPLYEYMNHRLVEANIQNDVAVIEEVEGLVTEFRDTWKEVIRINRQQQFGQG............................. 131
32 5.000e-54gi|573589651|gb|ETT87858.1| flagellar protein [Viridibacillus arenosi FSL R5-213]  clstr ali  23  4.QSAHQAYKQNSVTTASPGELTLMLYNGCIKFLHKGKLAIGSKDVEAKNTNLLKAQAIISELMSTLNMDIEISKQMLNLYEYMNRRLVEANIQNDVAIIDEVEGYVVEFRDTWKEVIRLNRQQQFTGNQ............................ 131
33 6.000e-54gi|654153023|ref|WP_027726358.1| flagellar biosynthesis protein FliS [Tuberibacillus calidus]  clstr ali  24  4..NPYKAYEQNSVLTATPGELTLMLYNGCLKFIHQGKKAIEAKDNEAKNTNLQKAQKIIQELMVTLNMDIPISKELLPLYDYIYRRLIEANVKSDTAILDEVDELVTSFRDTWKEVIQITRQQ.................................. 124
34 7.000e-54gi|493891546|ref|WP_006837550.1| flagellar biosynthesis protein FliS [Bacillus sp. SG-1]  clstr ali  19  4.KNPYKTYQNNTVNTASPGELTLMLYNGCLKFIQLAKRGIEEKNIEQKNLNIQKAQNIVSELMVTLNMDVEVSKNIMSLYEFIHRRLVEANIKNDLNALNEAEALIVDFRDTWKQVIQLDRQQKFEGKAGQV......................... 134
35 8.000e-54gi|497882827|ref|WP_010196983.1| flagellar biosynthesis protein FliS [Bacillus sp. m3-13]  clstr ali  22  3MKNPYQAYQQNSVNTATPGELTLMLYNGAIKFMKLAKKGMEDKDIEMKNTNLIKAQKIVQELMVTLDTSHDVGKSMMTMYDYMNRRLIDANLKNDSSIVDEVEGLMMEFRDAWKQVIQANRQQAFAQGGKA.......................... 133
36 8.000e-54gi|504637535|ref|WP_014824637.1| flagellar biosynthesis protein FliS [Solibacillus silvestris]  clstr ali  20  5.TNAFNAYKQNSVTTASPGELTLMLYNGCLKFLNKAKQSIADKNIEERNHYIQRSQAIIGELMATLNMDIGISKQMLPLYEYMSRRLTEANIQNDSSIIEEVEGLVTEFRDTWKEVIKITRQQQYGTAGQ........................... 133
39 9.000e-54gi|547951155|ref|WP_022351963.1| putative uncharacterized protein [Firmicutes bacterium CAG:534]  clstr ali  19  5..NAYAQYKNSKVLTASPAELTLMLYEGAIKFCNIAIAAIEQKEVEKAHVNIRKAQKIIEHLRVTLDMKYPVAKDFDNMYQYIDRRLLEANISKDPEILKEVLTHLHAIRDTWKEVMRINREKGV................................ 127
40 1.000e-53gi|547661564|ref|WP_022124280.1| putative uncharacterized protein [Clostridium sp. CAG:510]  clstr ali  21  5..NAYAQYSNNKVLTASPAELVLMLYDGAIKFCNIAVVAIDAKDIPKAHTNIIKAQKIIDHLRITLDMSYPVAQDFDNIYAYVAKRLVEANVSKDKEILEEVCTHLRSVRDTWKEVMRINH.................................... 123
43 4.000e-53gi|498317742|ref|WP_010631898.1| flagellar biosynthesis protein FliS [Sporolactobacillus vineae]  clstr ali  22  3.NNAYKVYQQNSVLTATPGELTLLLFNGCLKFIRQGRGAILNKNYEQKNKVIQKAQAIITELMVSLDSKQPVAKDMMSLYDYIHRRLIEANVKNDITILDEVEKLVADFRDTWKQVIIINRKEQ................................. 125
45 5.000e-53gi|704824224|gb|KGR80607.1| flagellar biosynthesis protein FliS [Lysinibacillus manganicus DSM 26584]  clstr ali  20  5.NAAFNAYQQNSVTTASPGELTLMLYNGCLKFLTKAKMAIDANDIQEKNTNIQKAQAIIHELMVTLKTDQEVGQQMLSLYDYMNRRLMEANINNNKEIIDEVIGLTTEFRDTWKQVIQITRQQQF-SNAQQI......................... 134
46 8.000e-53gi|491790494|ref|WP_005601298.1| MULTISPECIES: flagellar biosynthesis protein FliS [Butyrivibrio]  clstr ali  18  1MTNAYDMYQKNKVMTASPAELTLMLYEGAIKFINVAIMGIDQKNIEKAHNNIVKATRIIEEFRNSLDFKYPVAKDFDVVYEYILRRLVEANVHKDKEILEECLTHLRSMRDTWKEVMQTGR.................................... 123
47 8.000e-53gi|517536148|ref|WP_018706356.1| hypothetical protein [Bacillus fordii]  clstr ali  20  4.RNPYEAYQNNSVTTASPGELTLMLYNGCLKFINLAKHAIENKEIENRNTNIQKAQNIVSELMLTLNMDVEISKNMRSLYEYSNRRLMEANFKQDISILEEVEEIMTEFRDAWKQVIQLNRQ................................... 124
48 1.000e-52gi|501764389|ref|WP_012634560.1| flagellar biosynthesis protein FliS [[Clostridium] cellulolyticum]  clstr ali  21  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDDKNIEKANNSIIRAQDIILEFQVTLDMKYEVSNNLYSIYDYMHRRLVQANIKKDKDILEEVLGMAKELRDTWTQAMKIAK.................................... 123
49 1.000e-52gi|727677834|ref|WP_033827826.1| flagellar biosynthesis protein FliS [Bacillus sp. KW-12]  clstr ali  16  4.NNPYQAYQQNSVNTASPGELTLMLYNGCLKFINLAKVAIQEKNIPEKNTNLQKAQNIVNELMVTLNMDIEISKQMMTLYDFVRTKLIEGNVKDDIQALEEAEMIIREFRDTWKQVIQINRKHSYAQGGQA.......................... 133
50 1.000e-52gi|647281956|ref|WP_025727184.1| flagellar biosynthesis protein FliS [Bacillus ginsengihumi]  clstr ali  17  4.KNPYQAYQNNSVTTASPGELTLMLYNGCLKFIHLAKQAIEQNNIEEKHKNLIKAQNIIRELMVTLEPKFDGAENMMRLYDFMLQELIAANLKNDIKKLNDVEELVTGFRDTWKEVIQLNRKQSYAQGGKA.......................... 133
51 2.000e-52T2D.4084169 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  5..NAYNQYNNSKILTASPAELVLMLYDGAIKFCNIAVAAIEAKDVPKAHTNIVKAQKIIDHLRMTLNMSYPVAQDFENIYSYLGQRLIEANVSKDPEILKEVCTHLHSVRDTWKEVMKTGQGGA................................. 126
52 2.000e-52gi|653188185|ref|WP_027424507.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AC3007]  clstr ali  21  6...AYQQYKNSKVLTASPAELTLMLYDGCIKFCNMGVMAINGKDYAAANKNIQKAERIIGEFKMTLDHKYEVAKDFDNIYDYVLRRLHEANMHKDTEILNECITHMRSLRDTWKEVMKQAGQPAMPEAAQA.......................... 133
54 3.000e-52gi|595612005|gb|AHM55650.1| flagellar protein FliS [Eubacterium acidaminophilum DSM 3953]  clstr ali  18  3MANPYAKYQEQSVFTATPEELTLMLYDGCIKFINRAAIGIEDKNIEMTNTNIIKAQNIVRELNITLNMDYEVSKGLRPLYDYMHTRLIDANIKKDKEALEEVKGLVTDMRDTWKEAMKLAR.................................... 123
55 3.000e-52gi|550174396|ref|WP_022588181.1| flagellar biosynthesis protein FliS [Caldanaerobacter subterraneus]  clstr ali  29  8..NPYQQYKENAILTASPEELVLMLYNGIIRFIDEAKTALQKKDYVETNAKIQRAQDIITELMLTLDMNYDISKNLYNLYDYILRRLIDANVKKDIEILDEVRGFVVELRDTW--------SLALQKVREKVYA....................... 131
56 3.000e-52gi|692239698|gb|KGG81213.1| flagellar biosynthesis protein FliS [Caloranaerobacter azorensis H53214]  clstr ali  19  4.KNPYAQYQQDSIMTATPEELTLMLYNGAIKFVKQGKLFIEQKDIQNAHNSIVRAQDIISELNITLNMDYEISKNLRSLYTFILDKLMEANIKKDSKILDEILPIVEDLRDTWKEAMKLAKQ................................... 124
57 3.000e-52gi|651519241|ref|WP_026559724.1| flagellar biosynthesis protein FliS [Bacillus sp. J37]  clstr ali  15  4.NNPYQAYQQNSVGTASPGELTLMLYNGCLKFIKQASKAIEDSNIEDKNTNIQKANKIISELMLTLNMDLEISKEMQVMYDYMSYRLIEANTKNDVEILEEVEGYVVDFRDTWKQVIQTSRQQQFGMGGHA.......................... 133
58 3.000e-52gi|654945900|ref|WP_028396064.1| flagellar biosynthesis protein FliS [Bacillus sp. FJAT-14578]  clstr ali  19  4.NNPYQAYRQNSVNTASPGELTLMLYNGCLKFMKLARVAIEQKDIEAKNENLLKAQKIIQELMVTLNMDVAMSKTMMAMYDYINRRLIEVNMTNDLTILDEVEGYVTEFRDTWKQVIQLNRQKAHQGGQ............................ 131
59 3.000e-52gi|652403152|ref|WP_026798929.1| flagellar biosynthesis protein FliS [Pontibacillus halophilus]  clstr ali  20  4.....QAYQSNSVQTASPGELTLMLYNGCLKFIKLARKAIESNQFEAKNTNIQKARNIVQELMVTMNQDYEISKEIMPLYDYMNRRLMEANINNDVNILDEVEGLATEFRDTWKEVVKQTRMEKFGQGGQA.......................... 129
60 3.000e-52gi|547903133|ref|WP_022306604.1| flagellar protein FliS [Roseburia sp. CAG:380]  clstr ali  20  5.NRAAQMYQKNAVQTASPAKLTLMLYDGAVKFTNIAIEAIEAGDIEKAHNNIVKAQNIIVEFRSTLDMKYPVAKDFDVVYDYIYRRLVEANMKKDKDILVEALKHIKTMRDTWREVMKLNN.................................... 124
61 4.000e-52gi|657698984|ref|WP_029497990.1| flagellar biosynthesis protein FliS [Kurthia huakuii]  clstr ali  24  4.QNAYNAYKQNSVTTASPGELTLMLYNGCIKFIHQAKKAIEVKDISNRNKYVQKAQAILNELMSTLNMDIPVSKEMFNLYEYMYHQLTQANINNDVAILDEVEGLVVEFRDTWKQVIQMNR.................................... 123
63 4.000e-52gi|654485107|ref|WP_027955058.1| flagellar biosynthesis protein FliS [Halobacillus kuroshimensis]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKAAGKAMEQKDIESKNTNIQKAQRIIQELMVTMDQNTDISAQVLPLYDYMNRRLIEANTKNDPAILDEVEGLVVEFRDTWKQVILQTRKSQYPQGG............................ 127
64 5.000e-52gi|501225583|ref|WP_012268601.1| flagellar biosynthesis protein FliS [Thermoanaerobacter sp. X514]  clstr ali  28  2MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGTIEKKDYMAANNSIQRAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVTILEEVKGFAIELRDTW--------SVALNKVREKVYA....................... 127
66 7.000e-52gi|583922847|gb|EWG11506.1| flagellar protein FliS [Bacillus firmus DS1]  clstr ali  17  5..NPYKKYKENTVTQASPAELTLMLYNGALKFIKLAKQGIEEQNIELKNTNIQKTQSIIQELMVTLNTDVEISNNLMRMYDFMFRQLVEANVKNDAKLLDEVEGFLVEFRDTWKEMIQQSRKG.................................. 125
67 8.000e-52JGI.Meta JGI_HUM.1178964 7037836216 SRS014923_WUGC_scaffold_14075__gene_19967 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYRYLQERLVEANMKKDKEILEEVLAHLRTMRDTWKEVMKLAHSK.................................. 125
68 9.000e-52gi|516041931|ref|WP_017472514.1| flagellar biosynthesis protein FliS [Amphibacillus jilinensis]  clstr ali  18  3.QQHYQAYKNNSVNTASPGELTLMLYNGCLKFIKYAKKGIEQGDIQLKNTNIQKAQNIINELMVTLDQGAPIAKEMLPLYDYVNHCLIQANIKNDLESLMEANRVVEEFRDTWKEVLKQTRTQQYTQGAKA.......................... 132
69 1.000e-51gi|503042277|ref|WP_013277253.1| flagellar biosynthesis protein FliS [Acetohalobium arabaticum]  clstr ali  21  3.NNPYQKYKNTQVETASQEKLLLMLYDGAIKFLKQAIKGVEENDYEAANNYLVRTQDIIHELMATLDMEKEIARNLESLYDYMNRRLIEANVNKDIEPMEEVRDMLAELRETWQEAIKKVKQ................................... 125
71 1.000e-51gi|678286235|emb|CEE02763.1| flagellar protein FliS [Bacillus thermoamylovorans]  clstr ali  17  5..NPYQAYQENSVLTASPGDLTLMLYNGCLKFLNLAKKAIEEKNITEKNTNLQKAQNIINELMVTLNMDIEISKQMMALYDFVRIKLIEANVKNDLAALEEAESIMIEFRDIWKEVIKLNRQQTYTKDGQ........................... 132
73 1.000e-51gi|494767821|ref|WP_007503229.1| flagellar biosynthesis protein FliS [Caldalkalibacillus thermarum]  clstr ali  17  4.RNPYQTYKHNAVQTASPGELTLMLYNGCLNFIKQARQAIEEDNIQERNKYMQKAQDIIRELMVTLNTDYAVAKDMLRMYDYILRRLIEANINNDTAILDEVETYVSQFRDTWKEVLRLNRQKQYGGGVPH.......................... 133
75 2.000e-51gi|651593957|ref|WP_026588929.1| flagellar biosynthesis protein FliS [Bacillus sp. NSP9.1]  clstr ali  16  4.NNPYAAYQQNSVNTASPGELTLMLYNGCLKFIKKAQQGIEQGDMEMKNENLVKAQNIIRELNITLDRSIEIGESMAAMYEYIYRRLVDANIHNDLDILREAEGYVIEFRDTWKEVMQIERQGRHGSGGQA.......................... 133
77 2.000e-51gi|547834492|ref|WP_022242367.1| putative uncharacterized protein [Roseburia sp. CAG:45]  clstr ali  16  3MNNGYAAYQNSKIMTASPAELTLMLYEGAIKFCNIAIMGIEENNIQKAHTNIVKVENIIEEFQATLNHKYPVAKDFENVYKYLQERLVEANMKKDKEILEEVLVHLRTMRDTWKEVMKLAHSK.................................. 125
78 2.000e-51gi|503063644|ref|WP_013298620.1| flagellar biosynthesis protein FliS [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  19  1MFDPYLEYKRNSIMTASPEELVMMLYNGIIRFVNEAKQAIDDKNIERAHNSITRAQDIVLELMSTLDMKYDISKNLYSIYDYISRRLIEANLKKDKVALDEVESLISDLKDTWGKAMDKVRAKVYSKG............................. 128
79 2.000e-51gi|701592751|gb|KGP73570.1| flagellar biosynthesis protein FliS [Pontibacillus yanchengensis Y32]  clstr ali  17  3.TQAYQAYQSNSVQTASPGELTLMLYNGCLKFMKLAKRGIEEKDYELKNTNIQKAQRIIQELMVTMNPDYDITNEVMPLYEYINRRLMEANLHNDTTILNEASELVTEFRDTWKEVVRQTRQQKFGEGG............................ 130
82 3.000e-51gi|640599713|ref|WP_025028345.1| flagellar biosynthesis protein FliS [Bacillus mannanilyticus]  clstr ali  18  4.NNPYQAYQQNAMNTASPGELTLMLYNGCLKFIKQAKLDIEKKNIEAKNTNIIKAQNIIRELMVTLNMDVEISEQLMQMYDYLLNRLIEANLRNNIDILKEVEGFVTEFRDTWKEALQINRR---MQHGQ........................... 129
83 4.000e-51gi|498017899|ref|WP_010332055.1| flagellar biosynthesis protein FliS [Bacillus mojavensis]  clstr ali  19  4.QNPYAAYQQSSVNTATPGELTLMLYNGCLKFIKLACQAIENNDIERKNENLIKAQNIIQELNGTLNRNIELSGSMGAMYDYIYRRLVEANIKSDKSILEEVEGYVTDFRDAWKQAIQIERK................................... 124
85 6.000e-51gi|651374101|ref|WP_026486328.1| flagellar biosynthesis protein FliS [Caldanaerobius polysaccharolyticus]  clstr ali  23  4.NNPYQQYKANAVMTASPEELTLMLYDGIIRFLNQAKEAISSHDMQTAHERLVRVQDILNELNATLDRNYDISANFASLYDFMIRKTVEANVKKDVSIIDEVLDLARDLRDTWQQAMKKARKE.................................. 125
86 6.000e-51gi|495392851|ref|WP_008117552.1| flagellar biosynthesis protein FliS [Bacteroides pectinophilus CAG:437]  clstr ali  16  3LNQAYSQYNNSKILTASPAELTLMLYDGAIKFCNIAIMAIEKNDVMKAHTYIVKTENIIEEFQATLNHKYPVAKDFDNVYKYIYNRLIEANVKKDKDILEEVLVHLRTLRDTWKEVMKITHNGA................................. 126
87 6.000e-51gi|547326947|ref|WP_022057915.1| flagellar protein FliS [Clostridium sp. CAG:167]  clstr ali  20  1MNQDINAYQRNAILTASPAELTLMLYDGAIKFCNIAIIGIEKKDMEKAHVNLKKAQDIITELRVTLDHKYPVWEDFDRVYDYIYRRLVEANMSKDIAVVEDALKYIREMRDTWKEVMKAAPAGS................................. 125
88 6.000e-51gi|521288835|ref|WP_020453103.1| MULTISPECIES: flagellar assembly protein FliS [Bacillus]  clstr ali  23  3LNNPYAAYQQNSINTATPGELTLMLFDGCLKFMKLAKQAIEQEDMETKNTNLVKAQKIIQELNITLDRKVELAASMGAMYEYIHRRLVEANIRNDKDIVTEVEGYVKDLRDAWKQALQIERQG.................................. 125
91 1.000e-50gi|558636518|ref|WP_023511351.1| flagellar biosynthesis protein FliS [Sporolactobacillus laevolacticus]  clstr ali  21  4..SAYKTYQQNSILTATPGELTLMLYNGCIKFIRQAKIAITEKNIEDKNKYLQKAQDIIRELMVTLDQKQQVAQSMMQMYDYMNRRLIEANIKNDLKILNEVEGLVTEFRDTWKQVIEITQKNQ................................. 125
93 1.000e-50gi|489340841|ref|WP_003248016.1| MULTISPECIES: flagellar biosynthesis protein FliS [Geobacillus]  clstr ali  22  8.....QVYKQNSVSTASPGELTLMLYNGCLKFLNKAKQAMREGNIQERNTNLQKAQRIIQELMATLNQKYEIAKQMMIMYEYMNRRLIEANIKNDISIVEEVEGFVAEFRDTWEEVIRLTRQKQF................................ 127
94 1.000e-50gi|695912364|emb|CEG24352.1| Flagellar protein FliS [Planomicrobium sp. ES2]  clstr ali  19  5..NPYQAYQQNSVMTASPQELTLMLYNGSLKFMKLAKKAMAENNFQEKNTNIIKAQNITQELRVTLDPDAEISKNMEQLYEYMYTRLIEANTKNDVAILEEVEGLMVELRDTWKQVMGMVKNG.................................. 125
96 1.000e-50gi|653240250|ref|WP_027445884.1| flagellar biosynthesis protein FliS [Pontibacillus marinus]  clstr ali  17  3.TQAYQAYQNNSVETASPGELTLMLYNGCLKFIRLAKKGIEESNYELKNTNIQKAQKIIQELMVTMNPEYKITEEIMPLYDYINRKLMEANLHNDTAMLDEAAELVTDFRDTWKEVVKQTRQQKFGSGG............................ 130
98 2.000e-50gi|515752311|ref|WP_017184911.1| hypothetical protein [Alkalibacillus haloalkaliphilus]  clstr ali  22  6..QAYQAYQQNSVSTASPGELTLQLYNGCIKFIKLAKTAIEKEDFQSKNEQLQKAQNIIAELMVTLNPDYDITNQLLPLYDYINYCLREANIHNDVAKLDEAQKMVEQLRDTWKEAIKLDRQNKYAPGAKA.......................... 134
100 2.000e-50gi|516754026|ref|WP_018084741.1| hypothetical protein [Desulfurispora thermophila]  clstr ali  23  5..NPYQQYRQNAVNSAAPGELTLMLYNGAIKFLHQAREAIAAKDVPGAHEALVRAQEIIQYLFDTLDMQYEIAGNLAALYDFILRQLRQANIKKDVGPVEEVLPLLEDLRDTW............................................ 115
101 2.000e-50gi|518072867|ref|WP_019243075.1| hypothetical protein [Bacillus massilioanorexius]  clstr ali  19  4.NNPYKAYEQNSVTTASPGELTLMLYNGCLKFIGKAKIAIEQNHIEERNTNIQKAQNIIRELMVTLNMDYEVSKNMMTIYEYINGLLTEANIQSELAKLVEAEGLVKEFRDTWKQVVQMNRKKQYQGGA............................ 131
