current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16128007|ref|NP_414554.1|(removed signal:1-23) conserved protein, UPF0412 family (yaaI b0013 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
7 2.000e-42gi|320089039|emb|CBY98795.1| UPF0412 protein yaaI Flags: Precursor [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]  clstr ali  89  39NDHKILGVIAMPRNETNDLTLKIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNKRCVSKITFSGHTVNSSDMARLKIIGDD 149
13 2.000e-41gi|506490612|ref|WP_015965990.1| DUF2541 domain-containing protein [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  85  24NDHKLLGVIALPRNETNDLTLKLPVCRVVKRIQITVDHGDAQLSGASVYFKAAKSASQSLSVPSELKEGVTTEWININSDNDTRRCVSKITFSGHTVNSSDMATLKIIGDD 134
17 3.000e-35gi|501235546|ref|WP_012278564.1| hypothetical protein [Shewanella halifaxensis]  clstr ali  24  26DEQITLGRTILLGGGDHGAKIPLLICRKTDAIRVKAER-DLHLEKIKVTFN--NGQTKTIRFYRDLKKNKYTDWRKFAYP----RCVKKLEVFGNSDGS--KAGVKVLGR. 126
18 3.000e-35gi|644512110|ref|WP_025325983.1| hypothetical protein [Aeromonas hydrophila]  clstr ali  24  36DDEFRLGKTMLLGVGDHPAIIPVIICRPAKSIMVKAGR-ELTLDRVKVIY--GNDRSKTLHFDKDLKEDQESGWKSLGS----RVCIKRIEVYGNSEGS--KAGVKVYGR. 136
19 5.000e-35gi|754703211|ref|WP_042079164.1| hypothetical protein [Aeromonas sanarellii]  clstr ali  26  31DDDIRLGKTLLLGVGDYPATIPMVICRPVKSLMVKA-RRDLTLDRVKVIY--GNDRSKTLHFDRNLKEGQESGWKSLGS----RLCIKKIEVYGNSSGS--KAGVEVYGR. 131
22 9.000e-35gi|769899831|ref|WP_045040826.1| hypothetical protein [Photobacterium iliopiscarium]  clstr ali  25  27.DQITLGRTILLKHGEHGAKIPLVVCRNTNAIKVKAER-NLHLERIKVTFR--NGETRNISFYRDLKKNQETSWRKFSY----KRCVKKLEVYGNSDGT--RAGVKVYGRQ 127
24 1.000e-34gi|991958404|gb|KXF80859.1| hypothetical protein ATN88_16465 [Enterovibrio coralii]  clstr ali  32  26DDKFTLGRTILLENANHGAEIPLLVCRRTDAIQVEA-RKDLHLRKVVVTFN--NGDTKTIRFHRNVKEDRTTDWRKFAY----KRCVKKLEVFGESKNSS--AGVRVYGR. 126
25 2.000e-34gi|751277861|ref|WP_040986710.1| hypothetical protein [Vibrio renipiscarius]  clstr ali  26  24DDKFTLGRTILLEHGSAAAKIPMVICRRTNAIQIRAEK-DLTLRKAVVKFQ--NGESKTFSFYRDFKEDDKSDWRYFGY----RRCVKSIDVYGNSEGS--KAGVRVYGKE 125
26 2.000e-34gi|544710493|ref|WP_021140760.1| hypothetical protein [Aeromonas salmonicida]  clstr ali  26  37DDEFRLGQTLLLGVGDHAAIIPIIVCRPAKSIMVKAGR-ELTLNRVKVFY--GNDSSKTLTFDKDLKEDQESDWKSLGS----RLCIKRIEVYGNSEGS--KAGVKVYGR. 137
27 2.000e-34gi|488497228|ref|WP_002540672.1| hypothetical protein [Grimontia indica]  clstr ali  34  26DDDITLGRTIVFENTDYGAPIPLLVCRRVDAIQVKADR-DMYLRKVVATFK--NGDTKTFRFYRNIKEDDTTDWRELPY----KRCVKKLEVFGESKNSS--AGVRVYGR. 126
