FFAS03 results for 16127999

Query: gi|16127999|ref|NP_414546.1|(removed signal:1-23) predicted protein (yaaX b0005 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40 . 50 . 60 . 70 .`
#	Score	Template	Links and tools	%id	First	`AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR`	Last
1	-7.030	`d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	16	30	`.EVSLLEGEAVEVIHKLLDG-WWVIRKDDVTGYFPSMY.....................................`	65
2	-6.790	`d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Leishmania mexicana [TaxId: 5665]}`	`ali model 3D-neighbors follow..`	12	12	`KWVDTHVGTEIHLKGNPTTGYMWT...................................................`	37
3	-6.710	d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second `additional` domain {Escherichia coli [TaxId: 562]}	`ali model 3D-neighbors follow..`	38	23	`...QLWPHTKMAIGPVIDNGFYYD...................................................`	43
4	-6.710	`d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	21	29	`..EDMIPTVGFNMRKITKGNKLWDGGQPRFRSMWERYCR....................................`	69
5	-6.600	`d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	20	320	`.....LQAVLTHQGRSSSSGHYVSWVKRKQDEWIK........................................`	349
6	-6.450	`d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	17	26	`..VTTIPTIGFNVETVEYKNTVWDGGQDKIRPLWRHYFQNTQG................................`	70
7	-6.440	`d2nqda1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}`	`ali model 3D-neighbors follow..`	25	10	`ATLTVAVGVEIQLPSNPTTGFAWY...................................................`	35
8	-6.310	`d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}`	`ali model 3D-neighbors follow..`	15	15	`NTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNY.....................................`	52
9	-6.210	`d1iyca_ g.31.1.2 (A:) Antifungal peptide scarabaecin {Beetle (Oryctes rhinoceros) [TaxId: 72550]}`	`ali model 3D-neighbors follow..`	30	1	`.ELPKLPDDKVLIRSRSNKGKVWNGFDCKSP............................................`	32
10	-6.070	`d2fhza1 d.311.1.1 (A:27-109) Colicin E5 immunity protein ImmE5 {Escherichia coli [TaxId: 562]}`	`ali model 3D-neighbors follow..`	20	1	`..MKLSPKAAIEVCNEAAKKGLWDGGHWLNPGFWTYDMPEEYKSKIPENN.........................`	59

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster