| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . |
| # |
Score |
Template |
Links and tools | %id | First |
AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR | Last |
| 1 | -7.120 | d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
16 | 29 | DEVSLLEGEAVEVIHKLLDG-WWVIRKDDVTGYFPSMY..................................... |
65 |
| 2 | -6.800 | d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
20 | 320 | .....LQAVLTHQGRSSSSGHYVSWVKRKQDEWIK........................................ |
349 |
| 3 | -6.760 | d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Leishmania mexicana [TaxId: 5665]} |
ali model 3D-neighbors follow.. |
12 | 12 | KWVDTHVGTEIHLKGNPTTGYMWT................................................... |
37 |
| 4 | -6.690 | d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second `additional` domain {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
38 | 23 | ...QLWPHTKMAIGPVIDNGFYYD................................................... |
43 |
| 5 | -6.530 | d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
13 | 26 | ..VTTIPTIGFNVETVEYKNTVWDGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREE............. |
89 |
| 6 | -6.450 | d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
22 | 30 | ...DMIPTVGFNMRKITKGNKLWDGGQPRFRSMWERYCR.................................... |
69 |
| 7 | -6.410 | d2nqda1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]} |
ali model 3D-neighbors follow.. |
25 | 10 | ATLTVAVGVEIQLPSNPTTGFAWY................................................... |
35 |
| 8 | -6.250 | d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
15 | 15 | NTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNY..................................... |
52 |
| 9 | -6.120 | d1iyca_ g.31.1.2 (A:) Antifungal peptide scarabaecin {Beetle (Oryctes rhinoceros) [TaxId: 72550]} |
ali model 3D-neighbors follow.. |
30 | 1 | .ELPKLPDDKVLIRSRSNKGKVWNGFDCKSP............................................ |
32 |
| 10 | -5.940 | d2fhza1 d.311.1.1 (A:27-109) Colicin E5 immunity protein ImmE5 {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
29 | 1 | ..MKLSPKAAIEVCNEAAKKGLWDGGHWLNPGF.......................................... |
35 |