current user: public

anford Burnham Prebys Medical Discovery Institute

Query: gi|16128007|ref|NP_414554.1|(removed signal:1-23) conserved protein, UPF0412 family (yaaI b0013 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
1 -6.040d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  5..............................KVSVTLSGAKKLSGYILVALYGNNGNSKQYEIFKGSLKPEARHVRDIDVDIN----IQKVKFLWNNK.............. 70
2 -5.950d1vdza2 b.84.5.1 (A:114-190) A1 ATP synthase A subunit, bulge domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  12  22....IIGEVPETSIIVHKIMVPPGIEGEIVEI---AEEGDYTIEEVIAKVKTPSGEIKELKM................................................. 76
3 -5.940d3qpaa_ c.69.1.30 (A:) automated matches {Nectria haematococca [TaxId: 660122]}  ali model 3D-neighbors follow..  41............................ASNLESAFGKDGVWIQGVGGAYRATAAIREMLGLFQQANTKCPDATLIAGGYXQGAALAAASIEDLDSAIRDKIAGTVLFGY. 134
4 -5.880d2npta1 d.15.2.2 (A:5-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9ENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA............... 104
5 -5.820d1ueya1 b.1.2.1 (A:8-121) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  24.............................KSVQLSGDDNNSPITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLT.... 104
6 -5.780d2rnrb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  13.............................KKVRQKKQDGALYLMAERIAWAPEGKDRFTISHM-----------------------YADIKCQKISPEGKAKIQLQLVLHA 71
7 -5.760d2cuma1 b.1.2.1 (A:8-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15.............................RTALLTWTEPPVRPAGYLLSFHTPGGQTQEILL------PGGITSHQLLGLFPSTSY--NARLQAMWGQSLLPP........ 80
8 -5.700d4pdxa2 d.106.1.0 (A:543-661) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  11  1.................DTIRGMSVEMLFDFMAVRLDSAKAAGKNISLNFNMSNGDNLNLTLNDSVYRKTLQPQADASFYISREDLHAVLTGQAKMADLVKAKKAKIIGNG 96
9 -5.540d1w0pa1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  14  94.......RVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLSKQNMIVWGNGSSNTDGVAAYRDIKF................... 187
10 -5.300d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15.............................GFAVLHWKPPQNPVDTYDIQVTAPGAPPLQAET------PGSAVDYPLHDLVLHTNY--TATVRGLRGPNLTSP........ 80

FFAS is supported by the NIH grant R01-GM087218-01
8 9 8 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.