102 2.000e-50gi|502179011|ref|WP_012726961.1| MULTISPECIES: flagellar biosynthesis protein FliS [Exiguobacterium]  clstr ali  20  4..NPYAAYQNNAVTTANPQELTLMLYDGALKFMRLAKLAIDQGNPDLKNINIQKTQAIFQELRLTLNKDIAISANLDSLYDYMWRRLVDANVKNDTTILDEVLDFTTELRDTWKEAMKLAKQ................................... 123
105 2.000e-50gi|664799829|gb|AIF68064.1| flagellar biosynthesis protein FliS [Terribacillus aidingensis]  clstr ali  18  6....YQAYQQNSVQTASPGELTLMLYNGCIKFIKFAQQAIEKKDIEAKNTNIQKAQNIVRELMITLDPEVPITNEIMPLYDFINQQLIQANTHNDQQALKSALDLITDFRDTWKEVVKQTRKQQFGTGA............................ 130
106 2.000e-50gi|647307879|ref|WP_025747915.1| flagellar biosynthesis protein FliS [Caldicoprobacter oshimai]  clstr ali  21  3LNNPYQQYQQQSVMTASPGELLVMLYNGCIRFIKQAIECINGKDLEGAHKAIIRAQDIILEFMTTLDMKYEVSHNLMALYDYLHRRLVEANTRKDVAALEEVLGFVTELRDTWAEAVKITRKQ.................................. 125
107 3.000e-50gi|547200785|ref|WP_021941911.1| flagellar protein FliS [Clostridium sp. CAG:632]  clstr ali  20  3.NNAAQAYGARKVETATPAELTLMLYEGTIKFCNIAMGAIEKKDYEKANINIQKARKIIVELQTTLDHKYPVAEDFDRIYDYIFHKLVQANIKKDPEILEEALVELRDLRDAWKEIMRTAK.................................... 122
108 3.000e-50METAHIT unmapped GL0156791 unmapped_[Complete]_[mRNA]_locus=scaffold361806_1:404:778:+  ali  20  5..NGYAAYANSKVATATPAELTLMLYDGAIKFCNIAIMALEEKDLEKAHNNIIKVENIISEFQITLNHKYPVAKDFDAVYKYLKERLVEANVKKDKEVLEEVLEHLRTMRDTWKEIMKVAHA................................... 124
109 3.000e-50gi|504822296|ref|WP_015009398.1| flagellar biosynthesis protein FliS [Amphibacillus xylanus]  clstr ali  19  3.QQPYQAYINNSVNTASPAELTLMLYNGCLKFIRYGKKGIEEQNMELKNTNIQKAQNIITELMVTLDQSAPIAKDIMPLYDYINQLLIEANIKNDLNSLDEAANLVEEFRDTWKEVIKQTRTREYKQGVQA.......................... 132
110 3.000e-50gi|489616010|ref|WP_003520450.1| flagellar biosynthesis protein FliS [Ruminiclostridium thermocellum]  clstr ali  26  3LKNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQAQMALNDKNIEKANKSIIRAQDIISEFRCTLDMKYDIAHQLDLLYDYMYRRLVDANIKKDGAIAEEVLGFAKELRDTWEQAMKIAKQQ.................................. 125
112 3.000e-50gi|697199862|ref|WP_033168603.1| flagellar biosynthesis protein FliS [Clostridium sp. KNHs205]  clstr ali  20  4..NAALAYQNNAIQTASPAELTLMLYEGAIKFTNIALMAIEEGNVEKVHLNIVKVENIILELRSTLDHKYPVAEDFDRVYDYIYRCLVDANVKKDKWKLEEALGFIREMRDTWKEVMKTTKKK.................................. 124
113 4.000e-50gi|652514776|ref|WP_026908985.1| flagellar biosynthesis protein FliS [Paucisalibacillus globulus]  clstr ali  18  3LNKPYQAYQNNAVNTASGGELTLMLYNGCNKFIKQAIRDIQEKNMEAKNTNIQKAQAIIQELMITLDLEVEISKHIMPLYDYMNRRLMEANLKNDIEILAEVQGFVVDFRDTWKQVILKTRQKQYAQG............................. 130
114 4.000e-50gi|504270700|ref|WP_014457802.1| flagellar biosynthesis protein FliS [Bacillus megaterium]  clstr ali  16  4.NNPYQAYQQGAVQTASPGELTLMLYNGCLKFIKLARTGIEEKNIELKNTNLLKAQNIIQELMITLDTNVQVAKSMMAMYDYINQCLIEANTKNDTASLDEAEQYVTEFRDTWKQVVQLHRQQVHGSGGQA.......................... 133
116 4.000e-50gi|497451562|ref|WP_009765760.1| flagellar biosynthesis protein FliS [Sporosarcina newyorkensis]  clstr ali  25  4.NNPYAAYQNNSVTTSTPGELTLMLYNGCLKFIQQGKMALEEGKLEEKNVAIQKAQAIVTELMLTLDTSYPVAENMLVLYEFVNSRLIDGNIKNDPALFDEASGIIKEFRDTWKQVIQVNRSKQY................................ 127
117 4.000e-50gi|502937031|ref|WP_013172007.1| flagellar protein FliS [[Bacillus] selenitireducens]  clstr ali  18  4.NNPYQQYKQNTVDTKSPGELTLMLYDGCLKFIRRAEEAIKNKNIEVKNENLLKAQNIIRELMLTLNTDVAVSQDMMSMYDYILNQLVEANMKNDLDALKEAAKYTEDFRDTWKEVIKIDRQE.................................. 125
118 5.000e-50gi|725814256|gb|KHE67543.1| flagellar biosynthesis protein FliS [Halobacillus sp. BBL2006]  clstr ali  18  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKIARKAMEQSEIEKKNTNIQKAQNIIRELMVTMNQDYAISQEILPLYDYMNRRLMEANTKNDTAILDEVQGLAEEFRDTWKQVILQTRKVQYGQGG............................ 127
122 6.000e-50gi|652833144|ref|WP_027116886.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium P6B14]  clstr ali  18  3.QNRMSDYQRNAILTATPAELTLMLYEGAIKFCNLAKMAIEKKDIQKAHENIKRAQDIITEFRVTLDRKYPVWEDFERVYDYIYRKLVEANIHKDLEPLEEALKYIREMRDTWKEVMKLAR.................................... 122
123 6.000e-50gi|517205790|ref|WP_018394608.1| hypothetical protein [Bacillus sp. 37MA]  clstr ali  20  4..NPQQAYANNSVTTASPGELTLMLYNGCIKFIRLAERAMADKNIEQKNVNIQKAQAIVRELSITLKTDTDVAKNMLALYEYLYTRLIEANVQNDPAILKEVEGFVTEFRDTWKQVIQENRR------IQQVGAG...................... 130
124 8.000e-50gi|548336542|ref|WP_022516187.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:182]  clstr ali  17  3LNTGYAAYANNKVMTASPAELTLMLYDGAIKFCNIAIRAIEEGDVEKAHNNIVKVENIIDEFRATLNHKYAVAEDFENVYVYLRERLSLANMKKDKEILEEVLKHLRTMRDTWKEVMKETNNG.................................. 125
125 8.000e-50JGI.Meta JGI_HUM.1185298 7037865446 SRS014923_WUGC_scaffold_29623__gene_49197 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEVAIEEKDIQKAHNNIRKVQNIIGYLQSTLDTKYPVAQDFINIYDYLSQRLVEANVKKDKEILEEVNMHLHSVRDNWKEVMRVNREK.................................. 125
126 8.000e-50gi|504457205|ref|WP_014644307.1| flagellar biosynthesis protein FliS [Halobacillus halophilus]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCLKFIKTAKKAIENHDIEKKNTNIQKAQKIIRELMVTMEQDYEVAKDIMPLYDYMNRRLMEANITNDLGILEEVQGLTEEFRDTWKEVILQTRRVQQGQGG............................ 127
127 8.000e-50gi|721321722|ref|WP_033542927.1| flagellar biosynthesis protein FliS [Planococcus sp. CAU13]  clstr ali  18  4.NNPYQTYQQNSVTTASPQELTLMLYNGCLKFIKLAKRAMKEGNFQEKNTNLIKAQNIIQEFQITLDRNIEISEGLAQLYDYIYGRLIEANMKNDLAILEEAEGQVKELRDTWKEAMALVKGK.................................. 125
128 9.000e-50gi|511031625|ref|WP_016285716.1| flagellar protein FliS [Lachnospiraceae bacterium 3-1]  clstr ali  18  4.NKGYNAYARNKILTASPAELTLMLYEGAIKFCNIAIAAIEEKNIEKAHNNITKVENIVAEFLSTLDHKYPVAKDFENVYNYLMERLLEANLKKDKEILEEVLTHLRTMRDTWKEVMEQNKTA.................................. 125
129 9.000e-50gi|547854614|ref|WP_022261526.1| flagellar protein FliS [Butyrivibrio sp. CAG:318]  clstr ali  17  7...GYNAYLRSKVMTATPAELTLMLYEGAIKFVNKAIMSIEKDDVMGAHNNLMKTQRIIEELRASLDHKYPVAKEFDTVYEYILRRLVEANIKKDKDILEEVLEHLRTMRDTWKEVMKNANAPQSA............................... 129
131 1.000e-49gi|503861883|ref|WP_014095877.1| flagellar biosynthesis protein FliS [Bacillus coagulans]  clstr ali  20  4.RNPYQAYQNNSIATASPGELTLMLYNGCLKFIHLAKKAIENKNFEEKNKNIQKAQNIIRELMMTLDTKFEDAEKMLSLYDFILRELIQANVKNDMSKLDTAEELVTGFRDTWKQVIQANRRQTYGQGG............................ 132
133 1.000e-49gi|495910983|ref|WP_008635562.1| MULTISPECIES: flagellar protein FliS [Bacillaceae]  clstr ali  25  4.....QAYQNNSVSTASPGELTLMLYNGCIKFIKAGKKAMESNEIEAKNTNIQKAQKIIQELMVTIDDQYEVSKQILPLYDYMNRRLIEANTKNDTGVLDEVQGMVEEFRDTWKQVLLADRK................................... 120
134 1.000e-49JGI.Meta JGI_HUM.4707565 7025558325 C3976441__gene_155075 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 604812005]  ali  18  5.NKAYAAYANNKIMTASPAELTLMLYDGAIKFCNIAIMAVEKEDIQQAHTNIRKVERIIEEFQSTLDDKYPVSKDFNNVYTYLHRRLVEANIKKDKEILEEVLEHLRTMRDAWKEVMQ....................................... 121
136 2.000e-49gi|500860009|ref|WP_012011420.1| flagellar biosynthesis protein FliS [Bacillus pumilus]  clstr ali  18  4.QNPYAAYQKNSIETATPAELTLMLYEGCLKFIRLAKYAIQKEDAETRNVNLKKAQNIIQELNVTLNRSYDVSKSMASMYDYIYRRLIEANFQNDEEMLNEVEQYVTDFRDAWKEVIQNDRKG.................................. 125
137 2.000e-49gi|701632550|gb|KGP91392.1| flagellar biosynthesis protein FliS [Pontibacillus chungwhensis BH030062]  clstr ali  20  3.TQAYQAYQNNSVETASPGELTLMLYNGSLKFMKLAKKGIEEENIELRNTNIQKAQKIVQELMVTMNPDYSITQEVMPLYDYVNRRLMDANLKNDASILEEAFEIMTDFRDTWKEVVKQTRQQQF................................ 126
139 2.000e-49JGI.Meta JGI_HUM.2745273 7025242208 C3586802__gene_184747 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 764224817] :  ali  14  9..NPYQKYKETSINTASKEEITLMLYEGCIKFMNLARIGIEEKNIQKANENLIKAQNIVTELDITLNMDIPISKNFHQLYDFVLSRLIDANIKKDVAFIDDAKLVMVDLRDGWKEAMPLMRKAQ................................. 130
141 2.000e-49gi|512486119|ref|WP_016429516.1| flagellar protein FliS [Paenisporosarcina sp. HGH0030]  clstr ali  17  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFIRLSKKAMTEKNYEVKNTNIIKAQNIIQELRITLNQEIEISNNMTQLYEYMHTRLVDANIKNNLEILEEVEGYVVELRDTWKQVIELAKK................................... 124
142 2.000e-49gi|515948415|ref|WP_017378998.1| hypothetical protein [Paenisporosarcina sp. TG-14]  clstr ali  19  4.KNPYEVYQKNSVMTASPQELTLMLYSGCLKFIKLAKKAMVEKNFEVKNTNIIKAQAIIQELRVTLNQEIEISKNMAQLYDYMYNRLVDANMKNDLETLQEVEGYVVEMRDTWKQVMGLVKK................................... 124
143 2.000e-49gi|505173101|ref|WP_015360203.1| flagellar protein FliS [[Clostridium] stercorarium]  clstr ali  23  1MNAAYNQYRENSVYTASPEELTLMLYNGLIKFIMKAQNAISKKDIEGANENILRAQDIVSELMSTLDKKYEIANNLEMLYDFMLRRLIEANVKKSCEILDEVLEFAKELRDTWEQAMRIARKQ.................................. 124
145 2.000e-49gi|671613750|ref|WP_031583122.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AC2028]  clstr ali  21  5..NAYQQYANNKIMTSSPAELTLMLYDGAIKFLNIALGALEEKDVQKAHTNILKAEHIIDYLRQTLDMKYAVAQDFENIYSYLSQRLVEANLKKDSAILEEVNGHLHSVRDTWKEVMKLN..................................... 122
146 2.000e-49JGI.Meta JGI_HUM.2296328 7004744558 SRS013705_Baylor_scaffold_91903__gene_112818 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1  ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVRGNLDSDTAKIDEAAGIIRELRDAWAQAMKKARAEKMGEGAEAV......................... 133
148 3.000e-49gi|653215065|ref|WP_027427702.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AD3010]  clstr ali  21  5..NAYAQYNRNKILTASPAELTLMLYDGCIKFINIAIMGIDEKDIAKANTNIKKAERIILELQSTLNEKYEVAKDFNAVYSYVKRRLLEANLSKDKEILEECAGHMRTMRDTWKEVMKTAH.................................... 123
149 3.000e-49gi|518999167|ref|WP_020155042.1| hypothetical protein [Caldibacillus debilis]  clstr ali  18  4.QNPYQAYQDNAVTTASPGELTLMLYNGCLKFIAAAKEAMKKKDYAGKNTNLQKAQNIIRELMVTLKPEYEVSKNMMAMYDYIYRRLLEANLKNDLAILEECEGFVTEFRDVWKQVIQINRKQQYKEGGQ........................... 132
150 3.000e-49gi|652500051|ref|WP_026894455.1| flagellar biosynthesis protein FliS [Clostridiisalibacter paucivorans]  clstr ali  17  5..NPYAQYQQNSVMTASPEELTLMLYNGAIKFIKQAKIFINEKQMENAHKSIVRAEDIIAELNITLNMDYEISENLRSLYTFILDRLTDANVQKSTDVLNEILPLVEDLRDTWQQAMKQAK.................................... 123
151 3.000e-49gi|501009150|ref|WP_012062054.1| flagellar biosynthesis protein FliS [Alkaliphilus metalliredigens]  clstr ali  19  3MQNPYQQYKQNSVMTASPQELTLMLYNGALKFINVSKKNIDEKNIAKANESIQRVQSIIQELNITLDMNYEVSKNLRSLYTYILERLVDANMQKDMNALEEAAQMITELRDTWKDAMKQAR.................................... 123
152 3.000e-49gi|551041191|ref|WP_022784832.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium NK4A179]  clstr ali  22  3.KNPYEQYKNNAIATATPAELTLMLYEGAIKFGNIAIKAIEEGDIQKAHTNIMKVQRIISEFRNTLDFKYPVAKDFDRVYEYLERRLVEANVSKDKEIMEEMVMHIRSMRDNWKEVMKRAKQPQSA............................... 127
154 3.000e-49gi|489446590|ref|WP_003352007.1| flagellar biosynthesis protein FliS [Bacillus methanolicus]  clstr ali  20  8.....QVYKQNSVSTASPGELTLMLYNGCLKFLAKMKQAIIEKNISERNVNSQKAQRIIQELMVTLNQEYEVAKQMMAMYDYMNRRLIEANVKNDVAIVEEVEGFVTEFRDTWKEVIRLNRQKQF................................ 127
155 4.000e-49gi|652814066|ref|WP_027105604.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium V9D3004]  clstr ali  21  3.NNAANSYKNNKIMTATPAELTLMLYDGAVKFCNIALMAFEKNDYTKVNDNIIKVENIITEFRSTLDFKYPVANDFEVVYDYIYRRLVDANIKKDPEILNEALKYIKEMRETWQEVMKINKNQ.................................. 124
156 4.000e-49gi|503127878|ref|WP_013362539.1| flagellar biosynthesis protein FliS [[Clostridium] sticklandii]  clstr ali  16  3MNNPYAKYKEQSVTTATPEELTLMLYNGCIKFINLAEVYIEEKDYAKSNLNIQKAQGIIQELNITLNMDYEISQNLRQLYTFVNEKLLDANIKKDKQALFDAKEIVSDLRDTWKEAMALSRKG.................................. 125
160 5.000e-49gi|717926940|gb|KGX86305.1| flagellar biosynthesis protein FliS [Pontibacillus litoralis JSM 072002]  clstr ali  20  3.TQVHEKYQNNSIQTASPSELTLMLYNGCLKFIKLAKRGIEEGNYESKNMYIQKAQNIVSELMITMDPEYEITKQIMPLYEYLNHRLLEANMQNDVKILDEVEGFVVEFRDTWKEVIKLTKNQQ................................. 125
161 5.000e-49JGI.Meta JGI_HUM.0454210 7058202701 SRS049959_WUGC_scaffold_28224__gene_53652 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  19  5..NAYAQYNNSKVLTASPAELTLMLYEGAIKFCNVAIDAVERKDIAKAHTNIVKVENIIDYLRKTLDMKYPVAQDFERMYVYLDQRLVEANVKKDVEILEEIRDHLHAIRDNWKEVMRVNREK.................................. 125
164 6.000e-49JGI.Meta JGI_HUM.1597361 7027265228 C5287224__gene_287182 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765074482]  ali  18  24.QRAINAYQKNAIMTASKAELTLMLYDGAIKFCNIALSGFENKDYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAG.................................. 145
165 6.000e-49gi|671534319|ref|WP_031518062.1| flagellar biosynthesis protein FliS [Desulfotomaculum alkaliphilum]  clstr ali  22  5..NPYAQYQQNAVNSADPGQLTLMLYNGALKFNKQAMVQLEAKNIEQTNYYIQRVQDIITELMVSLNQEYEISKNLLSLYDYINRRLVDANVKKDMAILEEVQGMLEELRNTWAEALKQVK.................................... 123
167 7.000e-49gi|655378615|ref|WP_028783761.1| flagellar biosynthesis protein FliS [Thalassobacillus devorans]  clstr ali  19  4.....QAYQTNAVETASPGELTLMLYNGCLKFIKLAGKAIDNKDYEQKNINIQKAQKIIQELLVTLDPDISISKEIMPLYDYINRRLLDANLKNDAAILEEANELVGELRVTWKEVLRRTRQGQFGKGGSA.......................... 129
171 7.000e-49gi|651366683|ref|WP_026478988.1| flagellar biosynthesis protein FliS [Alkaliphilus transvaalensis]  clstr ali  19  1MQNPYSQYKENSIKTASPQELTLMLYNGALKFINQGKLFIEQKNFASANEALKRAQDVITELNITLDMNYEISQNLRGLYTYLLDQVIEANITKNIAPLDEAASMVTELRDTWKEAMKLAK.................................... 121
172 7.000e-49gi|656062496|ref|WP_029100289.1| flagellar biosynthesis protein FliS [Brevibacillus thermoruber]  clstr ali  25  3MYNPVQAYQTNSINTASPGELTLMLYNGAIKFIKQAKAAISEKNIGQAHEYNLRVQDILNELIVTLDRSYPISDQLYQMYDYMLRRMIDANVRKDISILDEVEDFFVQFRDVWKQAMVLAKNQ.................................. 125
174 8.000e-49gi|548310300|ref|WP_022500812.1| putative uncharacterized protein [Firmicutes bacterium CAG:95]  clstr ali  18  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYTYLQQRLAQANIKKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
176 8.000e-49T2D.3732081 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  15MNAGYQQYEKNKILTASPAELTLMLYDGAIKYANIAIMAIDKGDVEKAHNSIRRVERIIEEFQNTLDFKYPVAKDFDEVYKYIRTRLREANVKKDKEIIEEVLKHLRTMRDTWKEVIQLSRN................................... 138
