| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . |
# |
Score |
Template |
Links and tools | %id | First |
AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR | Last |
1 | -7.180 | d4j9fa_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
15 | 20 | NTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNY..................................... |
57 |
2 | -7.160 | d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Trypanosome (Leishmania mexicana) [TaxId: 5665]} |
ali model 3D-neighbors follow.. |
12 | 12 | KWVDTHVGTEIHLKGNPTTGYMWT................................................... |
37 |
3 | -6.860 | d2nqda_ b.1.26.1 (A:) Chagasin {Trypanosoma cruzi [TaxId: 5693]} |
ali model 3D-neighbors follow.. |
25 | 11 | ATLTVAVGVEIQLPSNPTTGFAWY................................................... |
36 |
4 | -6.640 | d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
16 | 30 | .EVSLLEGEAVEVIHKLLDG-WWVIRKDDVTGYFPSMY..................................... |
65 |
5 | -6.620 | d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second `additional` domain {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
38 | 23 | ...QLWPHTKMAIGPVIDNGFYYD................................................... |
43 |
6 | -6.570 | d1zd9a1 c.37.1.8 (A:17-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
21 | 29 | .NEDMIPTVGFNMRKITKGNKLWDGGQPRFRSMWERYCR.................................... |
70 |
7 | -6.410 | d1iyca_ g.31.1.2 (A:) Antifungal peptide scarabaecin {Beetle (Oryctes rhinoceros) [TaxId: 72550]} |
ali model 3D-neighbors follow.. |
30 | 1 | .ELPKLPDDKVLIRSRSNKGKVWNGFDCKSP............................................ |
32 |
8 | -6.100 | d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
20 | 320 | .....LQAVLTHQGRSSSSGHYVSWVKRKQDEWIK........................................ |
349 |
9 | -5.900 | d1ee6a_ b.80.1.1 (A:) Pectate lyase {Bacillus sp., strain ksmp15 [TaxId: 1409]} |
ali model 3D-neighbors follow.. |
19 | 42 | PIFRLEAGASLKIGAPAADGVHCYGDCTITNVIWED....................................... |
80 |
10 | -5.880 | d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
17 | 26 | ..VTTIPTIGFNVETVEYKNTVWDGGQDKIRPLWRHYFQNTQG................................ |
70 |