28 3.000e-34gi|545471996|ref|WP_021708359.1| hypothetical protein [Vibrio azureus]  clstr ali  26  24DDKFTLGRTILLEHGNLAAKIPMIVCRNTNAIKIKAEK-NLELRKAVVKFQ--NGEEQTIHFHRDLKKDHTTDWRYFGY----RRCVKNIDVYGNSKGS--KAGVRVYGKE 125
29 4.000e-34gi|501280454|ref|WP_012323472.1| hypothetical protein [Shewanella woodyi]  clstr ali  24  26DDQITLGRTILLGAGDHGAKIPLLICRKADALKVRAER-NLNLEKIIVTFN--NGSTKTISFYRDLKKDQETQWRGFGY----KRCVKKLEVFGNSDGS--RAGVKVLGR. 126
30 6.000e-34gi|678239641|dbj|GAK83679.1| hypothetical protein JCM19238_1241 [Vibrio ponticus]  clstr ali  26  24DDKFTLGRTLLLEHGKHAAKIPLLVCRNTNAIKIKAEK-DLDLRKAVVKFQ--NGESKTFNFYRGFDKDEFSDWRYFG----KRRCVKSIDVYGNAEGS--KAGVRVYGKE 125
31 8.000e-34gi|515577534|ref|WP_017010291.1| hypothetical protein [Enterovibrio calviensis]  clstr ali  33  26EERITLGRTILLENASHGADIPLLMCRRVNAIKLKADR-DAYVRKVKVTFK--NDETKTINFYRNIKEDATTDWRKFAY----KRCVKKLEVFGESKNSS--AGIRVYGRQ 127
32 8.000e-34gi|914776955|ref|WP_050719677.1| hypothetical protein [Aeromonas tecta]  clstr ali  23  36DGEFRLGKTLLLGVGDRPAIIPMIVCRPVKSIMVKAER-ELTLDRVKLTY--GDGRSKTLNFDRDLAQDQESGWKSLGA----RLCIKKIEVYGNSEGS--KAGVKVYGR. 136
33 9.000e-34gi|491490654|ref|WP_005348390.1| hypothetical protein [Aeromonas diversa]  clstr ali  27  31.DQFTLGRTLLLGIGDSGATIPLLVCRPTKYVKVKAERG-LTLERLVVTY--GDDRTRTVRFDREMDKDQETQWQSLG----TRRCVKKIQVYGNAEGS--KAGVKVFGR. 130
34 1.000e-33gi|647532142|ref|WP_025822305.1| hypothetical protein [Shewanella marina]  clstr ali  25  27DERITLGRTILLEVGNHAAKIPLLVCRKANAIKVKAER-DLRIEHMVIKFR--NGETKRINFYRDLKKGQETKWRPFAY----QRCVKNIEVYGNSEGT--RAGLKVYGNQ 128
35 2.000e-33gi|752535309|ref|WP_041206827.1| hypothetical protein [Aeromonas media]  clstr ali  22  36DDEFRLGNTILLGVGDHPAIIPIIICRPARSIMVKAGR-ELTLDRVKVIY--GNDRSKTLHFDKSLKEDQESGWKSLGS----RVCIKRVEVYGNSEGS--KAGVKVYGR. 136
38 2.000e-33gi|938891177|ref|WP_054675779.1| hypothetical protein [Photobacterium sp. JCM 19050]  clstr ali  28  27.DDFTLGRTILLGKSDHAAKIPLVVCRRTDAIQVKAEKG-LFLQKVKVNFR--NGESKTIQFQRWLKEDKKTDWRKFSY----KRCVKSLEVYGKAKDRESTAGVRVYGRD 129
39 3.000e-33gi|496854282|ref|WP_009386148.1| hypothetical protein [Vibrio sp. N418]  clstr ali  26  24DDKFTLGRTILLEHGKSAAKIPMVICRRTNAIQIKAER-DLKLRKAVVKFQ--NGESKTINFYRDFKEDEKSDWRYFGY----RRCVKSIDVYGNSERSTG--GVRVYGKE 125
40 8.000e-33gi|654554053|ref|WP_028021450.1| hypothetical protein [Enterovibrio calviensis]  clstr ali  33  26EERITLGRTILLENGKHGADIPLLVCRRVNAIKVKADR-DAYLKQVKVTFK--NGETKTISFYRNIKEDDTTDWRKFGY----KRCVKKLEVFGESKNSS--AGIRVYGRQ 127
41 9.000e-33gi|515529193|ref|WP_016962408.1| hypothetical protein [Enterovibrio norvegicus]  clstr ali  30  26DDRITLGRTIVFKNTDYGADIPLVICRRVNAIQVKADR-DMYLQKVKITFK--NGDTKTIRFYRDVGKDKTTDWRKLAY----KRCVKKLEVFGKSENSS--AGVRVYGRQ 127
42 2.000e-32gi|746425765|ref|WP_039466260.1| hypothetical protein [Photobacterium gaetbulicola]  clstr ali  24  24DDKITLGRTILLGKSDHGAQIPLLVCRRVDAIRVKAER-DMRLERVVVTFN--NDDTKTIHFHRKLDKHDQTDWRKFAYT----RCVKSLEVFGKAEGSS--AGVRVYGRQ 125
43 5.000e-32gi|503110316|ref|WP_013345058.1| hypothetical protein [Ferrimonas balearica]  clstr ali  28  26DDDFTLGRTILLEHGNRGADIPLLVCRNTNAIKLKAKRR-LHLKRIKVTFQ--NGDTRTFNYYRDMKKGEQTQWRKFAYS----RCVTHIEVFGNSDGSS--AGVTVLG.. 125
44 1.000e-31gi|491447285|ref|WP_005305072.1| hypothetical protein [Photobacterium damselae]  clstr ali  19  26DDQFTLGRTILLEHGNLAAKIPVPACRYTNAIKVKAER-DVRLRKVVVHFQ--NGEKQTIKFYRDLDKNEKTAWRYFGF----RRCVTSLDVYGNSERTTG--GIRVYGR. 126
45 1.000e-30gi|837860742|ref|WP_047879548.1| hypothetical protein [Photobacterium aquae]  clstr ali  26  26DDTITLGRTILLGKSDHGAEIPVIGCRRVDAIKVKAER-DLFLERVKVTFQ--NKETRTFKFYRKVGEDKKTDWRKFAY----KRCVTHIEVFGKAKGSS--AGVRVYGRQ 127
46 1.000e-30gi|499383251|ref|WP_011070822.1| hypothetical protein [Shewanella oneidensis]  clstr ali  22  37EDEITLGRTILLGIGDHPATIPLVICRQAKYIKIKAER-DVSIDRVVVTY--GDDKTRTIKFDTDIEKDEHSEWKSLGA----RRCVKKIEVYGNSDRS--KAGIKVLGR. 137
47 2.000e-29gi|555479413|ref|WP_023268896.1| hypothetical protein [Shewanella decolorationis]  clstr ali  21  37DNEITLGRTLLLGIGDHPAIIPLIICRQAKHIRIKAER-DVSIDRVVVTY--GDDKTRTVRFDTELGKDEHSEWKSLGA----RRCVKKIEVYGNSDRS--KAGIKVLGR. 137
48 9.000e-29JGI.Meta 7049375316 C503763__gene_25280 UPF0412 protein yaaI [Human Stool microbiome from visit number 1 of subject 158883629]  ali  97  53NDHKILGVIAMPRNETNDLALKLPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN.............................. 133
49 1.000e-28gi|654657077|ref|WP_028118022.1| hypothetical protein [Ferrimonas senticii]  clstr ali  23  24.DDFTLGRTVLLEHGNLAAQIPVIGCRKTDAIKLKTKR-DIRLERIRVTFE--NGDKRVFHFNKQFRKGQQTGWKKFAF----RRCVTHIDVFGNSRNTT--AGVTVYGRD 124
50 4.000e-28gi|837771725|ref|WP_047876022.1| hypothetical protein [Photobacterium aphoticum]  clstr ali  27  28..KITLGRTIVFESHSKDAVIPLMVCRRVDAIRVKADR-DMRLERVVATFR--NGETKTIRFHRNLDKNEYTDWRKFAYT----RCVKKLEVFGKSKGSS--AGVRIYGRQ 127