178 9.000e-49gi|502886625|ref|WP_013121601.1| flagellar biosynthesis protein FliS [Thermincola potens]  clstr ali  23  1MQNPYSQYKQISVQTASPEQLVVMLYDGAIKFLHLAKEAVARKNMEDTNKYIGKTQDIINEFIVSLDMSAEIAHNLYNIYDYWNRRLIQANIKKDPDIIAEVLGQVQELREVWAEAAVKSKEG.................................. 125
179 1.000e-48gi|547246858|ref|WP_021982582.1| flagellar biosynthetic protein FliS [Eubacterium sp. CAG:603]  clstr ali  21  5..NPYANYANTKIQTATPAQLTLMLYDGAIKFCNLAINAVEEGQIEMANTNIKKVEAIIAEFRATLNFKYPVAKDFDNVYEYLGRRLLEANLHKDKEILEEVLSHLRVMRETWTEVMKQSK.................................... 123
180 1.000e-48gi|657824676|ref|WP_029541219.1| flagellar biosynthesis protein FliS [Selenomonas ruminantium]  clstr ali  20  1MVNAAEAYRRQQIMTATPEALTLMLYNGCLKFINEGTEAIERKDYEQANISLQKAQNIISEFRITLNMDYEISHQLMPLYNYCYDRLVEGNLKNDTKQIGEAKDIITELRDAWAQAMKKARQEKQPQKA............................ 129
181 1.000e-48gi|503548211|ref|WP_013782287.1| flagellar biosynthesis protein FliS [Mahella australiensis]  clstr ali  21  3LNNPYHQYQQNSIMTASPGDLILMLYDGAIKFIKQAKVYIDEKDMQKANNAILKAEDIVAELMADLDPAYDISHDLYSLYEFINDCLVRANIKKDKVLLDQSLDLISDMRQTWAQVVKQYR--------QQEYAGI..................... 130
182 1.000e-48gi|656248297|ref|WP_029194907.1| flagellar biosynthesis protein FliS [Paenibacillus alginolyticus]  clstr ali  25  1MIQPARNYKQNQVETAPSEELTLMLYNGAITFVKRAKQAIEKKDFNFAHQHNIRVQDIVDELIITLDRKYPISEQLLSLYDYMKRRLIEANISKDTAILDEVESFFVEFRDTWKQAMTLARSQ.................................. 124
183 1.000e-48gi|652787766|ref|WP_027092636.1| flagellar biosynthesis protein FliS [Cohnella thermotolerans]  clstr ali  20  1MITPQDQYLMMQVQTASPGELTLMLYNGCIRFLKLALAGIEAKDAANKHLNIIKAQNILEELQSTLNMNYEISANLFSLYDFIRSQLIHANLHMDAESIRTCIGLMTELRDTWAQAVKQVKSGQ................................. 124
184 1.000e-48JGI.Meta JGI_HUM.1923324 7068730639 SRS015065_WUGC_scaffold_32618__gene_82136 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  18  9..SAYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAELSVEKNDIPRAHENIRKVQNIIGYLHSTLDMKYEVSKDFDNIYSYLERRLVEANVKKDKEILEEINTHLHSIRDNWKEVMK....................................... 124
185 1.000e-48gi|490756810|ref|WP_004619108.1| flagellar biosynthesis protein FliS [[Clostridium] papyrosolvens]  clstr ali  19  4.NNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDQRKIERANNSIIRAQDIVREFQVTLDMKYEVSKHLDSIYDYMYRRLIQANIKKDKAILEEMLEMAKDLRDTWTQAMKLAKRQ.................................. 125
186 1.000e-48gi|517983601|ref|WP_019153809.1| flagellar biosynthesis protein FliS [Bacillus massiliosenegalensis]  clstr ali  19  4.QQVQNAYKQNSVNTASPGELTLMLYNGCLKFLQKGKQAMKDKNIEEKNKNLQKAQKIIQELMITLNQDYGIAKEMMQMYEYMNRRLIDANVQNSVEILEEVEGYVNEFRDTWKEVIRLNRQKLYQGNQ............................ 131
187 1.000e-48gi|667771721|ref|WP_031391062.1| flagellar biosynthesis protein FliS [Clostridium sp. KNHs209]  clstr ali  19  5..NGYAQYNNNQVLTASPAELTLMLYNGAIKFCNIAIAAIEKKEIEKAHINIVKVEKIVEYMRITLDMKYPIAQDFDNIYAYLDRRLVEANVKKDIGILEEVCEHFRSVRDTWKEVMRLNKEK.................................. 125
188 1.000e-48gi|654955697|ref|WP_028405610.1| flagellar biosynthesis protein FliS [Bacillus sp. J13]  clstr ali  19  1MQQAVNRYYETQIKTATPEELTLMLYNGCIRFLKQAQISIANKDYKSKNLNITKAINIIDELQVTLDMKYDISQNLASLYEFFKQRLVFASMRLDQDVLQEVIDMVTDLRDTWHEAIKMVKQQ.................................. 123
189 1.000e-48gi|501110735|ref|WP_012160328.1| flagellar biosynthesis protein FliS [Alkaliphilus oremlandii]  clstr ali  19  3MNNPYGQYKQNSVMTASPQELTLMLYNGALKFIGMAKINIQEKDIPKANESIKRAQDIIQELNITLNMDYPISTNLRSMYTYILEKLVDGNIYKEIQYLDEAAEIITELRDTWKEAMKISKGG.................................. 125
190 1.000e-48gi|504023012|ref|WP_014257006.1| flagellar biosynthesis protein FliS [[Clostridium] clariflavum]  clstr ali  23  4.NNGYEQYRESSVYTATPEELVLMLYNGLVKFLMQAQMAINKKNIEKANNCIIKAQNILTEFRCTLDMKYDIAHQLDSLYDYMLSRLIDANIKKDNTIIEEILGYARELRNTWEQAMKIAKQQ.................................. 125
192 2.000e-48gi|502257470|ref|WP_012744009.1| flagellar biosynthesis protein FliS [Eubacterium rectale]  clstr ali  18  5..KGYAVYANSKVQTASPAELTLMLYEAAIKFCNIAEMAIEKNDIQKAHDNIKKVEAIIEEFQATLNHKYPVAKDFDKVYTYLMQRLVEANIKKDTKILDEVLEHLRTMRDAWKEVMR....................................... 120
195 2.000e-48T2D.2752953 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  19  6...AYAQYNNSKVLTASPAELTLMLYEGAIKFCNIAIMAIEKKDIEKSHINIVKVENIINYLQSTLDTKYPVSEDYDRIYSYLQQRLAQANIRKDPEILEEVCEHLRSVRDTWKEVMAKNQ.................................... 123
196 2.000e-48gi|547292492|ref|WP_022025252.1| flagellar protein FliS [Clostridium sp. CAG:75]  clstr ali  21  5.NKAAMQYQRNAIQTASPAKLTLMLYDGAIKFANMAIEAIDKGDIEKANNNIIKVQNIIVEFRSTLDMKYPVAKDFEVVYDYIYRRLVEANVKKDKAVLEDALHHIKTMRETWKEVMRINN.................................... 124
199 2.000e-48gi|498366998|ref|WP_010681154.1| flagellar biosynthesis protein FliS [Acetivibrio cellulolyticus]  clstr ali  21  4.NNAYDQYKENSVYTASPEELTLMLYNGLVKFLMQSQMGINEKNIEKANNCIIKAQNIISEFRCTLDMKYEISKQLELIYDYMNRRLIEANIKKDVTIVEEILGYARELRNTWEQAMKIARQQ.................................. 125
201 2.000e-48gi|655914244|ref|WP_028984361.1| flagellar biosynthesis protein FliS [Sporolactobacillus terrae]  clstr ali  21  5..SAYKSYQQNSVLTATPGELTLMLYNGCIKFIRQAKLAMEQDKIEEKNTYIQKAQKIIRELMVTLDQKQQVAQSMMQMYDYMNRRLIDANIKSDPLILDEVEGYAVDFRDTWKQVIEITQKNQ................................. 126
202 2.000e-48gi|547727493|ref|WP_022141663.1| flagellar protein FliS [Clostridium sp. CAG:230]  clstr ali  19  5.RNAAQLYQKNSVQTASPSKIILMLYDGAIKFCHMAQVAIDEKNIEKANLNIQKAQKIIVQLRVSLDTKYPVSQEFDKVYDYIYRRLVEANMKKDNEILEEALKHIKTMRETWIEVMKKTHS................................... 125
204 3.000e-48gi|649360825|gb|KDR94773.1| flagellar protein FliS [ [[Clostridium] litorale DSM 5388]  clstr ali  19  3MANPHLKYQQQAVMTAPPEELTLMLYDGCVKFLSRAEIGLEDNNIEMINNNLVKAQNIISELNSTLNMDYEVSKGLRPIYNYLHSRLLDANIKKDRAIVEEVKGFIIELRDTWKEAMKIAR.................................... 123
205 3.000e-48gi|499663175|ref|WP_011343909.1| flagellar biosynthesis protein FliS [Carboxydothermus hydrogenoformans]  clstr ali  23  1MNNPYAQYQTQNIATAPPEKLLIMLYDGAIKFLKQGLKALDEKKYDDFSYYISRTQDIISELMVTLDMDYEISKNLYQLYDYFMYRLIHGNVKKDRQSIEEVQKHLEELRETWVQAA........................................ 117
207 3.000e-48gi|499379315|ref|WP_011066893.1| flagellar biosynthesis protein FliS [Oceanobacillus iheyensis]  clstr ali  22  4.NNAYQVYQNNSVNTASNGELTLMLYNGCMKFIKQAKKDMEADNFAEKNKNIQKAQNIIQELMITLDAKMDISKQILPLYEYMQYQLKEANIHNDTSKLDEVLGFVTEFRDTWKQVIIKNRQQQYNEGA............................ 131
208 3.000e-48JGI.Meta JGI_HUM.1111735 7078983616 C3331390__gene_218949 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 763678604]  ali  16  16..NGYAAYANSKIMTASPAELTLMLYDGAIKFCNIAIAGIEENNIEKAHNNIRKVENIISEFQATLNHKYATADDFNNVYVYLKERLIEANMKKDKEILEEVLKHLRTMRDTWKEVMKLAAGQ.................................. 136
209 3.000e-48gi|654495559|ref|WP_027965387.1| flagellar biosynthesis protein FliS [Halalkalibacillus halophilus]  clstr ali  20  5..QAYQAYQENSISTASPEQLTLQLYNGCIKFIKLSKRAIENESIEEKNINIQKAQNIISELRATLNMDYDISHQLMPLYEYINHRLTQANFKSDVSMLNEAQQMVEQFRDTWKEVMKANRVQSQKAGVQ........................... 132
210 3.000e-48gi|647634227|ref|WP_025907032.1| flagellar biosynthesis protein FliS [Bacillus flexus]  clstr ali  17  4..NPYQAYQQGAVQTASPGELTLMLYNGCIKFIKMARIGFEQHNIEAKNENLLKAQKIIQELMVTLDTSAAVGKEMMAMYDYMNQRLIEANVQNRVELLDEVEGYAVEFRDTWKQVIQMNRKQTHGSGGQA.......................... 132
211 4.000e-48T2D.3823258 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  20  1MNNGYAAYANSKIMTATPAELTLMLYEGAIKFCNIAIMGIEEKDIEKTHNNIKKVENIITEFQVTLDHKYPVADDFDNVYKYLKDRLLEANVKKDKDILEEVLGHLRTMRDTWK........................................... 116
212 4.000e-48gi|497214887|ref|WP_009529149.1| flagellar biosynthesis protein FliS [Peptostreptococcaceae bacterium CM5]  clstr ali  19  4..NPYAKYKENSINTASKEELTLMLYDGCIKFMNLAKIAIEEKNIQKANDNLLKAQAIVTELDITLNMDIEISKNLHSLYDFVQNRLIEANLTKKASFVDEAKLIITDLRDAWKEAINLVRRG.................................. 124
213 4.000e-48gi|547940564|ref|WP_022341918.1| flagellar protein FliS [Roseburia sp. CAG:309]  clstr ali  17  3.QRAINAYQRNAVMTASKAELTLMLYDGAIKFCNIALSGFEKKEYEKINTNLKKAQAIITEFRATLDHKYPVWEDFERVYDYIYRCLIDANIHKDEEKLQEALKYIREMRDTWKEVMRLNKAGS................................. 125
215 4.000e-48gi|497332127|ref|WP_009646340.1| flagellar biosynthesis protein FliS [Selenomonas sp. CM52]  clstr ali  22  3.NAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKKDYESANNSIIKAEKIITEFRVTLDFDYEISHQLLPLYNYVYDCLVQGNLSSDTGKIDEAAGIIRELRDAWAQAMKKARAE.................................. 124
216 4.000e-48gi|489243206|ref|WP_003151407.1| MULTISPECIES: flagellar biosynthesis protein FliS [Bacillus]  clstr ali  15  4.NNPFAAYQQTSVFTAAPEELTLMLYNGCLRFIKLARQAMKQNNLEAKNENIVKAQNIIQELSITLNREIEISEQMSSIYDYIRRRLIDANVQNNGEFLDEAEKLVTEFRDTWKQAMQSERK................................... 124
218 4.000e-48gi|497211720|ref|WP_009525982.1| flagellar biosynthesis protein FliS [Peptostreptococcaceae bacterium ACC19a]  clstr ali  17  4..NPYAKYKENSVNTATKEELTLMLYDGCIKFMNLAKIGIEEKNIEKANDNLLKAQAIITELDITLNMDIEISKNMHSLYDFALSRLVDANLKKDASLIDDAKSVIVDLRDAWKEAMNIVKRG.................................. 124
219 5.000e-48gi|718347374|emb|CEI81201.1| Flagellar protein FliS [Oceanobacillus oncorhynchi]  clstr ali  18  4.NKAYQTYQNNAVNTASGGELTLMLYNGCIKFIKQARKEMDNDHFAAKNTNIQKAQKIINELMVTLDMNMEISHQMMPLYDYMHNLLTEANIKNDTEKLEEALSYAEEFRDVWKQVILKDRQQKYSQGA............................ 131
221 6.000e-48T2D.3731737 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  4.NQGYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKNDIQKAHTNIIKTERIIIEFQSTLDEKYPVAKDFNAVYTYLIRRLRDANIKKDAEILEEVLKHLRTMRDAWKEVMAKTANG.................................. 125
222 6.000e-48gi|499202201|ref|WP_010899741.1| flagellar biosynthesis protein FliS [Bacillus halodurans]  clstr ali  16  3MKNPYQTYQTNKVETSSPAELTLMLYNGCLKFISQAQHAIENNAIEEKNTHLQKAQNIIRELMVTLKGDTELGKNMLALYDFILNRLTEANLENNLTKLSEAEDLVKQFRDTWKEALQIDRKKRHGNGGEA.......................... 133
224 6.000e-48gi|506236525|ref|WP_015756300.1| flagellar biosynthesis protein FliS [Desulfotomaculum acetoxidans]  clstr ali  20  5..NPYQQYQQNSITSAKPGQLTLMLYNGAIKFIKTAILGMEKKDIGTANGAVIRAQEIIRYLDHTLDPQYEISQNLSSLYDYIYRRLVEANINKNAAVLEEVVSMVEELRDTWMSVLKKT..................................... 122
225 6.000e-48gi|635344655|emb|CDQ26193.1| Flagellar protein FliS [Halobacillus trueperi]  clstr ali  20  4.....QAYQNNSVETASPGELTLMLYNGCIKFIKVAGKAMENNEIEKKNTHIQKAQKIIQELMVTMDQQYSLTQEIMPLYDYMNRRLMEANTKNDNEILDEVLGLVEEFRNTWKQVILEARKAQYGQGG............................ 127
231 7.000e-48gi|551037069|ref|WP_022780814.1| MULTISPECIES: flagellar biosynthesis protein FliS [unclassified Lachnospiraceae]  clstr ali  20  5..NPYAQYKNSKILTASPAELTLMLYEGAIKFGNIAIEAIENKEIEKAHNNIIRVQKIIDEFRATLNRKYPVAEEFDKIYRYLLRRLLEANATKDEEIMKEVVEHLRSMRDNWKEVMKKVKEE.................................. 125
233 7.000e-48gi|517953062|ref|WP_019123270.1| hypothetical protein [Brevibacillus massiliensis]  clstr ali  21  2LQNPAQVYQNNQVTTATPGELTLMLYNGAIRFIKQTRQAILDKKLEKAHECNIRVQDILHELMSSLNRDVPISEQFITMYDYMLRRMVEANVRKDVEILDEVESLFGEFRDTWKEAMILAKKQ.................................. 124
234 7.000e-48METAHIT MH0023 GL0002506 [Complete] locus=scaffold7399_1:2107:2493:-  ali  20  6...AYAQYNNSKVLTASPAELTLMLYDGAIKFCNIAEMAVEKSDVPKAHENIRKVQNIIGYLHSTLDMKYEVAKDFDNIYNYLERRLVEANVKKDKEILEEINMHLHSIRDNWKEVMK....................................... 120
238 1.000e-47gi|518372553|ref|WP_019542760.1| flagellar biosynthesis protein FliS [Selenomonas bovis]  clstr ali  21  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGIQGVKEKQWEAANNSLQKAQSIISEFRITLDMDYEISHQLMPLYNYTYDRLVEGNIKSDVAMLEEAKGIIKELRDAWAQAMKKARKEKGTQGVQ........................... 131
240 1.000e-47gi|651996699|ref|WP_026700734.1| flagellar biosynthesis protein FliS [Bacillus aidingensis]  clstr ali  20  7.KQAANPYQQNALDTASSGDLTLLLYNGCIKFIDKADKAMEENNIEDKNKFIKRAQDIIRELMITLKTDSDIGQNMYSLYDFIHRRLIDANVQNDREALQEARGFVVDFRDTWKEIIKLDRQQRFGEGGQA.......................... 136
241 1.000e-47gi|653088798|ref|WP_027339040.1| flagellar biosynthesis protein FliS [Halonatronum saccharophilum]  clstr ali  21  4.NNPYQKYKSTKYETASPEKLLLMLYEGGIRFAKRGKIAMEKKDIQEVNKSLQKVQQVINELMVTLNMDKEISQNLYSLYEYINRRLIEANIKKDPLILDEVINLLTELKEGWEEASKKVNN................................... 126
242 1.000e-47gi|653619916|ref|WP_027630251.1| flagellar biosynthesis protein FliS [[Clostridium] cellobioparum]  clstr ali  20  4.NNGYDQYKSNSINTATPEELTMMLYNGLVKFLMQAQSAIDAKNIERANNSIIKAQAIIIEFMTTLDMNYEVSQNLELLYDYMYRQLTQANLKKDNVIVGDVLGMAKELRDAWSQAMKLAKHPAPVQ.............................. 129
243 1.000e-47gi|547967479|ref|WP_022367455.1| flagellar biosynthetic protein FliS [Firmicutes bacterium CAG:882]  clstr ali  18  1MNTPYQQYEKSKILTASPAELTLMLYEGAIKFANIAVMAIEKGDVEKAHNNIRKVERIIEEFQVTLNHKYPVAKDFDEVYKYLQQRLLEANIKKDKVIMEEVLRHLRTMRDTWKDVMRLAKTQ.................................. 125
244 1.000e-47gi|547467121|ref|WP_022086057.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:197]  clstr ali  18  4.NQAYAAYNNSKILTASPAELTLMLYDGAIKFTNIAIMAIEKHDIEKAHNNIVKTERIILEFQATLDDKYPVAKDFDAVYTYLIQRLREANLKKDSEILEEVLKHLRTMRDTWKEVMAKA..................................... 122
245 1.000e-47JGI.Meta JGI_HUM.0590400 7070285893 C4471001__gene_327217 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 2 of subject 16015  ali  16  2..NPYAKYKENSINTATKEELTLMLYDGCIKFMNLAKIGIEEKNIQKANDNLLKAQAIITELDVTLNMDIEISKNMHSLYDFALSRLVDANLKKDTSFIDDAKIVIVDLRDAWKEAMNIVKRG.................................. 122
246 1.000e-47gi|547564974|ref|WP_022111733.1| flagellar protein FliS [Roseburia intestinalis CAG:13]  clstr ali  15  4.NRGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVERIIEEFQSTLNHKYPVAKDFDEVYNYLLVHLQEANIKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
247 1.000e-47JGI.Meta JGI_HUM.1768320 7012167621 SRS055378_LANL_scaffold_76977__gene_92803 flagellar protein fliS [Human Supragingival plaque microbiome from visit numbe  ali  23  3.NNAAEVYKKQQVMTATPEALTLMLYNGCLKFIKEGLEALDEKNYENANIFFQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKGDPAIIKEADDIMLGLRDAWSGAMKKAREEKGMQGAEGVYAG...................... 138
