current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

16127998
Query: gi|16127998|ref|NP_414545.1| threonine synthase (thrC b0004 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAALRKLMMNHQLast
1 -131.000d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  100  1MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAALRKLMMNHQ 428
2 -108.000d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  33  5QVYRSTRSSSPKISFEEAIIQGLATDGGLFIPPTIPQVDQATLNDWSKLSFQDLAFAIMRLYIAEEIPDADLKDLIKRSYSEVTPLVQNKENLHILELFHGPTYAFKDVALQFVGNLFEYFLQRKQITVVGATSGDTGSAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWARILAQMTYYFYSFFQATNKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAIATNENDILDRFLKSGLYERDKVAATLSPAMDILISSNFERLLWYLAREYLA-KDFTSERVSNEETSETIKKIYEKHYILDPHTAVGVCATERLIDKSIQYISLSTAHPAKFADAVNNALSEKDVLPEELKKLSTLKKKLKFIERDVELVKNAIEEE. 507
3 -53.400d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  19  32AKYVPFAAPGSTESYSLDEIVYRSRSGGLLLKRFDGAYWRDLFDSRVGKSTWPYGSGVWSEWVLPEIDDDDIVSAFEGNSERFGKQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRVGVGCASTGDTSAALS-AYCASAGIPSIVFLPANKISMAQLVQPIANGAFV--LSIDTDFDGCMKLIREITAE------LPIYLANSLNSLRLEGQKTAAIEILQQFDWQVPD--WVIVPGGNLGNIYAFYKGFKMCIPRMVCAQAANANPLYLHYKSGWKFKPMTASTTFASAIQIGDPVSIDRAVYALKK-----CNGIVEEATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNPTDRTVVVSTAHGLKFTQSKIDYHS--NAIPDMACRFSNPP---VDVKADFGAVMDVLKSY. 469
4 -20.000d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  21  29...................................................................................TPLIPLKGRLYAKYEGLNPTGSFKDRGMTL---AVSKAVEGGAQAVACASTGNTAASAA-AYAARAGILAIVVLPAGYVALGKVAQSLVHGARI--VQVEGNFDDALRLTQ------KLTEAFPVALVNSVNPHRLEGQKTLAFEVVDELGDAPH---YHALPVGNAGNITAHWMGYKAYHALGKAFQAAGAAPLVLGR-------PVERPETLATAIRIGNPASWQGAVRAKEESGGVIE-----AVTDEEILFAYRYLREEGIFCEPASAAAMAGVFKLLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAA....................... 346
5 -9.270d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  33.....................................................................................................PSGSFK---IRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQL-GVPATIVVPGT-TPALTIERLKNEGATC--KVVGELLDEAFELAKALAKNNPFDDPLIWEGHASI---------------VKELKETLWEKPGAIALSVGGGGLLCGVVQQECGWGDVPVIMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVG--SQALKLFQEHPIFSEVIS----DQEAVAAIEKFVDDEKILVEPACGAALAAVYSHV............................................................... 278
6 -7.370d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  45...................................................................................TPMVRINK-LAKCEFFN-AGGSVKDISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLA--AAAVRGYRCIIVMPE-KMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVA-------WRLKNEIPNSHQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITG-IARKL--PGCRIIGVDPEGSILAEPEELNQTEQTTYEVEIPTVLDRTVVDKWFKS------------------NDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDR................................... 347
7 -7.300d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  20  45.....................................................................................................KTGSFK-----ARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVL-GVKALVVMPED-ASPYKKACARAYGAEV--VDRGVTAKNREEVAR------ALQEETGYALIHPFDDPLVIAQGTAGLELLAQAGRMGVFPGAVLAPVGG-GGLLAGLAVKALSPTTLVLGVEPEAADDAKRSLEAGRLRLEAPPRTRADGVRTLSLG--ERTFPILRERVDGI-----LTVSEEALLEAERLFTRTKQVVEPTGALPLAAVLEHGARLPQTLALLLS................................................... 302
8 -7.040d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  17  47.....................................................................................................KMGAFKFRGA--LNALSQLNEAQRKAGVLTFSSGNHAQAIALSAKIL-GIPAKIIMPLD-APEAKVAATKGYGGQV--IMYDRYKDDREKMAK------EISEREGLTIIPPYDHPHVLA------TAAKELFEEVGPLDALFVCLGG-GGLLSGSAARHFAPNCEVYGVEPEAGNDGQQSFRKGSIVHIDTPKTIADGAQTQHLG--NYTFSIIKEKVDDI-----LTVSDEELIDCLKYAARMKIVVEPTGCLSFAAARAMKEK............................................................. 292
9 -6.780d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}  ali model 3D-neighbors follow..  12  2.............................................................................................................................KVSVVGA-AGTVGAAAGYNIALRDIADEVVFVTVGQAADTNHGIAYDSNTRVRQ----GGYEDTAGVITAGIPRQPGQTRIDLAGDNAPIMEDIQSSLDEH------------NDDYISLTTSNPVDLLNRHLYEAGDRSREQVI.............................................................................................................................................................. 141
10 -6.470d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  8.................................................EGAEYLRAVLRAPVYEAAQVTPLQKMEKLS-------SRLDNVILVKREDRQPVHSFKLRGA--YAMMAGLTEEQKAHGVITASAGNHAQGVAFSSARL-GVKALIVMPTA-TADIKVDAVRGFGGEV--LLHGANFDEAKAKAI------ELSQQQGFTWVPPFDHPMVIA------TLALELLQQDAHLDRVFVPVGG-GGLAAGVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAEGVAVKRIG--DETFRLCQEYLDDIITVD----SDAICAAMKDLFEDVRAVAEPSGALALAGMKKYIALH............................................................ 299

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]