51 2.000e-27gi|491506900|ref|WP_005364537.1| hypothetical protein [Photobacterium angustum]  clstr ali  27  25.DTFTLGRTILLEAKNSHAKIPVPLCRNTKSIQIKAER-DVFLTKVV--FKFQNGSSRVFQFQRKLDKNEKTDWRRFSYE----RCVTDIQVHGRAEDGS--AGIKVLGR. 124
52 3.000e-25gi|499946614|ref|WP_011627348.1| hypothetical protein [Shewanella sp. MR-7]  clstr ali  22  36DDEITLGRTLLLGIGDHPATIPLIICRQAKYIKIKAERDVSVDRVVVTY---GDDKTRTVRFDTDIEKDKHSEWKSLGA----RRCVKKIEVYGNSGRS--KAGIKVIGK. 136
53 5.000e-25gi|738903801|ref|WP_036790740.1| MULTISPECIES: hypothetical protein [Photobacterium]  clstr ali  25  26...FTLGHTWLLEIGNVKGKIPFPICRNAKGFKIEAQR-DLKLDRVKVRFR--NGEEKTYNYYRDVKKDKDTGARLFGYE----RCIKHIEVSGNSEGT--RAGVKVIGID 124
54 2.000e-24gi|754623862|ref|WP_042011771.1| hypothetical protein [Aeromonas fluvialis]  clstr ali  22  14DDQFTLGRTIVLGLGEKGSSITKVICLPTQSIKVKAER-DLTLDKLVITYSGE--KTKTVSFNRKLKEDQETEWKSIGG----RLCVKKIQVYGYADG--LLAKVKVFGR. 114
55 5.000e-19gi|518331242|ref|WP_019501449.1| hypothetical protein [Pseudanabaena sp. PCC 6802]  clstr ali  24  35.....LGQARLSFRENDLDVLKLPRCQPVRDIRLRALRGSAEIQLLVVQY--GNNQLDRLPVRSRLRQGSETNWIPLRGTL---RCIRGIAIVGSSAGTTNRAIIQFYAR. 136
56 4.000e-17gi|522028288|ref|WP_020539497.1| hypothetical protein [Lewinella cohaerens]  clstr ali  20  42.....LGQRRVNYGLDRDEILVTAREGRFTSIRLKAEIAPINVHRCVVHF--ANGTTESFQFSGDLRAGQVTRNLDLPG---NRRVITKVVFWYDTKNRANRRGVELWGK. 143
57 1.000e-14gi|501725722|ref|WP_012626169.1| hypothetical protein [Cyanothece sp. PCC 7425]  clstr ali  26  161.....LGETPLAFAENDREVLNLGNCDRQPRVKVRAVRGSADIKQLNLRF--GDGTTQQLYVRENLNQGSETRWIDLQG---NKRCITRITVVGDTDDRSNRALLQVFGR. 264
58 2.000e-14gi|916728888|ref|WP_051335944.1| hypothetical protein [Aquimarina latercula]  clstr ali  21  34.....LGSRTVNYKIDRDVIKVTAKDGAFKKLKVKVTNGSINMHRIVVQY--GNGEKQVIQVKKNFKKGGATRIIDLKG---NKRIIRDITFFYDTKNSKNRAKVHVFGK. 134
59 9.000e-13gi|730641933|ref|WP_034061547.1| hypothetical protein [Lacinutrix jangbogonensis]  clstr ali  18  36...KKIGEVKANYGGDHDALFVQGPFDDFRKIKLKVSSADVNMQRMVITYD--NGGKDEIPLKFVIRKGETSRVIDLKG---GKRSLRKIEFWFDTKGRSGKARVIVLGR. 138
60 1.000e-12gi|736105526|ref|WP_034238134.1| hypothetical protein [Aquimarina atlantica]  clstr ali  17  35.....LGSRTVNYRLDKDVIKVTARKGGFKKLKVKVTGGSLNMHKMVIQY--GNGKKDVIQLKHNFSRKSETRIIDLKG---GKRIIRDITFFYDTKNSRKKAKVHVFGK. 135
61 1.000e-12gi|522071253|ref|WP_020582462.1| hypothetical protein [Endozoicomonas elysicola]  clstr ali  18  20DDWKKLGERRVSFQSEQDVIHVSGFKGKYDTIAFKVDRAPIFMKKIKVVF--GNGKSQTIHINKRLHKGK----RSLPYRLDGDRIINKIEMYKTAIGGHKYAEVKVYGK. 125