248 2.000e-47gi|639198127|ref|WP_024536572.1| flagellar biosynthesis protein FliS [Sporosarcina sp. EUR3 2.2.2]  clstr ali  20  5..NPYQAYQQNSVMTASPQELTLMLYNGCLKFIKLAKKAMADNKYEDKNTNMIKAQAIIQELRYTLDPDIELSASMAQLYDYMYNRLVEANMKNDAVVLEEVEGYVVELRDTWKQAMSQMKN................................... 124
249 2.000e-47gi|501153642|ref|WP_012198343.1| flagellar biosynthesis protein FliS [Lachnoclostridium phytofermentans]  clstr ali  19  3.QNAASIYQGTKINTASPAELTLMLYEGAIKFCNKALYGLEQNDIAKVNENLLKAQKIVTELRSTLDFKHPIAREFDTVYDYINRRLVDANIKKDTEILEEALDYIRQMRDTWKEVMKKNN.................................... 122
250 2.000e-47gi|660643759|gb|KEO84074.1| flagellar biosynthesis protein FliS [Tumebacillus flagellatus]  clstr ali  20  2MKNPYQSYSNTQAMTATPGELTLMLFNGAIRFLKQASIGLEDKDYETVNTNLLKAQNILLELMSTLKMEYEVAQGLMPLYQFMYEQLVQANIKKNQTPIQDVIGLLEELRDTWNEAIKLARVQQ................................. 125
251 2.000e-47JGI.Meta JGI_HUM.1204670 7037942878 SRS014923_WUGC_scaffold_59614__gene_126629 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject  ali  15  4.NKGYAAYANNKVMTASPAELTLMLYEGAIKFANIAIEAIEAKDIQKAHDNIMKVEHIIEEFQSTLNHKYPVAKDFDEVYNYLMMRLQEANMKKDKEIMEEVLKHLRTMRDTWKQVMKLAHTQQ................................. 126
252 2.000e-47gi|493689193|ref|WP_006639249.1| flagellar protein FliS [Bacillus sonorensis]  clstr ali  19  3LNNPYAAYQQNSINMKSPGELTLMLYDGCLKFMKLAKQAMEQGDMEMKNTNLVKAQKIIQELNLTLNREVELSQSMGAMYEYIHRRLIEANINNDQDIVSEVEGYVNDFRDAWKQAIQIERQGRY................................ 127
253 2.000e-47gi|652569574|ref|WP_026962968.1| hypothetical protein [Alicyclobacillus herbarius]  clstr ali  22  1MMNPYAAYRQTSIQTASRERLLIMLYDGLITALERAQVALESGDVATSHQQLVKAQEIIRELWGPLDMQYEISKSLASLYEYFHRRLVEANLKKDAAPVVEVLEHVRGLRETWVQAAAKSRQEQ................................. 125
255 2.000e-47gi|492391867|ref|WP_005829829.1| flagellin-specific chaperone FliS [Brevibacillus agri]  clstr ali  25  4.QQSLQAYQTNSVNTANPGELTLMLYNGALKFLKQSKAAIAEKKFDKANEYNKRVQDIVGELMVTLDQKYPIAQQMMSLYEYMQTRLIEANLKKETSILDEVEGLLTQFRDTWKQAMVLAKTQ.................................. 125
259 2.000e-47gi|506403703|ref|WP_015923422.1| flagellar biosynthesis protein FliS [Halothermothrix orenii]  clstr ali  17  4..NPYQKYKKTRFETANREKLILMLYEGAIKSLNHAKKGMEEDNIELINESLKKSQDIINELMVSLNPEAEIATNLYSLYDYMQRRLIEANLKKEIEPVKEVKKMVEELHETWKEAMLQVHKTKYAGQKKQ.......................... 133
260 2.000e-47JGI.Meta JGI_HUM.6623804 7006916546 SRS063215_LANL_scaffold_23823__gene_27119 flagellar protein fliS [Human Subgingival plaque microbiome from visit number  ali  19  4.NSAAEAYKKQQVLTATPEALTLMLYNGCLKFIKEGVDALAEKKYENANICLQKAQNIISEFRVTLNMDYEISHQLLPLYNYAYDRLVEGNMKSDPAIIQEATDIITELRDAWVQAMKTAREEKGAQGMEGVYAG...................... 139
262 3.000e-47gi|503138713|ref|WP_013373374.1| flagellar biosynthesis protein FliS [Paenibacillus polymyxa]  clstr ali  21  3.TSPYEKYRQSSVQTSTPSQLVVMLYDGAIRFVKAGLVALDSKDYQKVNLNLGKAQTIISELMSTLDHSYDISKSLFALYEYMNYLLIQANIKKSADPANEALGYLTELRETWVQASKLTAGAA................................. 125
263 3.000e-47gi|647411307|ref|WP_025786023.1| flagellar biosynthesis protein FliS [Sporosarcina sp. D27]  clstr ali  22  3MHNPYATYQNNSVTTSTPGELTLMLYNGCLKFIEQAKRAADLGQIEQKNTAVQKAQAIISELMITLDASFPVAKDMLVLYEFANSRLVDGNIKNDAKLFDEAAEIITEFRDTWKQVIQLNRQKQY................................ 127
264 3.000e-47gi|654670062|ref|WP_028129579.1| flagellar biosynthesis protein FliS [Selenomonas sp. AE3005]  clstr ali  20  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMNEGKDAVEAKQYENANNLLQRAQQIISEFRITLNMDYEISHQLMPLYNYCYDRLVEGNIKSDTAMIQEAIDIIKELRDAWAQAMKKARQDGGTKNVQ........................... 131
265 3.000e-47gi|656012561|ref|WP_029052510.1| flagellar biosynthesis protein FliS [Sporosarcina ureae]  clstr ali  20  4.NNPYATYQNNSVITSTPGELTLMLYNGCLKFIQQAKMELAKGNLEQKNIAIQKAQAIVTELMLTLDTSYDVSKNMLVLYEFVNSRLIDGNIQNDPAMFEEAAGIITEFRDTWKQVIQINRTKQY................................ 127
266 3.000e-47gi|511038544|ref|WP_016292562.1| flagellar protein FliS [Lachnospiraceae bacterium 28-4]  clstr ali  19  5..NRYEQYSSNKVMTASPAELTLMLYEGAIKFCNIAIMGLEQSDIEKAHNNMIKTEKIIRYLRETLDMKYPVAQEFENIYVYLDRRLVEANMKKDKEILDEICEHLRSVRDTWKEVMRINREK.................................. 125
267 3.000e-47gi|671563641|ref|WP_031544064.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium AC2014]  clstr ali  17  4.QQAFNAYNNSKILTASPAELTLMLYDGAIKFTNIAILALEKKDIEKAHNNIRKTERIVIEFQTSLDHKYEVAKDFEKVYLYLISRLREANIKKDAEILEEVLKHLRTMRDTWKEVMTIAGNG.................................. 125
268 3.000e-47gi|489639562|ref|WP_003544002.1| flagellar biosynthesis protein FliS [Desulfotomaculum nigrificans]  clstr ali  19  4.KNPYQNYQQNAIMSAGPEELTTMLYNRLVKDLKLAREHVENRDIEGAHSSIVHAQDILSHLMHTLDTSYEVGQNLMAMYDYMYRCLVQANLKKDANLIQEVTGYAEEIRDTWIQAVKLAKSSAAMGN............................. 130
269 3.000e-47gi|494500710|ref|WP_007290173.1| flagellar biosynthesis protein FliS [Thermosinus carboxydivorans]  clstr ali  21  1MNNMANAYKTQQIMTAPPEQLTLMLYNGAIKFVDESIQAIEQRDFPKAHASNLRAQDIVRELMVTLDMQYEIAKTWYQLYDYILYRLIQGNIKKDKDQLQEARGMLQEFRDTWVEAMKRARAGQAAVG-QAV......................... 133
270 3.000e-47gi|517490146|ref|WP_018660723.1| flagellar biosynthesis protein FliS [Bacillus acidiproducens]  clstr ali  17  4.QNPYQAYQNNSISTASAGELTLMLYNGCLKFIHLARVAMQNKNIEEKNKNIQKAQNIIRELMVSLDTEKAAAEKMLAIYEFMLHELIAANIKNDPGKLDTVEELVTGFRDTWKQVIQLNRRQ.................................. 126
271 3.000e-47gi|648228602|ref|WP_026009751.1| flagellar biosynthesis protein FliS [Bacillus endophyticus]  clstr ali  20  3MNNAYQAYQQGSVNTATPGELTLMLYNGCLKFIRRAKTAIENREVEEKNKNLIKAQNIITELMVTLRTGSELSDQMRTMYDYINQRLMKANIESSVDILEEVESYVMEFRDTWKEVIQKTRS................................... 124
273 4.000e-47T2D.3728574 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  22  4LRNAANIYQQNAINTASPARLTLMLYEGAIRFCNIAREAMAEDDYEKINTNVKKAQNIIVELRSTLDMKYPVAKEFDNVYDYVYRRLYEANMQKDMEAMDEVIKHLKTMRDTWKEVMKINH.................................... 127
274 4.000e-47gi|489558106|ref|WP_003462653.1| flagellar protein FliS [Gracilibacillus halophilus]  clstr ali  16  4..QQYQAYQNNSVETASPSELTLMLYNGCIKFIKQAKKAIDEGNIQDRNNYIQRAQNIIRELMVTLDQDAPIAQEIMPLYDFVHYNLTQGNVNNNKEALQEAEDIVVDFRDTWKEVIKQERKRTYGQGT............................ 130
275 4.000e-47gi|495157836|ref|WP_007882639.1| MULTISPECIES: flagellar biosynthesis protein FliS [Roseburia]  clstr ali  16  4.NQGYAAYANNKIMTASPAELTLMLYEGAIKFANLAITAIEEKNIEKAHINIVKVEHIIEEFQATLNHKYPVAKDFDEVYSYLMNRLREANMKKDKEIMEEVLKHLRTMRDTWKEVMRTGRT................................... 124
277 4.000e-47JGI.Meta JGI_HUM.3714688 7067123043 C2907313__gene_160437 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 3 of subject 763536994] :  ali  35  2LTKERKQVYTRRITEANRTQLITIVYELAMEYMDEAIEAEKKSDLTAFADGLRHADACVDDLLKALDMKYDLSENLRELYLYVKKQLICASGKRDLESLKEARQIMENLHRAWKQIESKDSSPPEFKNKQTVYAGLTYGKGTLKESIEGDTNRGIQA 159
278 4.000e-47gi|518207541|ref|WP_019377749.1| flagellar biosynthesis protein FliS [Virgibacillus halodenitrificans]  clstr ali  21  3LNKQYQTYQNNAVNTASGGELTLMLYNGCMKFIKQAIKDLENKNYEAKNTNIQKAQNIIQELMLTLDQKVEISKQILPLYEFMQFQLREGNIKNDPSLLIEALEFITEFRDTWKEVMLKNKKAQPVQGAQ........................... 132
280 5.000e-47gi|490200466|ref|WP_004098960.1| flagellar biosynthesis protein FliS [Acetonema longum]  clstr ali  18  7....ANAYKNQQIMTASPEELTLMLYNGALKFMTESVQAIEEKKYEKAHETNIRSQNIIREFMTTLDMQYELSHNLYEIYDYMHRSLIEANLKKDAAKLKEIRDLLRELRDAWAEAMKRARQDRV................................ 127
281 5.000e-47gi|517547152|ref|WP_018717360.1| hypothetical protein [Arhodomonas aquaeolei]  clstr ali  18  1MTYGVNAYQQSGANYADPWQLTAMLFNGGLERVAQARGAMERGDVAVKGERIGKAIGILDGLRASLNHEEELASNLDSLYEYMQRRLVAANAHNDLTALDEVATLLREIKEGWDGIPAEARNAPGQQNAQA.......................... 136
282 6.000e-47JGI.Meta JGI_HUM.3635082 7032392602 SRS023914_Baylor_scaffold_10072__gene_26124 flagellar protein fliS [Human Stool microbiome from visit number 2 of subjec  ali  30  28MTNELIKTFQYRITQATASQLVVILYDLADRYLEDACESDEEMQI---RDNIYMSGKVIDQLISGLDMQYEVSANLFVIYNHIKRTLISVSVNLNKAELKRVRGLLKNLRESFYEVSKQDTSEPLMKNTQTVYSGLTYSRGGINETQTDNENRGFRV 183
283 6.000e-47gi|691636294|gb|KGF81303.1| flagellar biosynthesis protein FliS [Massilia sp. JS1662]  clstr ali  20  5MKRGVNAYHETGIASASPHKLIVMLYDGALVALLSAKTNIAAGNIAAKGSAISKAISIIDGLRASLDKNAEIAANLDALYDYMSRRLLHANLKNDVTIIDEVHGLLNDLRGAWVEIGDKVQQPPVA............................... 137
284 7.000e-47gi|495707141|ref|WP_008431720.1| flagellar biosynthesis protein FliS [Planococcus donghaensis]  clstr ali  19  5..NPYQTYQQNSVMTASPQELTLMLYNGCLKFMKLAKRAMADKKIEEKNTNIIKAQNIIQELRSTLKADIEMSAGLEQMYEYMYSRLVEANMKNDVSALEEVEELMTDIRNTWKQAMALVKK................................... 124
285 7.000e-47gi|517760788|ref|WP_018930996.1| hypothetical protein [Gracilibacillus lacisalsi]  clstr ali  19  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQAKKAIESQNHQSKNEMIQKTQDIIRELMVTLDQDAPIANEIMPLYDFVYHALTQANIKNDLEQLEQAREIIENFRDTWKEVIKQER---IRQHGQGV......................... 130
287 8.000e-47gi|502941062|ref|WP_013176038.1| flagellar biosynthesis protein FliS [Syntrophothermus lipocalidus]  clstr ali  22  6..NAYQQYRNSTVETASPGALLLMLYDAAIQNLEGAKRAIEGNDMAGAHNYLTRAQDIVLELMSTLNMEYQISKSLWSLYDYLYRQLVQANVKKSVELVEEVYGFMTELRDTWREAVRKARTAAVSGGKSQ.......................... 135
288 8.000e-47gi|518247286|ref|WP_019417494.1| flagellar biosynthesis protein FliS [Anoxybacillus kamchatkensis]  clstr ali  19  5..QAHRAYQQNSVSTASPGELTLMLYNGCLKFLNKAKEAIHENRINERNENLQKAQKIIQELMVTLNQEYEIAKQMMIMYEYMHYRLIQANIKNDVLMVEEVENLVMEFRDTWKEVIRLNRQK.................................. 125
289 8.000e-47gi|547270852|ref|WP_022004958.1| flagellar protein FliS [Firmicutes bacterium CAG:194]  clstr ali  18  8..QQYAQYNTNKIMSASPAELTLLLYEGAIKFCNMAIMGIEHNDIQKANDNIKRVQRIIDEFRATLDMRYPVAEDFDRVYKYLLERLLEANIKKDKEILEEVNTHLHSMRDTWKEVMKKAGNG.................................. 128
291 1.000e-46gi|651936533|ref|WP_026672359.1| flagellar biosynthesis protein FliS [Bacillus bogoriensis]  clstr ali  18  8....AAAYKQNTLNTASPGELTLMLYNGCLKFIKQGKTGIENNDIEMRNINIKKAQDIIRELMVTLETNSDLGKNMMRIYDFVLSRLVDANIKNDVQALNEAEQFVTEFRDTWKQVIQIDRQQRHGSGGQA.......................... 134
293 1.000e-46gi|515113298|ref|WP_016742351.1| flagellar biosynthesis protein FliS [Brevibacillus brevis]  clstr ali  19  2LQNAAQTYQSNQVTTATPADLTLMLYNGALKFIKQAKGAIEEKDVARAHEASLKVQNILYELMSTLNSDYTISKEFIKLYEYMLHRTIEANMRKDIEILSEVESLFLQFRDTWKEAMQLAKSQ.................................. 124
299 2.000e-46gi|495793681|ref|WP_008518260.1| flagellar biosynthesis protein FliS [Dethiobacter alkaliphilus]  clstr ali  18  4..NPYQKYKQNQVETSSPQQLIIMLYNGAIKFLKLAQMGITEQSIEKAHTNIIKTQDIINELMASLDMNQEVASHLYSLYDYMNSRLLEANLKKDTQILSEVENMLTELRDSWVQALK....................................... 120
302 2.000e-46gi|651957150|ref|WP_026682018.1| flagellar biosynthesis protein FliS [Bacillus megaterium]  clstr ali  21  4.NKQHQAYKNNAVNTASGAELTLMLYNGCIKFIKQAMKDLDSKNYEAKNTNIQKAQKIIQELMITLDPKIEISNQFLPLYEYMLFQLKEANIKNDTSLLEEVLGYTIEFRDTWKQVILETRKKQYAQGA............................ 131
303 2.000e-46gi|653148638|ref|WP_027397829.1| flagellar biosynthesis protein FliS [Anaerovibrio lipolyticus]  clstr ali  23  2MNNAAEAYKRQQVMTATPEALTLMLYDGCLRFMKEGLEAMEQKKWEQCNTSLQKAQNIINEFRVTLDMKYDIAHQLMPLYDYVYNSLVEANMRSKPEKVTECMDIIKELRSAWAQAMIKARKE.................................. 124
304 2.000e-46gi|653213149|ref|WP_027425843.1| flagellar biosynthesis protein FliS [Lachnospiraceae bacterium NC2004]  clstr ali  19  2.......YGQNKILTATPAELTLMLYEGAIKFCNKAIDAVDNNDVVEAHKNIRKVENIIIEFQATLDHKYEVAKDFDIIYDYVYRKLVEANIKKDRETLEEVLKELRDLRDSWKIIMKTANSPA................................. 118
305 2.000e-46gi|503588819|ref|WP_013822895.1| flagellar biosynthesis protein FliS [Desulfotomaculum kuznetsovii]  clstr ali  20  6..NPYQQYLQNAVLTADPGRLTLMLYTGAVRFIRQASDCLAARDIPGAHRACLRAQDIIVYLLETVNREMEVGKNLSALYDYMYRRLVEANVKKDAAVLDEVAGLLEELADTWEQALKL-KGQQVAGG............................. 130
306 3.000e-46gi|493741206|ref|WP_006690311.1| flagellar biosynthesis protein FliS [Selenomonas flueggei]  clstr ali  19  3.NSAAEAYKKQQILTATPEALTLMLYNGCLKFIKEGSDALAEKNYEAANISLQKAQNIISEFRVTLNMDYEISHQLMPLYNYAYDRLVEGNLDNNFDAIKEATDIITELRDAWAQAMKKAREEKGRQGTEGVYAG...................... 138
307 3.000e-46JGI.Meta JGI_HUM.2266967 7051999134 SRS047014_WUGC_scaffold_71662__gene_111195 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  36  3..KEQILDFTRRISQSNRSGLTVINYEIIFAYLDDAKKAYQEEKWEEFKVALRKAQNSIGELMQTLDFSYDISRNLYRIYVFCRDSLAAAMYKRSLTEIETAEKMLRKLYQSFCKVAETDSSAPMMKNTQQVYAGYTYGKGDLVENCQ......... 148
308 4.000e-46gi|548369866|ref|WP_022518113.1| flagellar biosynthetic protein FliS [Roseburia sp. CAG:100]  clstr ali  18  4.QNGYAQYQNSKIMTASPAELTLMLYEGAIKFGNIAIMAMENKDPAKAHENVVKVEKIVQNFRETLDKRYPIWEDFEKIYAYLLRRCHEANIAKDPEIMQEVVDHLRSMRDNWKEVMKSVATNQNNPAAQSKIAG...................... 137
310 4.000e-46gi|670487446|ref|WP_031435698.1| flagellar biosynthesis protein FliS [Methylomarinum vadi]  clstr ali  20  10MNQYKQVGTQVGADSADPHQLIVMLFDGALERIAIAKGALERNDIEEKGQKIGRVIAIVDGLRASLDRDREIAENLDNLYDYMQRRLFEANLKNDVAILSEVADLIKEIKSAWVAIPMEQRQAA................................. 135
311 4.000e-46gi|490159443|ref|WP_004058108.1| flagellar protein FliS [Eubacterium plexicaudatum]  clstr ali  19  4.NSGYAAYAKNKVTTASKGELTLMLYDGAIKFCNMAIVAIKEHDIQKAHTNIIKVERIIEEFQSTLNFKYPVAKDFNNVYQYLQETLRNANIKKDEKMLEEVLKHLRTMRDTWKEVMRKNAS................................... 124
314 5.000e-46gi|406980427|gb|EKE02025.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  23  1MNPYLKQYQQTEVQTASPEKLLIMLYDGAIQFLNKAKTGIANKNIEEIHNNIIGAQKIISEFMNTLDMEVEVAQNLYNLYEYLHYRLVQANIKKDNDMVDEVLTHLKDLKQTWEEAIRIAAREKSM............................... 128
315 5.000e-46gi|519002092|ref|WP_020157967.1| hypothetical protein [Methylobacter marinus]  clstr ali  20  1MNQYKQVGTQINADSADPHQLIVMLFDGALERIAIAKGAIFRQDIAEKGQKIGRAIAIIDGLRASLDKDNEIAENLDDLYDYMQRRLLDANINSDVEILDEVTGLIKDVREAWVAIPLQDR.................................... 123
316 6.000e-46gi|544876082|ref|WP_021289102.1| hypothetical protein [Virgibacillus sp. CM-4]  clstr ali  16  4.NKQHQAYQENAVNTASGAELTLMLYNGCMKFVKQAIKDVEANHFEEKNTNIQKAQNIIQELIITLDPKIEISNQFLPLYDYMLFRLKEANINNNVEYLQEVLELITDFRDTWKQVILEIRKKQYAQGA............................ 131
317 6.000e-46gi|504864176|ref|WP_015051278.1| flagellar biosynthesis protein FliS [Thermacetogenium phaeum]  clstr ali  24  7..NNYDQYRQIAVQTAGPGKLLLMLYDGLTVFLKQAVQAVKDGEFGEAHRCLIRAQDIITELMCTLDMKYEVAKNLFRIYDYLKGRLVEANVKKDSSIIEEVLGLVAELKETWEQIIEPSK.................................... 125
