|
|
current user: public |
|
| Query: gi|16127999|ref|NP_414546.1|(removed signal:1-23) predicted protein (yaaX b0005 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli |
| . 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
| # | Score | Template | Links and tools | %id | First | AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR | Last |
| 1 | -7.120 | d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | ali model 3D-neighbors follow.. | 16 | 29 | DEVSLLEGEAVEVIHKLLDG-WWVIRKDDVTGYFPSMY..................................... | 65 |
| 2 | -6.800 | d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} | ali model 3D-neighbors follow.. | 20 | 320 | .....LQAVLTHQGRSSSSGHYVSWVKRKQDEWIK........................................ | 349 |
| 3 | -6.760 | d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Leishmania mexicana [TaxId: 5665]} | ali model 3D-neighbors follow.. | 12 | 12 | KWVDTHVGTEIHLKGNPTTGYMWT................................................... | 37 |
| 4 | -6.690 | d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second `additional` domain {Escherichia coli [TaxId: 562]} | ali model 3D-neighbors follow.. | 38 | 23 | ...QLWPHTKMAIGPVIDNGFYYD................................................... | 43 |
| 5 | -6.530 | d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | ali model 3D-neighbors follow.. | 13 | 26 | ..VTTIPTIGFNVETVEYKNTVWDGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREE............. | 89 |
| 6 | -6.450 | d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | ali model 3D-neighbors follow.. | 22 | 30 | ...DMIPTVGFNMRKITKGNKLWDGGQPRFRSMWERYCR.................................... | 69 |
| 7 | -6.410 | d2nqda1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]} | ali model 3D-neighbors follow.. | 25 | 10 | ATLTVAVGVEIQLPSNPTTGFAWY................................................... | 35 |
| 8 | -6.250 | d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | ali model 3D-neighbors follow.. | 15 | 15 | NTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNY..................................... | 52 |
| 9 | -6.120 | d1iyca_ g.31.1.2 (A:) Antifungal peptide scarabaecin {Beetle (Oryctes rhinoceros) [TaxId: 72550]} | ali model 3D-neighbors follow.. | 30 | 1 | .ELPKLPDDKVLIRSRSNKGKVWNGFDCKSP............................................ | 32 |
| 10 | -5.940 | d2fhza1 d.311.1.1 (A:27-109) Colicin E5 immunity protein ImmE5 {Escherichia coli [TaxId: 562]} | ali model 3D-neighbors follow.. | 29 | 1 | ..MKLSPKAAIEVCNEAAKKGLWDGGHWLNPGF.......................................... | 35 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
 |
 |
 |
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013. Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83. |