62 3.000e-12gi|736840725|ref|WP_034841849.1| hypothetical protein [Endozoicomonas numazuensis]  clstr ali  20  31.....LGERKVSRRAEVDTIRVGLRDGVFKRIQFKVKGADVDFNKVVVHYK--NGQNREVAIRSKVRKGGSSRVIDLPGKA---RAIEKVRFYYDTEGTGRQASVLLWGK. 131
63 4.000e-12gi|748172942|ref|WP_039746500.1| hypothetical protein [Hassallia byssoidea]  clstr ali  25  59..............................ALKIKVINGTLNIHKATVHF--ANGDKQDVELPEVLGKDNDGELIDLAG---NKRIVEKVTFWYDTENKNNKAMVEVWAR. 134
64 1.000e-11gi|503534164|ref|WP_013768240.1| hypothetical protein [Haliscomenobacter hydrossis]  clstr ali  18  31.....LGKRAVNYGLDRDVIPVTWRDGAFDGLKFEVKGGALNMRKCIVHFE--NGGKQEIELRHNFGKGSDSRIVDLRG---NNRLVEKVEFWYDTNNRANKAVIFVYGR. 131
66 6.000e-11gi|495887301|ref|WP_008611880.1| hypothetical protein [Joostella marina]  clstr ali  18  36.....IGEVKANYGNDHDAINVDGSFNDFRTLKFNVGNADVNMDRMEITYDS--GAKERVPLRLEIRKGDDSRNINLPG---GKRRVHKIEFWYNTKGFSGKARITVYGK. 136
68 1.000e-10gi|522071735|ref|WP_020582944.1| hypothetical protein [Endozoicomonas elysicola]  clstr ali  16  31.....LGEKQVSRRTEADTIFVGAREGLFRKIQFKVRGADVDFKRAIIHYR--NGQTREIAMKGLVRKNNSTRQIDLPGKT---RAIEKVSFWYQTQGKGRQATVLLWGKE 132
69 4.000e-10gi|502982125|ref|WP_013217101.1| hypothetical protein [Hyphomicrobium denitrificans]  clstr ali  22  223..........................GKFAKIRLRVLDNDIHISEMKVVYN--NGESDALAVNADIPKNSRTNWIDLRGD----RFIKEIQVYRSRPNFNGQARIEIFGR. 301
70 5.000e-10gi|748177904|ref|WP_039751449.1| hypothetical protein [Hassallia byssoidea]  clstr ali  18  37.....LGTHVVDYTLDYDVIPVTYKKGTFTSLKLRVTDGNINMHRCMITYE--NGDKQEIEIKHQFTANSE-KVVDLKG---NNRIIEKVTFWYDTKNSSRKAAVEVWGK. 136
71 6.000e-10gi|797120397|ref|WP_045834866.1| hypothetical protein [Hyphomicrobium sp. 99]  clstr ali  22  215..........................GKFAKIRLRVLDNDIHINELKVVY--ANGESDSLAVNADIPKNSRTNWIDLRGD----RFIKEIQLVYRSRPSNGQARIEVFGQ. 293
72 2.000e-09gi|430892205|gb|ELC14697.1| UPF0412 protein yaaI [Escherichia sp. KTE11]  clstr ali  77  24NDHKILDVIAMTRNETNDPALQCPVCRVVKHIQLTADHGDLQLS................................................................... 67
73 3.000e-08gi|920574560|ref|WP_053004322.1| hypothetical protein [Flavobacterium sp. ABG]  clstr ali  18  40....VIGSRSVTHNADHD-KLDVTHRDSFRKLKLKVTDSPLNMQKMVVDYES--GAPENIELRQNIAKGGESRVIDLRG---GKRKIKAIHFWYDTKGFNGKAEVTVFG.. 139
74 4.000e-08gi|917167777|ref|WP_051774489.1| hypothetical protein [Formosa agariphila]  clstr ali  15  73.............................RKIKFKVRDAPVNIQRMVVTYD--NGAPEKIDTRFDIPKNGESRVIDLRG---GKRKLRSIEFWYDTKGLNGTADVTVYG.. 148