318 6.000e-46gi|654780187|ref|WP_028234322.1| flagellar biosynthesis protein FliS [Pseudobutyrivibrio sp. MD2005]  clstr ali  18  1MTNGYDAYAKNRILTASPAELTLMLYEGAIKFCNIAIVACENRDIEKAHINIRKTDRIIEEFELTLDEKYEVAKDFHAVYSYLRSCLRHAMIDKNPETLQEVLKHLRTMRDAWKDVMKLTANGKNLNSRQTTIAG...................... 137
320 6.000e-46gi|500208514|ref|WP_011878723.1| flagellar biosynthesis protein FliS [Desulfotomaculum reducens]  clstr ali  16  4.KNPYSNYQQNAIMSAGPEELTTMLYNRLVKDLKLAQGHIEQKEIQLAHNNITHAQDILDHLMNTLDTSVEVGKNLELMYDYMSRRLVEGNLKKDKEILQEVAGFAEEIRDTWVQAVKQVKTG.................................. 125
322 7.000e-46gi|499958959|ref|WP_011639693.1| flagellin-specific chaperone FliS-like protein [Syntrophomonas wolfei]  clstr ali  23  6..QAYNQYKKSVVETVAPEKLLLMLYDAAIKNINNAKKAIKEKDINRAHEQIMRTEEIIVELMSTLNMEYEISGRLFALYEYFYHRLTQANAQKDIVILDEVEGFLLELRGTWQEAINALKTAPSQDNKVEV......................... 135
323 7.000e-46JGI.Meta JGI_HUM.0956367 7001900127 SRS022725_LANL_scaffold_9219__gene_23667 flagellar protein fliS [Human Supragingival plaque microbiome from visit number  ali  13  6..NPYQKYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDGWKEAMIIVRKGQ................................. 127
324 7.000e-46gi|489483333|ref|WP_003388312.1| flagellar protein FliS [Brevibacillus borstelensis]  clstr ali  20  2LHNAAQTYQSNQVTTATPGELTLMLYNGAIKFIKQAKSAIDEKNVVKAHENCLKVQNILYELLSTLNKDYPISGELEKMYDYMLHRMIEANMRKDASILTEVEDYFVQFRDTWKEAMLLAKKQ.................................. 124
325 8.000e-46gi|503041372|ref|WP_013276348.1| flagellar biosynthesis protein FliS [Thermosediminibacter oceani]  clstr ali  19  1MINAYQQYQQNYILSAPPEKLVVMLCEGALKFARLAKKAIEEKNYAEANNYLIRTQDIIMELNASLDMEYEISKNLRSLYNFIYQRLIEANLKKDGGVVEEIEPLLEDLKDTWQRV......................................... 116
327 8.000e-46gi|493841470|ref|WP_006788596.1| flagellar biosynthesis protein FliS [Thiorhodospira sibirica]  clstr ali  18  7.NQALSQYRQSGINEASPHRLIQMLMEGALERIAVARGAMLRGDVAVKGERISRAIDIIEGLRVHLDMEKEIAANLEALYDYMNRQLMMANLRNDPAILDEVSSLMREIKTAWDALSAEE-SGTKPPNAQ........................... 140
328 8.000e-46gi|489420996|ref|WP_003326733.1| flagellar biosynthesis protein FliS [Bacillus atrophaeus]  clstr ali  18  4.QNPYTAYQQNSINTATPGELTLMLYNGCLKFIKLANQAIHLGDMESKNVNLIKAQNIIQELNITLNRDIELSGSMGAMYEYIHRKLVEANIQSDKDILAEIEGYITDFRDAWKQAIQIERK................................... 124
329 8.000e-46gi|548219072|ref|WP_022438264.1| flagellar protein FliS [Clostridium sp. CAG:411]  clstr ali  20  7...AANAYQGTRINTASPAELTLMLYDGAIKFCNIGMVALEKGDYEKANLNIQKAKKIIVQFRNDLDFNYPVAQDFDRVYEYIYYTLVDANVKKDKELLEEALGRIREMRDTWKQVMDKVKNG.................................. 126
330 9.000e-46gi|491507379|ref|WP_005365015.1| flagellar biosynthesis protein FliS [[Eubacterium] yurii]  clstr ali  13  6..NPYQRYKENSINTASKEEITLMLYDGCIKFMNLAKIGIQEKNIQKANENLIKAQNIITELDSTLNMDVEISKNFHMLYDFALSRLIDANIQKKEEFVDDAKMVIVDLRDAWREAMIIVRKGQ................................. 127
331 1.000e-45gi|575082095|dbj|GAE95177.1| flagellar biosynthesis protein FliS [Gracilibacillus boraciitolerans JCM 21714]  clstr ali  18  4..QQYQAYQNNSVNTASPGELTLMLYNGCLKFIKQANKAIEDKDYETKNEMIKKTQNIVRELMITLDQEAAITKEIMPLYDFVNHALMQANIKNNVDQLEQARAIIQDFRDTWKEVIKQER---IRQHGQGVKA....................... 132
332 1.000e-45gi|494102148|ref|WP_007042939.1| flagellar biosynthesis protein FliS [Thiorhodococcus drewsii]  clstr ali  18  4MRRELQQYRQSGATVADPHRLIQMLFEGALERIAVAKGAMEQGNIQLKGNKLTQAISIIGGLRSSLDLSQDLAGNLDALYEYMTRRLLQANIHNDTDALDEVIRLLREIKSAWDGIPDRLRQAS................................. 133
336 1.000e-45gi|517532060|ref|WP_018702268.1| hypothetical protein [Anaeromusa acidaminophila]  clstr ali  16  3MMNPAAAYRNQQIMTASPEQLTLMLYDGAIRFLRASITAIEAKEMEKAHEMNMRTQEIIREFRQTLNMDIELSENWDKLYEFMEYRLMEGNVKKDKAMLQEVLDLLKEMRDTWAEAMKLAK.................................... 123
338 1.000e-45gi|544869518|ref|WP_021282973.1| hypothetical protein [Clostridium sp. BL8]  clstr ali  19  5.NNGYNAYKNNSINFASKEQLFLMLLDGAVKFSKIARQAIEDKEIIKAHENIIKTQNIFYELMVTLDTSEPWLKDLFNIYDFITRRLIDANVKKDVKIIDEIIPLIEDIRDTWNEAYRLSKSG.................................. 128
339 2.000e-45gi|510895194|ref|WP_016228327.1| flagellar protein FliS [Lachnospiraceae bacterium 10-1]  clstr ali  17  5..NAFAQYNNNKIMTASPAELTLMLYEGAIKFCNIAIDAAEQKNVMKAHSNIVKVENIIAYLRNTLDMQYAVAKEYDRMYDYLQRRLFQANMKKDVEILKEVNTHLRSIRDTWKEVMRINRGK.................................. 125
340 2.000e-45gi|657022410|ref|WP_029266215.1| flagellar biosynthesis protein FliS [Virgibacillus alimentarius]  clstr ali  19  4.NKGYQTYQHNAVHTASSGELTLMLYNGCIKFIKQAMKDIDEHNYEAKNNNIQKAQNIIQELMLTLDPKIEISKQILPLYEYMHHLLKEANIQNEITELEEVLQLVSEFRDTWKQVILKNRKEQSVQGAQ........................... 133
342 2.000e-45gi|504784103|ref|WP_014971205.1| flagellar biosynthesis protein FliS [Exiguobacterium antarcticum]  clstr ali  22  1MANPYATYQTNSVTTALPQDLTLMLYEGLIKFSMLAKRAIEQGLIEQKNTNIQKAQAIILELQLTLNQSIALSKELNNLYDYMQGRLIDANVKNDVVAIDEVIGFAEEFRETWKEAMKLARQ................................... 122
345 3.000e-45gi|516870762|ref|WP_018139665.1| MULTISPECIES: flagellar biosynthesis protein FliS [Thioalkalivibrio]  clstr ali  15  6MNRGVNQYRQSGAQVADPHRLIQMLFEGALERIAVAKGAMQQGNVGLKGEKIGKAIDIVESLRAVLDHKHELSGNLDALYEYMSRRLLEGNAQNDPAALDEVAKLLREIKAGWDEIPPEERQ................................... 133
347 3.000e-45gi|686527506|gb|AIQ38206.1| flagellar biosynthesis protein FliS [Paenibacillus sp. FSL R5-0345]  clstr ali  20  2MTSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFARTAMDGLSKQDYEKTSLNFGKAQTIISELMSTLDYSYEVSNNLYSLYEYTNFLLVEANIRKSPEKAEEAIGYLTELRETWLQASKIAAGQGQAESA............................ 130
348 4.000e-45gi|573550090|gb|ETT48892.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL H7-689]  clstr ali  20  3.KSPYEKYRQSSVQTSTPAQLVIMLYDGAIRFVKVGLEGLNNQDIEKANLNLGKAQTIISELMSTLDQSYDVSKNLFALYEYTNYLLIEANIRKSPEKAEEAIGYLTDLRETWMQASKLASTQ.................................. 124
350 4.000e-45gi|503198254|ref|WP_013432915.1| flagellar biosynthesis protein FliS [Caldicellulosiruptor kristjanssonii]  clstr ali  17  27...AAARYQEEVIMTKPPEELTLMLYDGCIRFIKLAMQAIDEKKLDKANENIIKAENIITELMSTLDMSYEISKNLMSLYDFVYRWLIQANLKKDKKYLEEALEIVQDLRNTWAEAIKIARQQ.................................. 146
351 4.000e-45gi|40889902|pdb|1VH6|A Chain A, Crystal Structure Of A Flagellar Protein  clstr ali model  18  6.QNPYTAYQQNSVNTATPGELTLXLYNGCLKFIRLAAQAIENDDXERKNENLIKAQNIIQELNFTLNRNIELSASXGAXYDYXYRRLVQANIKNDTGXLAEVEGYVTDFRDAWKQAIQSERK................................... 126
352 4.000e-45JGI.Meta JGI_HUM.5740408 7072814211 C2773271__gene_106554 flagellar protein fliS [Human Supragingival plaque microbiome from visit number 1 of subject 63875  ali  18  3.NNPYNKIKNSSIMTASPAELTLMLYEGAIKFGNQAVAAIKAKDVSEAHRLIVRVQDIIDELRGTLNFDFPIAEQMDRMYEFISFTLVEANMEKSAEKVETALTFIREFRDTWKEAMGLAKK................................... 123
353 4.000e-45gi|727087505|gb|KHF37830.1| flagellar biosynthesis protein FliS [Bacillus okhensis]  clstr ali  17  5MYNA-NAYKQNAMKTASPGELTLMLYNGCLKFINQAKKAIEAGNVEQRNTSITKAQNIIRELMVTLKTDSEVGQNMMRMYDFIMSQLVDANVKNDVQALTNAEELVTEFRNTWKEVIQLDRQQ.................................. 126
356 5.000e-45gi|545666077|ref|WP_021772468.1| flagellar protein FliS [Mitsuokella sp. oral taxon 131]  clstr ali  18  3.NSAAEAYKRQQIMTATPEALTLMLYNGCLKFIDEGTAAVAEKKWEQANIALQKAQNIISEFRITLNMEYDISKQLMPLYNYAYDRLVEGNMKSSVEKIQEARDIISELRDAWAQAMKKARQDQGTRNVQ........................... 131
358 6.000e-45gi|652439969|ref|WP_026835008.1| flagellar biosynthesis protein FliS [Eubacterium xylanophilum]  clstr ali  18  3.TNMADSYKTNAILTASPAELTLMLYDGAIKFCNIALIALEKNDYGKCNENLKRAQDIILEFRITLDHKYPVWEDFDRVFEYIYNCLIDGNIHKDKEMIEEGLGRIREMRDTWKEVMQLNNQK.................................. 124
359 6.000e-45gi|655111622|ref|WP_028559285.1| flagellar biosynthesis protein FliS [Paenibacillus pinihumi]  clstr ali  22  3.TSPYDKYRQSSVQTSTPGQLLLMLYDGAIRFVRGGIEAITGQDYQKANTLLGKAQAIISELRITLDYSYEISQQLSSLYEYMNHLLIDANVKKQTAPAEEALGYLLDLRESWAQAAKAA..................................... 121
361 7.000e-45gi|500959444|ref|WP_012033250.1| flagellar biosynthesis protein FliS [Pelotomaculum thermopropionicum]  clstr ali  18  6....YSQYSLNAVMTASPGELTLMLFNGAVRFIRQGLNFAEEKNIEGAHNAIIRAQEIIQHLNGTLNMDYEVSKNLAMLYDYIVRRLTEANIKKDGQILKEALDLVEDLRNTWAEALKLA..................................... 121
362 7.000e-45gi|652370461|ref|WP_026766474.1| flagellar biosynthesis protein FliS [Selenomonas ruminantium]  clstr ali  20  3.NNAAEAYKRQQIMTATPEALTLMLYNGCLKFMNEGKEAVEAKQYEQANTSLQKAQQIISEFRVTLNMDYEISHQLLPLYNYTYRCLVDGNMQSNPALIQEAIDIIRELRDAWAQAMKKARQDGSLQNAQ........................... 132
363 7.000e-45gi|506218527|ref|WP_015738302.1| flagellar protein FliS [Ammonifex degensii]  clstr ali  21  3...AANKYLEMAVSTAPPERLLLMLYDGAINFLSRAVEAIEARDFAEANRLIIRVEEIVTELKNSLDPQYEISQHLDRLYDYFLSRLFAANVAKDTEVLQEVQKHLRELRDTWAEVI........................................ 116
364 7.000e-45gi|690619677|gb|AIQ20890.1| flagellar biosynthesis protein FliS [Paenibacillus sp. FSL H7-0357]  clstr ali  21  3.NSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFIRAGLDGLKRNDLEKTNINLGKAQTIVSELMSTLDRSYEVSEGLYSLYEYTSFLLVEANIRKDAVKAEEAVGYLTELRETWLQASKIAAGQ.................................. 124
365 8.000e-45gi|495688434|ref|WP_008413013.1| Flagellar protein fliS [Desulfotomaculum hydrothermale]  clstr ali  18  4.KDPYKSYQQNAVLSAAPEELTTMLYQRLVKDLKLARESVEKKDIEAAHRCITHAQDIIAHLLDTLDTSYEVGQNLQLMYDYMNRRLVEANIKKDPEILREIAGYAAELRDTWVQAVKQVKTG.................................. 125
366 8.000e-45JGI.Meta JGI_HUM.4077605 7031886519 SRS056259_LANL_scaffold_55701__gene_126069 flagellar protein fliS [Human Stool microbiome from visit number 2 of subject  ali  29  1MTKETIKTFQYRITQATASQLVVILYDMAIEYLNDACESDSAKQ---AHNNIYMAQKVIDQLICGLDMQYEISANLFVIYNHMKRSLISASVSLDNNEINRITGLLKKLRASFYEVSKQDDSEPLMKNTQVVYSGLTYSRGGINETQTDN....... 148
370 9.000e-45gi|652951122|ref|WP_027204515.1| flagellar biosynthesis protein FliS [Butyrivibrio fibrisolvens]  clstr ali  21  11..NPYAQYANNKVLSASGPELTLMLYEGAIKFCNRAENACEKKDIEGTHNNIRKVQNIIAYLRETLNMKYATAQDFENIYSYLDRRLVEANVSKDIEILKEVNKHLHSVRDTWIGVMKANNVPSYMNHSDAV......................... 143
371 1.000e-44gi|545654748|ref|WP_021762209.1| putative flagellar protein FliS [Desulfovibrio gigas]  clstr ali  22  1MQKAATAYLQTSVGTTSQGEILLMLYEGAIKFLRQAQEKIKERDYAQKGILISKALDIISELECSLNMNKDIAGNLHRLYFFCQKRLLQANINMDVAMVEEVVTILSGLRSAYQEVIK....................................... 120
372 1.000e-44gi|647360213|ref|WP_025774195.1| flagellar biosynthesis protein FliS [Moorella thermoacetica]  clstr ali  21  5..NPYQAYRQNQVQTLSQEKLVLMLYDGALRFCRQGLVAMEQNDYAAVSNNLGRAEDILSELMATLNRDVDISENLYKLYDFMYRHLVQANVKKSVKMINEVIELLQQLRDTWEEAIKI...................................... 122
374 1.000e-44gi|493881808|ref|WP_006828066.1| flagellar biosynthesis protein FliS [Planococcus antarcticus]  clstr ali  15  5..NPYQTYQQNSVMTASPQELTLMLYSGSVKFIKIAKRAMNDKNFQEKNTNIIKAQNIILELRSTLNSDIDMSTGLEQMYEYMYSRLLEANMKNDLEALEEVETLMTDMRNTWKQAMALARK................................... 124
375 1.000e-44gi|503077362|ref|WP_013312277.1| flagellar biosynthesis protein FliS [Paenibacillus polymyxa]  clstr ali  17  3.NTPYQKYRQTQAQTASKPKLLIMLYDGAIRFVRAGIEGIENKDNEKANNNLCKAQAIVHELISALNFEYPISHDLLRIYEYMLHELIEANIHKIAAPAQEVLEHLTDLREAWLEAMKM...................................... 120
376 1.000e-44gi|686544451|gb|AIQ55148.1| flagellar biosynthesis protein FliS [Paenibacillus sp. FSL R7-0331]  clstr ali  19  3.TSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFVKMALDGLSKQEYEKSNLNFGKAQSIISELMGTLDHSYEVSKGLFSLYEYTNHLLIEANIHRNPEKAHEALGYLGELRETWLQASKLPNAQ.................................. 124
377 1.000e-44gi|518465419|ref|WP_019635626.1| hypothetical protein [Paenibacillus fonticola]  clstr ali  18  3.TSPYDKYRQSSVQTSTPSQLLLMLYDGAIRFVRGGIEGIKEGDYDKVNTLLNKAQSIVTELTVTLDYSYEVSKGLASLYEYINHLLIDANIKKTAPPAEEALGYLLDLRDTWAQAAKLA..................................... 121
378 1.000e-44gi|569808069|dbj|GAE31554.1| flagellar biosynthesis protein FliS [Bacillus hemicellulosilyticus JCM 9152]  clstr ali  16  3.TQLQSVYKKNSMQTASPGELTLMLYNGCLKFIKQANKAIEENNVEARSHSIQRAQDIIRELMVTLKMDSEASENMMRLYDFILNRLIEANVKNDVKALHDAEELVIQFRDMWKEVIQLDRKE.................................. 124
379 1.000e-44gi|495862450|ref|WP_008587029.1| flagellar biosynthesis protein FliS [Salimicrobium sp. MJ3]  clstr ali  21  4.....QAYENNTVETASQGELVLKLYNGCIKFIKASGKAMENNDIEKKNLNIQKAQRIVQELIITTDPSYDISQQILPLYEYMNRRLLEANTKNDREILDEVRGLAEEFRDTWKEVLIQTRKAEYSKGG............................ 127
380 2.000e-44gi|573551186|gb|ETT49978.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL R7-269]  clstr ali  24  4..SPYDKYRQSSVQTSTPAQLVMMLYDGAIRFAKTAIEGLNKQDLEKSNLNFGKAQTILSELMSTLDFKYEVSKNLYSLYEYTNHLLVEANIHKSVDKAQEAIGYLVDLRETWLQASKLAASQTEIANG............................ 130
381 2.000e-44gi|550548983|ref|WP_022629127.1| flagellar biosynthesis protein FliS [Bacillus marmarensis]  clstr ali  16  3.TAMQSAYKQNAMKTASPGELTLMLYNGCLKFIKQTRLAMEENDLEKRNLNSTKAQNIIRELMVTLKTDNEVGQNMMRMYDFILNRLIEANVKNDANALTEAEGLVVEFRDTWKEVIQLDRKQ.................................. 124
382 2.000e-44gi|517807567|ref|WP_018977775.1| flagellar biosynthesis protein FliS [Saccharibacillus kuerlensis]  clstr ali  19  4..SPYQKYQQTQAQTASKPKLLIMLYDGAIRFVKAGIDGISEKNYEAANNNLCKAQAIVHELVSSLNFDYAIADELVRLYEYMLRRLIEANVKKDAAPAEEVLEHLSDLREAWVEASKIS..................................... 121
383 2.000e-44gi|517782643|ref|WP_018952851.1| flagellar biosynthesis protein FliS [Thioalkalivibrio sp. ALJ17]  clstr ali  18  8..QALNQYRDAEVNEANPHRLIQMLFDGALERIATAKGAMQQGNVAVKGERISKAIGIIDGLRAHLDMEKEVAANLDALYEYMGRRLTEANLRNDPAMLDEVANLLREVKAGWDAIPAQQAAE.................................. 133
386 3.000e-44gi|686522005|gb|AIQ32706.1| flagellar biosynthesis protein FliS [Paenibacillus sp. FSL P4-0081]  clstr ali  19  3.KSPYDKYRQSSVQTSTPAQLVIMLYDGAIRFVKTALDGMSKQDLEKSNLNFGKAQTIISELMSTLDHSIEVSKGLYSLYEYTNYLLIEANIHKNPAKAEEALGYLTDLRETWLQASKLAATQTEIANG............................ 130
388 3.000e-44gi|547838489|ref|WP_022246153.1| hpt protein [Clostridium sp. CAG:306]  clstr ali  22  1MNPYLKQYRQTQIDTAPKEQILLMLYDGAVRFLNQAKAGFAEKNIEKIHNNIVKVQNIITEFESTLDMKTEFAQNLFALYEYINNQLLLANIKKREECLDEALKHMTELRDTWRQAVKQFKAA.................................. 125
389 3.000e-44gi|647225793|ref|WP_025678749.1| flagellar biosynthesis protein FliS [Paenibacillus massiliensis]  clstr ali  19  3.NSPYEKYQQTQAQTASKPKLLIMLYDGAIRFVQAGIEGVEQRNFELVNRNLVKAQAIIHELISSLDFNYPVAHNLVAVYEYMIRRLIEANIQKKTEPAVEVLEHLKELREAWVEASK....................................... 119
391 3.000e-44JGI.Meta JGI_HUM.2899131 7055223932 C3669430__gene_208949 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 765013792] :  ali  19  25MTNAASLYQGASINTATPAELTLMLYNGAIKFCNQAMAGIEEKNVEKANNNLIKAQNIIWELQGTLDFKYKVAKDFDIIYQRILRNLLMANIRKDADKLNEALEDIRGMRDVWVEVMKAAKN................................... 146
392 3.000e-44gi|653250961|ref|WP_027456367.1| hypothetical protein [Dechloromonas agitata]  clstr ali  20  5MRNPAQSYLEVAVETASPHKLILMLFDGAIAAINIAKFELEAGDIPKKGASISKAIDIVNGLRASLDVDAELGERLAALYDYMIQRLLFANLNNSIAALDEVVGLLDTLRDAWTQIAPGEQAAA................................. 135
393 3.000e-44gi|651418653|ref|WP_026521623.1| flagellar biosynthesis protein FliS [Butyrivibrio sp. VCB2001]  clstr ali  23  9.RAAYAQYKSNKVMSASGPELTLMLYDGAIKFLNIASYAIENKDIQKSHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYSYIARRLVEANISKDKEIVDEINGHMHAIRDNWVEVMKANH.................................... 128
394 4.000e-44gi|492909592|ref|WP_006039998.1| flagellar biosynthesis protein FliS [Paenibacillus curdlanolyticus]  clstr ali  18  1MLQAQANYANTQIQTASPGELTLLLYNGCIKFIKKALQSMENQNVHGKHENFIKAQNIIDELQSTLNMEYELSNGLFQLYTYIQEKLSFANVKMDRAAAEECIQLISELRDTWLEALKSLKRG.................................. 123
396 4.000e-44gi|494375362|ref|WP_007200458.1| flagellar biosynthesis protein FliS [Fictibacillus macauensis]  clstr ali  19  4.QNPNLLYQNNAVATASPGDLIVMLYNGCLKFITTAKQAIINHDIPLKNTMIQKAQKIIQELMVTLNPEVMLSESLLSLYDYMHRRLIQANIETNIRYLEEVESYLVDLRDTWKEVVRM...................................... 121
397 5.000e-44gi|568815013|dbj|GAE33041.1| flagellar biosynthesis protein FliS [Bacillus akibai JCM 9157]  clstr ali  15  4.NNPQQAYQQNKAVTSSPGELTLMLYNGCLKFINVAKKSIEENNIATRHENLVKAQNIIRELMVTLKTDTKLGKDMLALYDFILSRLTDANTENSMEKLSEAEEMVKDFRDTWKEALQIDRKK.................................. 125
398 5.000e-44gi|518757464|ref|WP_019915067.1| hypothetical protein [Paenibacillus sp. HW567]  clstr ali  20  2LTSPYEKYRQSSVQTSTPAQLLIMLYDGAIRFARAGIDGLNKQDYEKTNLNLGKAQTIVSELMSTLDQSYEISKGLYSLYEYMNFLLVEANIRKSVDKAEEAVGYLTELRETWLQASKLAASQTEIANG............................ 130
399 5.000e-44gi|490766306|ref|WP_004628540.1| flagellar biosynthetic protein FliS [[Clostridium] termitidis]  clstr ali  20  4.NSGYDQYVSNSINTATPEELTLMLYNGLVKFIMQAQSAAIVRDLEKANEAMKRAQAILVEFRSTLNMNYEVSKYLESIYEYMHRQLLQANIKKDKDILEEVLGYAKDLRDTWTKAMKLAKQQ.................................. 125
400 5.000e-44gi|568807981|dbj|GAE26537.1| flagellar biosynthesis protein FliS [Bacillus wakoensis JCM 9140]  clstr ali  16  3.TNMQAAYKQNAMKTASPGELTLMLYNGCLKFIKQAKQAMDAQEIEKRNIATTKAQNIIRELMVTLKTDSEVGQNMMQMYDFILRQLVEANVKNDPQALANAEDLVTQFRDTWKEVVLIDRQQ.................................. 124
401 6.000e-44gi|503423886|ref|WP_013658547.1| flagellar biosynthesis protein FliS [Cellulosilyticum lentocellum]  clstr ali  17  6....YQKYQQNSVLTASPQELTLMLYNGAIKSCNQGIEAIEEGKIEKAHQYITKTQDIILELKCTLDDKYPISKNFEELYDYIMMLLVDANITKNGERLLEAKAFITDFRDLWKEAMKASKS................................... 123
402 6.000e-44gi|654643635|ref|WP_028104787.1| flagellar biosynthesis protein FliS [Pseudoduganella violaceinigra]  clstr ali  19  10..NAYAKVLETGVTSASPHKLIVMLYDGALAAIMTAITQMKAGNVQEKGKAISKAIRIIDGLRASLDKEVEIALNLDALYDYLSRRLLEANLKNDADILEEVRGLVADLRDTWNQI......................................... 127
403 7.000e-44gi|501423976|ref|WP_012448646.1| flagellar protein FliS [Natranaerobius thermophilus]  clstr ali  19  4.QNPYNNYKETQIKTASSEKLLLMLFDGGLKFMKQAKGHLENKELKQANEKLKRAQSIVAELMNSLDTNQEVATNLWRLYDFMLNELIQANIKKDTEKIDQVMKMMRELRQTFDEASKSAGSG.................................. 126
404 7.000e-44gi|652965129|ref|WP_027218212.1| flagellar biosynthesis protein FliS [Butyrivibrio fibrisolvens]  clstr ali  20  8.QNAYAQYKNNKILGASGPELTLMLYDGAIKFLNIADLAIEKKDIQKAHDNIIKTERIIEYLRNTLDMKYPVAQDFENMYVYIARRLVEANVGKDREIIAELNGHMHAIRDTWIGVMKANN.................................... 127
405 8.000e-44gi|647569458|ref|WP_025847754.1| flagellar biosynthesis protein FliS [Paenibacillus ehimensis]  clstr ali  20  4.QQGQETYLRMQVTTAAPWELTLMLYNGCIKFMKQALDGIQKSDYEAKNMNIKKAIRIIDELIATLDKKYEISKNLDALYVFMKDKLFEANVKLNVEALQVSIELMTDLRDTWVKAMKSLKSPAKVQ.............................. 129
406 8.000e-44gi|548231217|ref|WP_022449885.1| putative uncharacterized protein [Roseburia sp. CAG:303]  clstr ali  21  5..NAYKAYSNSKLMTASPAQLTLMLYDGAIKFTNIAIEAIENKNYEKANTYIQKTHRIIDEFRSTLNFKYPVAQEFENVYVMISEKLVYANMKKDVEVLQDVLKHLRSMRETWEEVMRLAK.................................... 123
407 9.000e-44T2D.3341305 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKTHNNIVKVENIIEEFQATLNHKYPVAEDFDKIYRYIYDLLIEANIKKDKELLERALDELRGMRDTWKEVMVKAK.................................... 126
408 9.000e-44gi|500116662|ref|WP_011792667.1| flagellar biosynthesis protein FliS [Desulfovibrio vulgaris]  clstr ali  23  1MHKAAQAYLQTQVTTTSQGELLLLLYDGAIKFLTQAKERMAARDMAGKGVLISKALDVINELDSSLNAEKELADNLHKLYFYCSTRLLSANLKLDPNLIDEVIKVLSGLRGAYAQI......................................... 118
410 1.000e-43gi|654396803|ref|WP_027872881.1| flagellar protein FliS [Melitea salexigens]  clstr ali  16  19..........SQVEAASPHRLIQLLMDGALDRLALARGQIQRGEISLKANSISRTMSIIDGLRLSLDHSVDLSENLEGLYDYMNRRLLLANVKNDTEALDEVSGLLRELKEAWDAIPDPARDSKDYSSSEAVV........................ 143
412 1.000e-43gi|489428699|ref|WP_003334320.1| flagellar biosynthesis protein FliS [Brevibacillus laterosporus]  clstr ali  20  1MNQAAQIYQQNQVKTASPGELTLMLYNGGIRFSKEAKIALEKQDVQKAHQSIIKVQDIIRELMVTLDQNVAISEQFMLMYDYMYNRTIEANLKKDGAIITEVEEFFVQFRDTWKQAILIARRQP................................. 125
414 1.000e-43gi|502999075|ref|WP_013234051.1| flagellar biosynthesis protein FliS [Herbaspirillum seropedicae]  clstr ali  17  5MKRGANAYANIGVETASPHKLITMLFDGALVAIALGKKYMAEGNIKDKGESITKAILIVDGLRASLNKEVELALNLDSLYEYMSRRLFEANATNNPAILDEVHSLLEDIRSAWEQIGP-NGQPASMQAAPAPTA....................... 144
417 1.000e-43gi|546467217|ref|WP_021866369.1| putative uncharacterized protein [Eubacterium sp. CAG:86]  clstr ali  17  7.NQAYAEYNRNKVLTASPAELTLLLYEGAIKFCNIAIIGLEQNDMEKVHNNIIKVENIIEEFQATLNHKYPVAEDFDKIYKYIYNLLVEANIKKDKELLEQALTELRGMRDTWKEVMVKAKQG.................................. 128
419 1.000e-43METAHIT unmapped GL0475776 unmapped_[Complete]_[mRNA]_locus=scaffold485658_1:2:382:-  ali  21  5..NPYNAYKQNSVKMASKQQLLLMLVDGAVKYTKIARLAIEKKDITRAHNELVRVQDIFTELMVTLDKSAQVYEDLYKVYEYIKSRLIEANIKKDVAIIDEVLPLIENVRDTWYEVSKKSK.................................... 124
420 1.000e-43gi|516336231|ref|WP_017726264.1| hypothetical protein [Bacillus sp. L1(2012)]  clstr ali  16  5..NMQTAYKQNAMKTASPAELTLMLYNGCLKFMKQAKQAIEEKNVEHRNLYTNKAQDIIRELMVTLKTDSEVGKNMLRLYDFALDRLIEANVKSDLKALEDAEDIMVQFRDTWKEAMQLDRQQRHGAGGQA.......................... 133
421 1.000e-43gi|506373825|ref|WP_015893544.1| flagellar biosynthesis protein FliS [Brevibacillus brevis]  clstr ali  20  2LQNAAQTYQSNQVTTANPADLTLMLYNGALKFIKQAKVALEEKDVIKSHEASLKVQNILYELISTLKSDYEISKEFAKLYEYMLQRTIEANMHKDVNILLEVEDLFIQFRDTWKEAMLLAKKQ.................................. 124
424 1.000e-43gi|570732850|gb|AHF04013.1| flagellar biosynthesis protein FliS [Marichromatium purpuratum 984]  clstr ali  18  4MRKELNQYRQAGVAVASPHRLIQMLFEGAVERIAVARGAMTHGNLQTKGEQLSKAINIIESLRAVLDHDQELAENLDALYSYMSRRLLEGNARNEPEALDEVSDLLRTIKSGWDEVPE....................................... 127
425 1.000e-43gi|689316054|gb|KGE20417.1| flagellar biosynthesis protein FliS [Paenibacillus wynnii]  clstr ali  20  3.TSPYEKYRQSSIQTSTPAQLVIMLYDGAIRFVRTGLDGLKQQDVEKTNLNFGKAQAIVSELMSTLDQSYEISKSLSSLYEYTNFLLIEANIRKNPEKAEEAIGYLTDLRETWLQASKLASGQTQAEGA............................ 130
426 2.000e-43JGI.Meta JGI_HUM.7345218 7073755069 SRS023468_LANL_scaffold_17240__gene_35376 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  28  1MTDEKIKIYTEKIAKANRTELIVLLYDMFLDYISDARDCFKKDDMFEFTLNIKRAEKVLMHLEDSLDFTYPISNNLYSLYVYCQRVITQTIYKKDIFYLPEAEKVITSLRGSFEEIAKTDKSESIMKNTENIVYGMTYGKNDINKMTDSXKS..... 152
427 2.000e-43gi|503044914|ref|WP_013279890.1| flagellar biosynthesis protein FliS [Butyrivibrio proteoclasticus]  clstr ali  20  20.QRAYAQYKNNKVMSASGPELTLMLYDGAIKFLNIADFAIEKNDIYKAHENIVKTEKIIDYLRNTLDMKYAVAQDFENMYSYIARRLVEANIGKDREIIAEVNKHMHAIRDNWIEVMKANH.................................... 139
428 2.000e-43gi|517491150|ref|WP_018661727.1| Flagellar biosynthesis protein FliS [Thermobrachium celere]  clstr ali  20  5..SALNIYQQNSVNTASKEKLLLMLYDGLVKFIRQAITSLEEKDLQKAHTNLIKAQNIILEFMSTLNMEVEIAKSLMALYDYMYRRLVEANIKKDAKIAEEILGFAEELKETFEEAYKRIKK................................... 126
429 2.000e-43gi|493568815|ref|WP_006522096.1| flagellar biosynthesis protein FliS [Desulfotomaculum gibsoniae]  clstr ali  14  3LNNPYQRYQQNSVSSAPPQELTNMLYSGGVRFIRQAMQSIEENEMEKAHQELVRAQEIYKHLQDTLNMDIKISNNLYNLYDFMIRQLLQANIKKDIAILHEILGLAEELRNTWKEAMVKARGQ.................................. 125
430 2.000e-43gi|653056071|ref|WP_027307542.1| flagellar biosynthesis protein FliS [Caloramator sp. ALD01]  clstr ali  19  4.NNALNAYQQNSVFTASKEKLLLMLYEGLVRFIKQAISSLEEKDYQKAHTNLIKAQNIILEFMATLNMEVELSKSLMALYDYMYRRLVEANIKKDINIAKEILEFAEELKDAFEEAYKKIKK................................... 126
431 2.000e-43gi|500110030|ref|WP_011786035.1| flagellar biosynthesis protein FliS [Marinobacter hydrocarbonoclasticus]  clstr ali  17  2..NGLQAYQQTSITDADPHKLIQLLYSGALERINMAKARMQANDIEGKGRLISKAIEIIGGLRSFLDFEKDLAERLEGLYDYMERTLFEANVKNDPAKLDEVAELLRSIKEGWDGI----REEVVTQHSQAA......................... 133
434 2.000e-43T2D.2924132 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  44...........KVLTASPAELTLLLYEGAIKFCNIAMMGLEEKNIQKTHDNIKKAQAIIEELQSTLNHSYKVAEDFDNVYHYIYSLLTDANIHKDKETLERALTEIRGMRDTWKEVMKKAKS................................... 154
435 2.000e-43JGI.Meta JGI_HUM.2418179 7013606553 C4552524__gene_251735 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 675950834] :  ali  21  1MKKEYASYANQKVLGATPAELTLMLYDGAIKFCNIAESAIEKKEIEKVHQNLLRAERIIEYLRATLDMKYPIAQDFDNMYSYIYKRLVEVNVTKEVEILQEINGHLHAIRDTWVQVMEKNH.................................... 124
436 2.000e-43gi|506217939|ref|WP_015737714.1| flagellar biosynthesis protein FliS [Paenibacillus sp. Y412MC10]  clstr ali  21  7..QAQYNYLHTKIQTSSPGQLTLMLYTGCIKYLKLAVQSIEIHDMEGKHLNFVKAQNIIDELQSTLNMEYEISKQLYSLYTYINEKLFEANVKLDVKSAEDCIQLLTELRDTWAEALK------LISNGEQV......................... 130
437 2.000e-43gi|496185442|ref|WP_008909949.1| flagellar biosynthesis protein FliS [Caloramator australicus]  clstr ali  21  1MNNALNAYQQNSIFTASKEKLLLMLYDGLVKFIKLAIVGIEEKDIKKAHENFIKAQNIILEFMATLNMEVEIAKSLMLLYDYMYRRLVEANTKKDKAIAEEVLGFAEELKETFEEAYRRLKK................................... 126
438 2.000e-43gi|517579769|ref|WP_018749977.1| hypothetical protein [Paenibacillus sanguinis]  clstr ali  18  3.TSPYEKYKQSSVQTSTPAQLLIMLYDGAIRFTRGAMEAIHAEDYQKKNELIGKAQAIVSELRASLNHSYEIAAQLDKMYEYINYLLIEANIRKEATRAEEALGYLLELKESWVQASKEVAGGQANANG............................ 130
440 2.000e-43JGI.Meta JGI_HUM.3703256 7060367354 C3667938__gene_201283 hypothetical protein [Human Tongue dorsum microbiome from visit number 3 of subject 158883629]  ali  21  6..NAYETYANQKVMGATPAELTLMLYDGAIKYCNIAEAAIEKKDIERSHQNLVRVEKIIEYLRATLDMKYPVAQDFDHMYAYLYKRLVEVNISKDVEILQEINEHLHAIRETWVQVMEKNH.................................... 124
441 2.000e-43gi|568324364|ref|WP_024092917.1| flagellar protein FliS [Paenibacillus larvae]  clstr ali  14  4..SPYQKYQQTKVQTASPAQLLLMLYDGAIRFVKLGIEGIQEHNMEKTNTNLCKAQSILHEMIASLNFNYEISNNLLRIYEYMLHQLIQSNVNKSAKPAEEVLSQLMELKEAWTEAGKQA-AGSVAGISQH.......................... 131
442 2.000e-43gi|654786695|ref|WP_028240711.1| flagellar biosynthesis protein FliS [Pseudomonas azotifigens]  clstr ali  17  7MRQYQNVNRNAQVLEASPHRLIQMLMEGGLERIAQARGALERGQVALKGELIGKAVAIVGGLREGLNMDAELAANLDSLYDYMARRLVEANIHNDTQRLDEVAGLLRQIKSGWDGIA........................................ 125
444 3.000e-43gi|499660095|ref|WP_011340829.1| flagellar biosynthesis protein FliS [Pelobacter carbinolicus]  clstr ali  18  1MNPYLNQYKNNQISSASPEQIMIMLYDGAIRFLTQAMQGIEDGNIELKNHGIQKAMAIVMEFRNTLDHNIKIAADLDSLYDYMIREMIQANINLDRSKLEAVHTMLSDLRDTWKEAIVIARSESQAK.............................. 129
445 3.000e-43gi|501259841|ref|WP_012302859.1| flagellar biosynthesis protein FliS [Candidatus Desulforudis audaxviator]  clstr ali  17  4.TNPFAHYQQNAVLNAGPGQLVLMLFNGILRFVKQADLALENGDLPRAHNALVRAQDIVSYLRETLNTDFKIGQDLDALYDYIYNRLVQANLKKEREMLAEVDRMVRELKEAWSQALK-PRSAPEQE.............................. 128
446 3.000e-43gi|655103249|ref|WP_028551012.1| flagellar biosynthesis protein FliS [Paenibacillus sp. UNC451MF]  clstr ali  18  3.QTPFNKYRETSIQTMTPGQLLIMLYDGAIRFARKGVEGVKQKNYQEANNCFIRVQEIINELVASLDHSYPISKDLLQLYDYFLRKMVEANIKKDIQPALEVIDHLVELKETWIQASKLSTS................................... 123
447 3.000e-43gi|651902010|ref|WP_026656715.1| MULTISPECIES: flagellar biosynthesis protein FliS [Butyrivibrio]  clstr ali  21  8.QKAYAQYKNNKVMGASGPELTLMLYDGAIKFLNIADYAIENNDVPKAHENIMKTERIIDYLRSTLDMKYAVAQDFENMYSYIGRRLVEANMSKDREIVAEVNKHMHAIRDNWVEVMKANN.................................... 127
450 4.000e-43gi|518844437|ref|WP_020000327.1| MULTISPECIES: flagellar biosynthesis protein FliS [Desulfovibrio]  clstr ali  17  1MKTAAQAYFSTQVSTTSQGQLLIMLYEGCLKFLNQAKTSIEEKDVAKKGMLITRAMDIINELDSSLNTEAEIAKNLHELYYFCNTRLLKANLLMDTTCIDEVIKIIDGVRDAYAQIIDTPEAVEAMKN............................. 130
452 4.000e-43gi|505066074|ref|WP_015253176.1| flagellar biosynthesis protein FliS [Thermobacillus composti]  clstr ali  20  2LTTPHQIYQQSAVNTSNPLQLIIMLYDGAIKHVKLGIEGIETNDFQKANTHLVKAQSVINELISSLNFQYPIAELLLQIYDYLVRNLIEANVKKQKDPALEVLGHLSNLRDAWQQVAKRGSAAP................................. 125
453 4.000e-43gi|503002646|ref|WP_013237622.1| flagellar biosynthesis protein FliS [Clostridium ljungdahlii]  clstr ali  22  5..NAYKTYKTNSVNYASKEQLLLMLVDGAVKFSKIGRQAIVDKDIKKAHENIIKAENIFNELIISLDVSKKWGQSLMSLYDFIVRRLIDANMKKDVKVIDEVIPLIEDVRNTWEEAYKISK.................................... 125
454 4.000e-43gi|496442078|ref|WP_009150923.1| flagellar biosynthesis protein FliS [Thiorhodovibrio sp. 970]  clstr ali  16  6MKKSTDQYRQAGVLSASPHRIIQLLFEGALERIAVGKGAMLQGNIAKKGEQISKAINIIDGLRGVLDHEKELAERLDALYEYMSYQLLQANLRDNPDALDEVTKLLREVKSGWDEIPEELRNSA................................. 135