75 1.000e-07gi|951410162|ref|WP_057784074.1| hypothetical protein [Formosa algae]  clstr ali  18  45.....LGTTHAKHTGDHDKINVPGPFDSYRKIKFKVKDAPVNMHRLVVNYEA--GASQKVETRFTIPKNGESRVIDLVG---GKRKLRSIEFWYDTKGLNGTADVTLYG.. 144
76 2.000e-07gi|212554969|gb|ACJ27423.1| hypothetical protein swp_0600 [Shewanella piezotolerans WP3]  clstr ali  15  43.....LGQRSVKHGVDKDVMHVNIAEGGFRELKVTVKKSSVNIKKIIVEY--ANGKRDELKLRSVISAGSESRLMDLRG---GKRVIRNVTFYYETERGRGKAIVTAWGR. 143
77 3.000e-07gi|498332568|ref|WP_010646724.1| hypothetical protein [Vibrio campbellii]  clstr ali  29  14............................................................RIKVKVEKDNITDWRNFGY----RRCVKNIEVYGNSEGS--KAGVRVYGK. 57
78 4.000e-07gi|909986109|ref|WP_049961454.1| hypothetical protein [Acidobacterium sp. PMMR2]  clstr ali  14  42...IFLGMAHVDGLTDHDDIKVGPYAGRYHSIVLRVRYAPIQFEQVVIHY--GNGTSQALPVKALIRAGGQSRPVMLPG---GERVIESLELWYSRANPNNKPEVRLFG.. 144
79 9.000e-07gi|1000258341|gb|KXK21132.1| hypothetical protein UZ08_BCD001000283 [Bacteroidetes bacterium OLB8]  clstr ali  21  53..............................ALKLKVVDAGLNMIDMDVYFE--NGQKEHVPLQKNFHAGEESRVIDLPG---NARRIDKITFLYDTKGRKGKANIIVFGR. 128
80 1.000e-06gi|929016745|ref|WP_054040676.1| hypothetical protein [bacterium 336/3]  clstr ali  16  29....RVGVRKVSYGVEKDVVMVTSKKGKFTKLQLKVKDAPVNFRDMKVYF--GNGSVQDVSLRNTIPAGGESRVIDLDG---GERTIIKIEFIYDTKNNAKKRGVVVLAKE 131
81 1.000e-06gi|655506568|ref|WP_028887677.1| hypothetical protein [Tenacibaculum ovolyticum]  clstr ali  21  158...KLLGITTVKRSVDRDEVRVTASKGMFTHLKIKVRNSSLEMKKMIVHF--GDGSKQDVWLKNRFSKGQESRAIDLKG---NKRIVKKVIFWYK................ 244
82 2.000e-06gi|931551485|gb|KPL26191.1| hypothetical protein AMS23_02735 [Bacteroides sp. SM1_62]  clstr ali  12  25.....LGVKKINKSYDRDVISVTATEGTFNALKFKVKYHPVTIYDMKIHY--GNGMVEDIKIRYHVQAGGESRIIDLRGR---DRVIKKVVFHYETKTTGRRAEIRLFG.. 124
83 2.000e-06JGI.Meta 7038489895 SRS016585_Baylor_scaffold_339__gene_318 UPF0412 protein yaaI [Human Stool microbiome from visit number 1 of subject 1599  ali  100  24NDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLS............................................................................ 58
84 3.000e-06gi|910256068|ref|WP_050060569.1| hypothetical protein [Silvibacterium bohemicum]  clstr ali  14  44...FILGTAHVDGPTDHDDIRVDRYAGRFHFVLLKVRYAPIQFDHVLIHY--GDGDSEPLPVNQYIGPGGTSRWIALPG---GERHIRSLELWYARADQRDRNRVELYGAQ 148