455 4.000e-43gi|502791186|ref|WP_013026162.1| flagellar biosynthesis protein FliS [Pantoea ananatis]  clstr ali  13  10.TQAYAQVVESAVLSASPHQLVVMLFDGALSAMKKAAILIEQGDIPGKGNALSKAINIINGLRAGLNHEVEISANLDNLYEYMTRRLLQANLNNDVEAIAEVEGLLNNIADAWKQIGPNYQPQQ................................. 136
457 4.000e-43gi|665413291|dbj|GAK41253.1| flagellin-specific chaperone Flis [Paenibacillus sp. TCA20]  clstr ali  22  4..SPYEKYRQSSVQTSNPAQLVIMLYDGAIRFVRASMKGLEEKDLEQVNTNLGKAQTIISELMSTLNQDFEVSKSLYSLYEYMNHLLVQANIKKSLEPAQEALDMLTDLRDTWLTASKL------------VMTGSTY................... 127
458 5.000e-43gi|639453596|ref|WP_024631602.1| MULTISPECIES: flagellar biosynthesis protein FliS [Paenibacillus]  clstr ali  19  3.TSPYEKYKQSSVQTSTPGQLVIMLYDGAIRFVKVGLEGISSKDYMKANVNLGKAQTIISELMSTLDHSYPVSKNLFSMYEYMNHLLIQSNIKKVTQPAEEALNYLQELRETWIVANKQ...................................... 120
460 5.000e-43gi|491758137|ref|WP_005587123.1| Flagellar protein FliS [Clostridium ultunense]  clstr ali  23  2..NASQVYQEQQVLTASPQELVLMLYNAGIRFSKMAKKAIEEKRYEEAHRHLIRVQDILTELELGLNREIEIANQIGDLYDFMKRHTVEANAKKDVGKINEVIGLFEDFRSTWKEAMERARSEA................................. 123
461 5.000e-43gi|551222531|ref|WP_022850052.1| flagellar biosynthesis protein FliS [Geovibrio sp. L21-Ace-BES]  clstr ali  19  1MSNPYQNYIKQEVEGATKGKLVLLLYDGAIKFMKLAIIAVNEENVPEAHNNIMKAENIIYELMSTLNMDAEISDNLMRLYDFMIWQLIEANKTKDKQKIESVIELMASLREAWKEVVKQE..................................... 121
462 6.000e-43gi|502237255|ref|WP_012738512.1| flagellar biosynthesis protein FliS [[Eubacterium] eligens]  clstr ali  17  5.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIEKQDYEKANINIKKAENIITEFKVTLNHKYPVAKDFENVYNYIYSLLVDANIKKDTEILNRALDEIRGMRDTWKEVMNRTRS................................... 125
463 6.000e-43gi|547795612|ref|WP_022205541.1| flagellar protein FliS [Eubacterium sp. CAG:248]  clstr ali  18  5.QNMAQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDMEKAHTNIVKAEMIIEEFQATLNHKYPVAEDFDKLYKYIYGLLVDANMKKDLELLEKATDELRGMRDTWKEVMKRA..................................... 123
465 7.000e-43gi|516839944|ref|WP_018124856.1| hypothetical protein [Desulfovibrio oxyclinae]  clstr ali  20  1MANPAKAYLAVQVETTSQGQLLLMLYEACIKFLRQAKVEIEKKDYAKKGILISRALAIIHELTESLNKEKEISKNLAGIYMFCTNELTQANIKLDVEKIENVIKMMDSIRSAYEQIIPEAQKKNGAAGTQ........................... 132
466 7.000e-43gi|498182636|ref|WP_010496792.1| flagellar biosynthesis protein FliS [Paenibacillus elgii]  clstr ali  21  1MNQQAQQYLRTQVSTAAPGELTLLLYNGCIKFMKQAHEALVTKNYNEKNVNLKKAQDIIDELMITLNMDYEISKNLKMLYVFIKEQLFEANFKLNVECLETSISLVTELRDTWVEALKILKNKA................................. 125
467 7.000e-43T2D.4206508 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  5.QQAYAKYGNNKVLTASPGELTLLLYEGAIKFCNIAIIGVEHNDIQKVHNNLKKAQAIIEELRSTLNHKYPVAKDFDKIYEYIYSLLVDANISKKTEDIEAALVEIRGMRDTWKQVMQKTK.................................... 124
468 7.000e-43gi|500994443|ref|WP_012047917.1| flagellar biosynthesis protein FliS [Clostridium botulinum]  clstr ali  20  8..NAYNTYKNNSVNFASKDQLLLMLMDGAVKFSKIARQAIADKDVPKAHENLVKTQDIFYELMATLDVNQQWTKNLLSLYDFIVRKLAEANMKKDVKIIDEAIPLIEEIRDIWNEAYKLSKA................................... 129
469 8.000e-43gi|499650207|ref|WP_011330941.1| flagellar biosynthesis protein FliS [Nitrosococcus oceani]  clstr ali  14  4.NRALQQYRQSAVTAADPHRLIQMLLEGALEKITVARGAIARNDITQKGVNIGEAIDIVSGLQASLNREAEIADNLDRLYDYIIGRLLEANLRNDVAILEEIACLLGEIKQGWEAISTMNTSIAVQEGGKAV......................... 140
470 8.000e-43gi|648438594|ref|WP_026130345.1| flagellar biosynthesis protein FliS [Methylomicrobium buryatense]  clstr ali  22  1MNSGVRQYAVNSIEEASPHRLIQMLYEGGLQRIAIAKGALMRNQIAEKGENISRAIAIIGGLRSSLDLKQEIAQNLDNLYEYMERRLLEANLKNDVAILDEVSGLLKEIKVAWDAV......................................... 125
471 8.000e-43gi|504666435|ref|WP_014853537.1| flagellar biosynthesis protein FliS [Pseudomonas stutzeri]  clstr ali  15  7MKQYQSVNTNAQLVDATPHRLIQMLMEGGLTRLAQAKGAMERNDVALKGTLIGKTIDIVGGLRQGLNLEAEVAANLDSLYIYMTTRLVEANRKNDPTILDEVAGLLREIKSGWDGISQQ...................................... 127
472 8.000e-43gi|495234407|ref|WP_007959178.1| flagellar biosynthesis protein FliS [Pelosinus fermentans]  clstr ali  18  3.NNPYAQYKRMQVETASQGRLIIMLYDGALKNLRNAQHCITSKDINGAHRMLIKAQDIIKELNFTLNMSAEISNNLRNLYLYMLQRLVEANMAKDNTKIEEVVELLSTLKGAWDAVILKNKS................................... 124
473 9.000e-43gi|516426106|ref|WP_017815468.1| hypothetical protein [Paenibacillus sp. A9]  clstr ali  21  4..SPYEKYRQNAVQT-SPGQLLIMLYDGAIRFTLAAIDGINQKDYAKSNTNFGKAQAIVSEFRASLDRSYDVAENLDRLYEYMGYLLIQANIKKDVASAEEALGYLKDLRETWVEANKLAPAA.................................. 123
474 1.000e-42gi|515242254|ref|WP_016822930.1| hypothetical protein [Paenibacillus polymyxa]  clstr ali  21  4..SPYEKYKQSSVQTSTPGQLIIMLYDGAIRFVRAGLDGISSNDIAKANINLVKAQSIISELMSTLNYSYDISKNLYALYEYMNYLLIQTNIKKKIESGEEVLGYLQELRETWITVNKLTAGMSL................................ 126
475 1.000e-42gi|517694244|ref|WP_018864452.1| hypothetical protein [Thioalkalivibrio sp. ARh3]  clstr ali  16  6MRKNVDSYRQSEVQVADPHRLVQMLFEGALERIAVAKGAMKNGNIAYKGERIGKAIDIIDSLRSMLDHNPELAERLAALYSYMMRRLTEANLHNDPERLDEVAKLLREIKAGWDEIPREYRNPA................................. 135
476 1.000e-42gi|544740288|ref|WP_021169185.1| flagellar protein FliS [Sporomusa ovata]  clstr ali  18  1MNNTANAYKNQQIMTASPEELTLMLYNGAIRFIMESMMAVDKGDLEKANNANLRAQNIVREFMCTLDMQYEMSQGYYKLYDYIEYRLTQANLKKDKDQLEEAKNLLSELRDTWVQAMKLARTQ.................................. 125
477 1.000e-42gi|639415172|ref|WP_024615665.1| flagellar biosynthesis protein FliS [Clostridium sp. Ade.TY]  clstr ali  20  6.NNPYNAYKNNTINMASKDQLLLMLVDGAVKYTKIAKLAIEKKDIEKAHKELVRVQDIFTELMSTLDRSGEDFENLFNLYDFIKSKLAEANIKKNIQIIDEVLPLIEEVRNTWYEVSKKAK.................................... 126
478 1.000e-42gi|516854621|ref|WP_018132189.1| hypothetical protein [Alicyclobacillus pohliae]  clstr ali  21  3LNQPYQVYQNMAVQTATPERLLLMLFEGAIRFCKEAIHALQTQNYETGNAKIIRVQNIINELIVTLDRDVELAQNLLSIYQYLQRRLIEANLKKDQSIIEEVSQHLKELYEGFAEAAKLVKGQ.................................. 127
479 1.000e-42T2D.3872177 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  2....AQQYNRNKVLTASPAELTLLLYEGAIKFCNIAAVAIEKKDIEKAHTNIVKAELIIEEFQASLNHKYSVAEDFDKIYNYIYGLLVEANMKKDLDILEKATEELRGMRDTWKEVMKRA..................................... 117
480 1.000e-42gi|502775767|ref|WP_013010743.1| flagellar biosynthesis protein FliS [Denitrovibrio acetiphilus]  clstr ali  20  1MQSPYKNYIKQEVEGATKGKLVLLMYDGAIKFLRVAVKAVNENNIPDAHNNIMKAQNIIYELMSTLNMEADVAKNLMRLYDFMIWQLVEANKEKDNTKIESVIKLMSSLREAWKEVVQKE..................................... 121
481 1.000e-42gi|499686413|ref|WP_011367147.1| flagellar protein FliS [Desulfovibrio alaskensis]  clstr ali  24  1MQKAAHAYFQTQVSTTSQGQLLLMLYDGAIKFLNQAKDKIAQRDYAAKGILISKALDVINELDGSLNPEQELAENLHKLYFYCSTRLLNANLKMDVTLIDEVIRILSGLRSAYAQIM--DTPEAIEAQKQ........................... 130
482 1.000e-42gi|506327557|ref|WP_015847292.1| flagellar biosynthesis protein FliS [Paenibacillus sp. JDR-2]  clstr ali  17  1MQQPRNPYMQTSVQTANPAALLIMLYDGAIRFCRQGIEALKEQRNADAHTSLMKTQEIISEFIITLDRSNPVSESLLLLYDYFNHRLIEANTRKDAEPAEEVLGHLIDLKATWVEAAKQVNQMAGQANG............................ 130
483 1.000e-42gi|664790976|gb|AIF53649.1| flagellar protein FliS [Pelosinus sp. UFO1]  clstr ali  19  4..NPYAHYKRMQVETASQGRLIIMLYDGALKNLRIAQNSITQKNINGAHNSLIKAQDIIRELNGTLNLNAEIASNLRNLYLYMLERLVEANVNKDAEKVDEVIELLSTLKEAWDSIILKNKS................................... 124
484 1.000e-42gi|494278425|ref|WP_007160426.1| flagellar biosynthesis protein FliS [Pseudomonas psychrotolerans]  clstr ali  17  7MRQYQQVGLQAQVFEASPHQLIQMLMQGALDRLAKAQGALERGWLPEKGELIGKTVSIVAGLKDVLDFEQEIAVNLDRLYDYMIRRLSEANRNNDPVILEEVSGLIREIKSGWDAIAP....................................... 126
485 1.000e-42gi|570736767|gb|AHF07798.1| flagellar biosynthesis protein FliS [Desulfitobacterium metallireducens DSM 15288]  clstr ali  17  7....ANAYKNQQVMTASPEQLTLLLYNGALRFLNESILAMEQGDFQKSHNANMRAQAIVREFMHTLDMKFEISKDLARLYEYTEYCLIQGNIKKDVEQLKHAKDVLEDLREGWTGAMQQTH.................................... 123
486 1.000e-42gi|653218300|ref|WP_027430890.1| flagellar biosynthesis protein FliS [Lachnospira multipara]  clstr ali  17  15....AEQYKRSKILTASPAELTLMLYEGAIKFCNIAIMAIEKGDMERAHIYIKKTEDIIIEFRSTLDRKYKVAEDFERVYVYIYDLLVEGNIKKDTEILTRALNEIRGMRDTWKKVMEKTKGQS................................. 134
488 2.000e-42gi|651851278|ref|WP_026636756.1| flagellar biosynthesis protein FliS [Dyella japonica]  clstr ali  22  9......AYQQVRVETADPHGLIAMLMDGAIERLTKARGHMLHGEVAAKGELISRCLDIISELRGSLDPKVELVGQLGALYDYMGRRLLHANLHDDPRALDEVSDLMQKLRRAWAGIPMDARQPQ................................. 132
490 2.000e-42gi|656111567|ref|WP_029135077.1| hypothetical protein [Sedimenticola selenatireducens]  clstr ali  17  6MKSALSQYNSVSVNSATPHRLVQMLMEGALDKIAAAKGHMARNEPADKGRYISWAISIVSGLQSSLDMESELSRNLDDLYDYMVRRLGEAGAKNDPKILDEVSSLLLEVKSAWDVIPSQLDAE----NRQTA......................... 139
492 2.000e-42gi|686570755|gb|AIQ14811.1| flagellar biosynthesis protein FliS [Paenibacillus durus]  clstr ali  21  11...GYQAYQQNKYQTASPHRLTLMLYNGAIQFAGKAKQAITEGDISQTNKYIQKTQDIVYELMSALNQKEEIARNLKNLYFYMIERLIEANIKKNTASIDEVVAMLQELKSAWEEIGK....................................... 127
493 2.000e-42gi|499941330|ref|WP_011622064.1| flagellar biosynthesis protein FliS [Shewanella sp. MR-4]  clstr ali  15  1MRGSMQSYRKVSVESASPHRIIQMLFAGALERLAQAKCAIEQGNIAQRGLFLGKAIGIVSGLNSSLNMDAEVATNLTRLYDYMLRRMSEANINNDVQAIDEVVAILKTIKEGWDAIP........................................ 123
494 2.000e-42gi|494914808|ref|WP_007640846.1| flagellar biosynthesis protein FliS [Cellvibrio sp. BR]  clstr ali  17  7.QEALKQYQKLGIESASPHRLIQLLFEGALGRLAAAQGAMERGDIAVKGEMLGKAIGIVGGLRSSLDMDAEISERLDQLYEYINLRLLEASAQNDIDKVVEVIQLLKTVKSGWDEIGPQAAKAP................................. 134
495 2.000e-42gi|585386509|dbj|GAF14031.1| flagellar biosynthesis protein FliS [Bacillus sp. JCM 19045]  clstr ali  16  4....QTAYKQQSVQTASPGELTLMLYDGCLKQIRFAEHAIEQKNIENRHIALSKAEAIIRELMVTLKTDTEVGMNMMRMYEYILHHLIEANVKNDVLLLQEAKTYVEEFRQTWKQVIQLERQ................................... 121
496 2.000e-42gi|644124969|ref|WP_025281905.1| MULTISPECIES: flagellar protein FliS [Ectothiorhodospiraceae]  clstr ali  20  6MHRGINQYQQVGASGADPHRLIEMLLDGGVDRLAQAKGAIARGDRRGKVKLIDKAFNIIGGLRGGLDMDRDIARNLDDLYDYMQRRLTLANAHDDVEGLDEVISLLNEVREGWKAIPVEARKAA................................. 134
498 2.000e-42gi|557698398|ref|WP_023438642.1| flagellar protein fliS [Clostridium tetani]  clstr ali  19  4.NNAYNTYKTNSVNYASKEQLLLMVLDGAVKFSKIAKQGIEEKNIIKAHENIIKTQNIFYELMATLDVEQQWAENLMRIYDFIIQKLLEANIKKDVKIMNEIIPIIEDIRDTWHEAYKISK.................................... 125
499 2.000e-42JGI.Meta JGI_HUM.2310591 7004866538 C3858453__gene_234798 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 1 of subject 159268001] :  ali  21  1MGNAASLYQGTAINTATPAELTLMLYNGAIKFCNQAAVGIEEKNIEKAHQNLIKAQNIIWELQGTLDFKYPVAKDFDLVYKKIAQNLLMANLRKDIEKLNEALEDIRGLRDVWAQVMKAAKTA.................................. 123
500 2.000e-42gi|648594333|ref|WP_026286084.1| flagellar biosynthesis protein FliS [Salsuginibacillus kocurii]  clstr ali  16  8.....NVYKQNAATTASPGELTLMLYNGILKFTKRARQAMDEKDVQGRNEALQRAQAIISELLITLKVEDETTENMARLYEYINYQLIQANVKNDPAFIDEAEQYVIRFRDTWKEVIQQERKRKYGGGV............................ 131
502 2.000e-42gi|504779372|ref|WP_014966474.1| flagellar biosynthesis protein FliS [Gottschalkia acidurici]  clstr ali  19  4.NNPYNQYKQNSVTTASPEELTLMLYNGAIKFVNIAKIEMEAKNIERTNEAIVRSQDIIRELNGSLNMNYPISENLRTLYTFILEKLIDANIQKDIKIIEEILPIIEEMRDTWKLVIEEVKRQKFAQGA............................ 131
504 2.000e-42gi|501085921|ref|WP_012136203.1| flagellar biosynthesis repressor of class 3a and 3b operons [Marinobacter lipolyticus]  clstr ali  20  2..NGLQQYQQTSITDADPHKLIQLLYNGALERINMAKARMQAGDIEGKGRLISKTIEIIGGLRSFLDFDQELAIQLESLYDYMERTLLEASARNSVEKLDEVASLLRSVKDGWDGI----REEVVAQQTQAV......................... 133
505 2.000e-42gi|573566960|gb|ETT65511.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL H8-237]  clstr ali  16  3.NSPYEKYRQSSVKTSTPSQLLIMLFDGAIRFVRAGMEGIDSVDYQKTNINLGKAQTIVSELMSTLDPTYDISKSLNDLYEYINHLLIQANVKKDKVPAEEALQYLTEFRVTWLEASKLV..................................... 121
506 2.000e-42gi|639212587|ref|WP_024550592.1| MULTISPECIES: flagellar protein FliS [Cronobacter]  clstr ali  15  4.NSGVQSYQESAVMSASPHQLIVMLFDGAHSALVRARLFLEAGQMAEKGEALSKAINIIDGLKAGLDMEAELSQNLASLYEYMVRRLLQANLRNDVDAISEVEGLLVNIADAWKQI......................................... 125
507 2.000e-42JGI.Meta JGI_HUM.4193301 7011721024 C1897798__gene_157348 flagellar protein fliS [Human Stool microbiome from visit number 1 of subject 765620695]  ali  37  1LKKEQIADFTRRISQTNRGGLIVVMYDIVFAYLDDAKEAFASEDWEGYKEALRRAQQAINELILALDFSYELAKNLYSIYLFCRDSLAAAMYKRRLDELETAERLMKKLYDGFVQAAKE...................................... 119
508 3.000e-42gi|665411193|dbj|GAK43491.1| hypothetical protein TCA2_5989 [Paenibacillus sp. TCA20]  clstr ali  20  5...PQQKYQQTKAQTASPAQLIIMLYDGAIRFTQIAVVGIEEKNLEKSNTHFIKAQAIINELIASLNFNYELSHQLLPIYEYLLRLLIEANVKKNKEAAYEVLEHLQELRSAWDQASR....................................... 119
509 3.000e-42gi|668727815|gb|KFC13236.1| FliS family flagellar biosynthesis protein [Trabulsiella guamensis ATCC 49490]  clstr ali  15  1MYNGAQAYQESAVLSASPHQLVVMLFDGALSSMVRARLFLEQGNIAAKGEALSKAINIINGLKAGLNMDVDLPHNLSALYDYMVRRLLHANLRNDAGAITEVEQLLANIADAWKQIGPNSPSTQ................................. 133
511 3.000e-42gi|494775956|ref|WP_007511364.1| flagellar biosynthesis protein FliS [Rhodanobacter denitrificans]  clstr ali  21  9......AYQQVRVESADPHGLITLLMDGALERLVKARAHMLRGEVAAKGEAISRCIEIIGGLRGSLDPKADLVGRLDSLYDYMSRRLLQANLRDDASLIDEVSNLLQPIRDSWVQIAPAASQ................................... 130
512 3.000e-42gi|599129955|gb|EYE88795.1| flagellar biosynthesis protein FliS [Fervidicella metallireducens AeB]  clstr ali  19  4.TNALNVYQQNSVNTASKEKLLIMLYDGLVRFIKQGIAGIEEKDINKSNTNLVKAQSIILEFMATLNLEIEMATSLMALYDYMHRRLIEANIKKDIEIAKEVLGFAEELKETFEEAYRITKKG.................................. 127
516 3.000e-42gi|551004868|ref|WP_022749555.1| flagellar biosynthesis protein FliS [Lachnobacterium bovis]  clstr ali  20  4.NQGYAAYANNKVLTASPAELVLMLYEAAIKFTNIAIAAVDKKDIQKAHDNIIKVERIIDELQLSLDKRYPVAQDFDNVYQYIQERLVVANMDKDKEVLEEILKHLRKMRDTWKEVMKKA..................................... 128