85 4.000e-05gi|983026776|gb|KWT70951.1| hypothetical protein APY04_0613 [Hyphomicrobium sulfonivorans]  clstr ali  19  75NGEVLFGVQDVGFLVDRDVIRVGAEIGKFDRIRLRVLRNEIFITDLKVIFD--DGTTETVLSDTRIRDGRKTDWIALA----HKGFIKEIQLVYRSQPKKGQARVEIFG.. 178
86 9.000e-05gi|835200520|ref|WP_047393104.1| hypothetical protein [Chitinibacter sp. ZOR0017]  clstr ali  16  53..........................GPYNKLRLSVHKRAVQFSRVFVEFR--NGDRIEVPVRERIHAGGQSRVIDLPGRG---RYIKKVILWYKTPGTLERAQVAVWAR. 132
87 9.000e-05gi|493933878|ref|WP_006878312.1| hypothetical protein [Vibrio brasiliensis]  clstr ali  17  54..........................RNFSKIKIKVVQGTVNLKNIVVT--MSDGSSKELKSMGTLTKGMSTRAWTLPGNENAK--FKKLDMTYDSWGSSKKAKIEVWGK. 141
88 3.000e-04gi|518928362|ref|WP_020084237.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  22  213..........................GRFERLALRVSDNDIFLRELTVVY--GNGERDRKVIETAIPAGSQTRPIDLRGD----RFIREIEVYRAAPNRRGPAVVEIYGD. 291
89 4.000e-04gi|919188228|ref|WP_052743729.1| hypothetical protein [Candidatus Filomicrobium marinum]  clstr ali  20  184..........VTFHGDHDKIKVAKEMGKFGRVRIQVRDEDVYLNSFKIVY--ADGTENTHKIDLHIPEGRTTDWVDI----DGARFIDHLELSYRKKGFEGHARIEVMG.. 277
90 5.000e-04gi|902773700|ref|WP_049644797.1| hypothetical protein [Candidatus Rhodobacter lobularis]  clstr ali  18  24.....LGQMTL-YPGTDIAFLKAPDRERSRDLRLCATRGHVHVLWLDVFLR--NGGHRTVPVNLRLPRDHCTSWIKLRGRALG-RDVHRISVHYDS............... 110
91 6.000e-04gi|739215044|ref|WP_037078430.1| hypothetical protein [Rhizobium vignae]  clstr ali  14  29.....LGRRKVRWAADHDVIHVGAQEARFDHILIKVEGNGIYIFDLDVRY--SNGAPDHIPMGLHIPQGGQSRVINLRG---GDRNIRNVSFTYRRPGFDGPATVELWGQQ 130
92 6.000e-04gi|915920753|ref|WP_050929514.1| hypothetical protein [Aestuariivita boseongensis]  clstr ali  17  42...ILLGESRVNLIKNFSIVPVTLAKGLFTGLVVEAVDKPIFIESIEVTFT--NGETSELRVRSIIAAGSRTRKMLLPGLVRGIRTVKII---YKRIPTGGSATVRIYGR. 143
93 1.000e-03gi|522154136|ref|WP_020665344.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  20  191..........................GKFTRIRLRVIGNDVHVNALRVVF--VDGQEQNLAVDADLKANTRSKW----FEIDGSRFIREIQLTYRSPNFRGQARIEVTG.. 268
94 1.000e-03gi|640548219|ref|WP_024980336.1| hypothetical protein [Flavobacterium succinicans]  clstr ali  21  69..............................ALKVMVRKNTVNFNKMTIYFE--NGQKQDVELRNNIKDGGESRVINLSF----KRRIDKIRFEYRTRNLGSRAEVDVWAR. 143

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 0 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.