517 3.000e-42gi|699062969|gb|KGM46471.1| flagellar biosynthesis protein FliS [Bacillus niacini]  clstr ali  20  1MINPNEIYQRNQIMMAKPEELTLMLYNGGVKFLNQAKLAIEKKDPAKAHSLIMKTQEIITELMVTLNMEIETSNSLFSLYDYMKQRLIEANMSKDIEILKEIEGMFQELKITWTQAMK....................................... 118
518 4.000e-42gi|555551426|ref|WP_023276411.1| flagellar protein FliS [Mucispirillum schaedleri]  clstr ali  14  1MQTAYQNYKKQEVEGATKGKIVVLLFEGTIKFLRKASKAIDEDNIQEAHNNIVKAENILYELMSTLNMDAEIADNLMRLYDFMIWQLIEANRDKDKNKVESVIELLLPLCDAWKQIVEKDN.................................... 122
519 4.000e-42gi|501050814|ref|WP_012102452.1| flagellar biosynthesis protein FliS [Clostridium kluyveri]  clstr ali  17  5..NAYNAYKTNSINYASKEQLLLMLVDGAVKFVKIGRQAIVDKNIKEAHENIIKAENIFYELMATLDVSKDWGQSLMSVYDFIVRRLVYANIKKDVKIIDEVIPLIENVKDAWNKAYK....................................... 122
521 4.000e-42gi|503255511|ref|WP_013490172.1| flagellar biosynthesis protein FliS [Bacillus cellulosilyticus]  clstr ali  17  5.NNPYANYKQKAAETKTPGELTLMLYEGCLKFIKQAGKAMDEENYQDKNTNLIKAQNIVKELMVTLKTDTEVAIGMLQMYDFILSRLTDANINNDVDALKEAEEFVVEFRDTWKQVIQIDRKQ.................................. 126
522 4.000e-42gi|491910027|ref|WP_005665903.1| flagellar protein FliS [Massilia timonae]  clstr ali  23  17........LETGVASASPHKLVVMLYDGVIVALLSAINGIKSSNIATKGASISKAITIIDGLRASLDKKAEIAANLDALYDYMSRRLLEANIKNDAAIVEEIHGLMANLREAWVQIEQQAAAEPMPPAIQKA......................... 144
523 4.000e-42gi|522141541|ref|WP_020652750.1| hypothetical protein [Massilia niastensis]  clstr ali  21  5MKRGVNAYLETGVAAASPHKLIIMLYDGAMVALLSAISNMKSSNVAAKGAAISKAITIIDGLRASLDKNADIAHNLDALYDYMSRRLLQANIKNDVAGIEEVHGLLSDLREAWLSIGEKS-GQPVPQAAPA.......................... 141
524 5.000e-42T2D.3978099 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  16  5.QNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIKKQDYEKANTNIKKAENIITEFKVTLNHKYAVAKDFENVYNYIYSLLVDANIKKDPDILNKALDEIRGMRDTWKEVMNQTRS................................... 125
525 5.000e-42gi|503836773|ref|WP_014070767.1| flagellar biosynthesis protein FliS [Enterobacter asburiae]  clstr ali  17  16.........ESAVMSASPHQLIVMLFDGALSALVRARLFLEQGDLVSKGEALSKAIGIIDGLKAGLDMNAELSNNLASLYDYMVRRLLLANMHNDVETIIEVEGLLNNIADAWKQIGETASTHQDM............................... 135
526 5.000e-42gi|545060589|ref|WP_021433684.1| flagellar protein FliS [[Clostridium] bifermentans]  clstr ali  21  5..NPYNTYKQNSINMASKEQLLLMLVDGAVKYTKIAKIAIEKKDIQRAHKELIRVQDIFTELMATLDMSSSFVQDLFNLYEFIKNKLADANMKKDINIIDEVLPLIEDVRDMWHEVSKKAK.................................... 124
527 5.000e-42gi|446023137|ref|WP_000100992.1| flagellar biosynthesis protein FliS [Escherichia fergusonii]  clstr ali  17  8..QAYAQVVESGVMSASPHQLIEMLFDGAHSALVRARLFMQQGEIVAKGEALSKAINIIDGLKAGLDEEKELARNLSSLYDYMIRRLLQANVRNDVQAIEEVEGLLGNIADAWKQISPKGVSQ.................................. 132
528 6.000e-42gi|489494327|ref|WP_003399247.1| flagellar biosynthesis protein FliS [Clostridium botulinum]  clstr ali  19  5..NAYNTYKNNSVNFASKDQLLLMLMDGAVKFSKIGKQSILDKDIVKAHENLVKTQDIFYELMATLDVNQSWGKQLMSIYEFIVRRLGEANIKKDTEIMDEVIPLIEDIRDIWYEAEKLSKQ................................... 126
530 6.000e-42gi|501233531|ref|WP_012276549.1| flagellar biosynthesis protein FliS [Shewanella halifaxensis]  clstr ali  14  1MRSSLQSYRKVSIAVASPHRIIQMMFDGALQRIAQSRYAIENKDLANKGIFIGKAIGIITGLNNSLNMEADVSKNLSELYDFMLRQLSEANLNNDVQALDNVSGIIRTIKEGWDAIPSEQH.................................... 127
531 7.000e-42gi|558084737|ref|WP_023479156.1| flagellar protein FliS [Enterobacter cloacae]  clstr ali  14  4.KSGIQAYAQSAVMSASPHQLVVLLFDGALSAMKKAAILIEQGDIPGKGQALTKAINIINGLRAGLDHEVELTANLDSLYDYMTRRLLQANLHNDLAAIDEVTLLLSNIADAWKEIGPT...................................... 128
532 7.000e-42gi|501095598|ref|WP_012145664.1| MULTISPECIES: flagellar biosynthesis protein FliS [Serratia]  clstr ali  16  7.TQAYAQVLESGVMSASPHQLIVMLFDGALSALLRARILMNQGDIAGKGLALSKAINIIDGLKSGLDHQQEMADNLAALYDYMKRRLMQANLHNDEAAITEVVKLLENIADAWRQIGPN...................................... 128
533 7.000e-42gi|668964217|gb|KFC81653.1| FliS family flagellar biosynthesis protein [Buttiauxella agrestis ATCC 33320]  clstr ali  15  7.TQAYAQIVESAVMSASPHQLIVLLFDGALSALVRARLFMQQGELAAKGEALSKAINIIDGLKAGLDNEQEIAENLSSLYDYMIRRLMLANLRNDVELIEEVEGLLTNIADAWKQISPLNAA................................... 131
534 7.000e-42gi|652922111|ref|WP_027175980.1| hypothetical protein [Desulfovibrio aminophilus]  clstr ali  24  1MKNGAKAYLATQVTTTTQGDLLLMLYDAAIKFLKQAKVKIAERNYAEKGILISRALDIISELAESLNKEKDVAKNLNNLYFFCSTRLLKANLKMDAALIDEVVGILSGIRSAFAQIIP....................................... 120
535 7.000e-42gi|566001042|ref|WP_023990666.1| flagellar biosynthesis protein FliS [Paenibacillus polymyxa]  clstr ali  19  3.NSPYQKYQQTQLQTASPAQLLLMLYDGAIRFVRMGISGIEESNYEKSNINLCKAQAVINELIAALNYDYQIAKTLFQVYEYMLHRLINANLKKDKAPANEVLSYLLELRGAWEEAGK....................................... 119
536 7.000e-42gi|495729222|ref|WP_008453801.1| flagellar biosynthesis protein FliS [Enterobacter sp. Ag1]  clstr ali  16  8..QAYQQVLESAVMSASPHQLVVMLFDGALSALVRARLFLEQEQIPQKGEALSKAINIIDGLKAGLNMDVDLPANLANLYDYMVRRLLHANLRNDVEAIAEVERLLANIADAWKQIGPTS..................................... 129
537 8.000e-42gi|618854308|gb|KAJ53504.1| flagellar protein FliS [Clostridium tetanomorphum DSM 665]  clstr ali  20  5..NAYSAYKNNSVNFASKEQLLLMILDGAVKFSKIARQAIEDKDVKKAHENIIKTQNIFYELMATLDVAQEWAEKLMDVYEFIVNRLMIANVKKDVAIMDEIIPLIEDVRDTWNEAYKLSKS................................... 126
538 8.000e-42gi|517060359|ref|WP_018249177.1| hypothetical protein [Orenia marismortui]  clstr ali  20  3.NKQYQKYKKSQYETASQEQLLIMLYNGAIKFGNQAKKAMEEGKIDLANNKLKRTQAIINELIVTLDMDKEIAQNLYSLYEYMNRRLVQSNIRKEPKIVDEVISLLEDLKESWMEVI........................................ 120
539 8.000e-42gi|504590213|ref|WP_014777315.1| flagellar biosynthesis protein FliS [Thiocystis violascens]  clstr ali  20  4MRRELNQYRQAGASVANPHRLIQMLFEGALERIAVARGAMEQGNIRVKGEKVSQAIAIIDGLRASLDHGKDLSEKLDALYEYMNRRLLEGNARNDLDALDEVSRLLREIKSGWDAIPEMLRRAS................................. 133
540 8.000e-42gi|501238875|ref|WP_012281893.1| flagellar biosynthesis protein FliS [Heliobacterium modesticaldum]  clstr ali  14  9....ADAYMTQKIMTSPPEELTTLLYDGALRFIKKGIVAIDEKNMLEAHQRIIRAQDIVIELMETLNMSQEISSQLMALYDFVLYCLVEGNVKKDKTHLNHAQELLQDMRDTWVEAIKQSR.................................... 125
541 8.000e-42gi|518385263|ref|WP_019555470.1| hypothetical protein [Zymophilus raffinosivorans]  clstr ali  20  3.NNAARTYRTQQVMTATPAELTLMLYNGAIKFTSESIKYLQVKNYEQANTSCLKAQKIITEFMVTLKMDYDFSQDWLAIYDYIRRCLIEGNLKNDTIKLEEAKNLITELRNTWHEIIKIDKSGGDMDHVQA.......................... 138
542 8.000e-42gi|556511101|ref|WP_023355998.1| flagellar protein FliS [Catonella morbi]  clstr ali  17  3MTNAASLYQGAAINTASPAELTLMLYNGAIKFCNLALIGMEEEDIMKAHNNLMKAQRIIRELQATLNFKYEVSKDFDLIYTRILNSLLAANIKKDTDKLNEALEDIRGIRDVWTQVMKVAK.................................... 123
543 8.000e-42gi|651976061|ref|WP_026691418.1| flagellar biosynthesis protein FliS [Bacillus aurantiacus]  clstr ali  17  4.RNPYANYKQQNMQTKTPAELTLMLYEGCVKFIRRGEKALVEGNMEVKNENLIKAQNIIRELMVTLKVETDTARNMMQMYDFILSRLTDANTKNDVKALKEAERFVVDFYDTWKEVIKIDRQ................................... 124
544 9.000e-42gi|406886603|gb|EKD33600.1| Flagellar protein FliS [uncultured bacterium]  clstr ali  17  2..NAYSQYHQNQILSASPEQILLMLYDGAIRFTRQAIYGIEEDNLTLFHNGIRKSMAIITEFSNSLDHTIEIAENLDALYNFMIRELTLANLHKDIEKLRIVEKLLVDLRATWEEAVEINKGE.................................. 124
545 9.000e-42gi|516881911|ref|WP_018145623.1| flagellar biosynthesis protein FliS [Thioalkalivibrio sp. AKL6]  clstr ali  16  6MNRAVNQYRQSGAQVADPYRLIQMLFEGALERIAVAKGAVQQGNVGLKGEKIGKAIDIVESLRALLDHDKELAGRLDALYEYMSRRLLEANAKNDPAALEEVTGLLRQIKAGWDEIPSEQRAA.................................. 134
547 1.000e-41gi|503216655|ref|WP_013451316.1| flagellar biosynthesis protein FliS [Calditerrivibrio nitroreducens]  clstr ali  22  3.QQAQKTYLKNEIEGATKGKLVLLLYDGAIKFINMAVKGIEEKNIVAAHENIIKAENILYELLSTLNMEAEIAENLFKLYDFAIWQLVEANKTKDAEKLTPVLGILKTLRDAWKEVVTQEEEKQTVNNQQKV......................... 135
549 1.000e-41gi|573542150|gb|ETT41081.1| flagellin-specific chaperone flis [Paenibacillus sp. FSL R5-192]  clstr ali  22  3.KSPYDQYRKSSVQTSSPGQLLIMLYDGAIRFVRTALDGLGTKDYEKVSLNLGKAQTIVSELAVTLDQSSDIAENLNALYEYINFLLIDANTKKTSEPAEEALGYLKELKETWVQVNKMVSS................................... 123
550 1.000e-41gi|515523493|ref|WP_016956747.1| flagellar protein FliS [Catenovulum agarivorans]  clstr ali  17  3.KRGINAYQKQQIAQADPHQITLMLMQGAIDKMAYAKGCMERKDFEGKSVHLSKASAIIVNLRDTLDFESEVTDNLFALYDFMVNRLTDAHVQNSQSIIDEVIGLMLPIKSAWASIPEEAKQEAYEMQRQK.......................... 138
551 1.000e-41gi|655005223|ref|WP_028454379.1| flagellar biosynthesis protein FliS [Chitinilyticum litopenaei]  clstr ali  20  14.....KQNLQSQVESASPGRLIVMLYEGAIKSIQLGRMHMQNGEIAEKGQAISKAISIIDELRLALDHEQELAANLDALYFYMMQQLLEANLRNTTEPLDQVLVLLNDLKEAWESISQPAAAQPPLLSEPAAEANLSYGK................. 156
552 1.000e-41T2D.4185302 [KEGG:K02422] flagellar protein FliS;|[COG1516] Flagellin-specific chaperone FliS  ali  18  16.QQAYSQYNNNKVLTASPAELTLLLYEGAIKFCNVAIIGVEQKDIMKVHNNLKKAQVIIEELRATLNHKYPVAEDFENIYKYIYNLLVRANVSKKTEDIETALVELRGMRDTWKEVMKNTKS................................... 136
553 1.000e-41gi|544825381|ref|WP_021241380.1| flagellar biosynthesis protein FliS [Enterobacter cloacae]  clstr ali  14  4.KSGIQAYAQSAVLSASPHQLVVLLFDGALSAMKKAIILIEQGDIPGKGQAISKAINIINGLQSGLNHEIDLAANLDSLYDYMTRRLLQANLHNDINAINEVVELLNNIADAWKEIGP....................................... 127
554 1.000e-41gi|658075819|gb|KEH89013.1| flagellar biosynthesis protein FliS [Clostridium novyi A str. BKT29909]  clstr ali  17  4.NNAYKTYKNNSVNFASKDQLLLMLVDGAVKFAKMGRQAILDKNIKKAHESLTRTQDIFFELMATLDVNAEWGKQLMGIYEFIVKRLADANIKKDVEIMNEVIPLIEEVRDTWYEADKISKGK.................................. 127
555 1.000e-41gi|503490649|ref|WP_013725310.1| flagellar biosynthesis protein FliS [Clostridium botulinum]  clstr ali  16  9.NNAYKAYKNNSVNYASKEQLLLMLLDGAVKFAKMGRQAIIDKKIQKAHESLTRTQDIFYELMASLDISAEWAKNLMGIYEFITKRLADANMKKDIEVMNEVVPLIEDVRDTWYEAEKLSRGQ.................................. 132
556 1.000e-41JGI.Meta JGI_HUM.1310501 7070782352 C3885178__gene_270913 flagellar protein fliS [Human Tongue dorsum microbiome from visit number 3 of subject 159510762] :  ali  16  10MINAASLYQGAAINTASPAELTLMLYNGAIKFCNLAAAGIEEKDIMKAHNNLMKAQKIIRELQATLNFKYEVSKDFDLIYTRILKNLIAANVKKDIDKLNEALEDIRGIRDVWAQVMKVAK.................................... 130
557 1.000e-41gi|588313248|gb|EXF47092.1| flagellar protein FliS [Pseudomonas sp. BAY1663]  clstr ali  16  7MKQYQSVNTNAQLVDASPHRLIQMLMEGGLTRLAQARGAMERGDVALKGTLIGKAIDIVGGLREALNQEAEIAANLDNLYAYMASRLIEANLKNDSAIIDEVAGLLREVKSGWDGIAQ....................................... 126
558 1.000e-41gi|654855174|ref|WP_028307518.1| hypothetical protein [Desulfitibacter alkalitolerans]  clstr ali  19  1MNSPVNTYLQQQVSTVSQEKLVLMLYDGEIKFLKKALESIAAKNIQEAHYNILRAQDILMGLMSGLNMSTQIAENLFNLYEYMHSRLVEANIYKDTSIIEEVLTMIIDLRNTWNQILKTTK.................................... 122
559 1.000e-41gi|685435969|gb|KGA97214.1| flagellar biosynthesis protein FliS [Bacillus alcalophilus ATCC 27647]  clstr ali  19  5..QMQATYKQNALKTASPGELTLMLYNGCLKFMKQAEKAMGAEQTEARNTAITKAQNIIRELMVTLKTDSELGVNMMRMYDFTLNRLVDANVKNDLQALKEAEDIVVQFRDTWKEVIQLDRKQ.................................. 125
560 1.000e-41gi|655129722|ref|WP_028576814.1| flagellar biosynthesis protein FliS [Desulfomicrobium escambiense]  clstr ali  23  1MHKAANAYMQTHVTTTTPGHLVVMLYDGAITFLEQAKEEIEAKNFAKKGILISQALDIIAELDGSLNNERDLAQNLHRLYMYCNTRLLRANLKMDTAIIDEVVGILSSFRSAFAEISRT...................................... 121
561 1.000e-41gi|506439809|ref|WP_015959526.1| flagellar biosynthesis protein FliS [Enterobacter sp. 638]  clstr ali  17  4.KSGVQAYQESAVLSASPHQLVVMLFDGVHSALVRARLFLEQGDIPAKGEALSKAINIIDGLKAGLNMDVGLPHNLSALYDYMVRRLLHANLRNDVEAIVEVEALLLNISDAWKQINP....................................... 127
562 2.000e-41gi|499780035|ref|WP_011460769.1| flagellar biosynthesis protein FliS [Desulfitobacterium hafniense]  clstr ali  21  21..QMAAAYKNQQIMTASPEQLTLLLYNGALRFLNESIQALESGDKEKSHNANLRVQAIVHELMGTLDMNYEISQNWAALYEYIEHCLIEGNIQKDVQQLYNAKEILEDMRNTWQEAMKLAQQAKVAG.............................. 145
563 2.000e-41gi|666993444|gb|KEZ88799.1| flagellar biosynthesis protein FliS [Clostridium sulfidigenes]  clstr ali  19  7..NAYNAYKNNSVNYASKEQLLLMLLDGAVKFAKIARQAILDKDVKSSHENLVKTQDIFTELMITLDQNAEWAVNMYKIYEFIKERLFQANIKKDVKIIDEVMPLIEEVRNTWQEAYEVSKGK.................................. 128
564 2.000e-41gi|501081316|ref|WP_012131915.1| flagellar biosynthesis protein FliS [Citrobacter koseri]  clstr ali  15  16.........ESAVMSADPHQLIVMLFDGALSALVRARLFLEQGELLSKGEALSKAINIIDGLKAGLNMDVELSRNLASLYDYMIRRLLLANLHNDVEAIIEVEGLLTNIADAWKQI......................................... 125
565 2.000e-41gi|652571501|ref|WP_026964856.1| hypothetical protein [Alicyclobacillus pomorum]  clstr ali  16  6..QAYARYKAMSVQTASPDRLLIMLYDGLLLAMRSAKEQILASNLPEAHRQLVKAQDIVHELRNTLKMEYEISHALAALYEYFLRRLTEANVKKAVHPIDEIYPRVEELREAWVQASMKLRTEAAM............................... 129
566 2.000e-41gi|494119813|ref|WP_007059592.1| flagellar biosynthesis protein FliS [Clostridium carboxidivorans]  clstr ali  20  4.QNAYKTYKTNSINYASREQLLLMLVDGAVKFSKIGRQAIIDKDVKKAHENIVKTQNIFFELMATLDINADWAKSLMNVYDFIARRLIDANMKKDLAIMDELIPLIENIKDTWEQAYKLSKGG.................................. 127
567 2.000e-41gi|495126182|ref|WP_007850993.1| flagellar biosynthesis protein FliS [Cronobacter sakazakii]  clstr ali  17  8..QAYQQVLESAVMSASPHQLVVMLFDGALSALVRARLFIEQGDTVAKGQALTKAINIIDGLKAGLNMDIDLPRNLASLYEYMVRRLLHANLRNDVDAINEVETLMTNIADAWKQIGP....................................... 127
568 2.000e-41gi|516564365|ref|WP_017939551.1| flagellar biosynthesis protein FliS [Pseudomonas thermotolerans]  clstr ali  16  1MNAALRQYQQAQVVEASPHRLIQMLMEGGLTRLAQARGAMERGQVGLKGELIGKAIAIIGGLRDGLNMEAELAQNLDRLYEYMSARLFEANRENDFAKLDEVAGLLRTIKSAWDAIAPAA..................................... 128
569 2.000e-41METAHIT V1 GL0008968 [Complete] locus=scaffold60350_3:3608:3985:+  ali  17  14...........KVLTASPAELTLLLYEGAIKFCNIAMMGIEEKNIQKTHDNIKKAQAIIEELQATLNHSYKVAEDFDNVYRYIYSLLTDANIHKDKETLEKALNEIRGMRDTWKQVMKSAKS................................... 124