current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16128007|ref|NP_414554.1|(removed signal:1-23) conserved protein, UPF0412 family (yaaI b0013 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
1 -6.880PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  152.RNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAEL-ICTYTYEVRNVKNMEYMTQACGSL-SSMAPSMLFANEELDRECVTVPFETELHLESSKMTGKFYTFG.. 257
3 -4.200PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  10  3..................................................KELHNTKVTVRLRKSAYRNEWYLYIESAGKSEPQRVREYLNRIVTTVVWDKTRTAR..... 63
4 -3.420PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  117......................................GGITVQGSASNVQVKQENNGNVYLSMSVQGIFISATVNLVLYSGTNNAMVTVD------PNFSGNNLTMNGT. 182
5 -3.310PB007486 gi|154484254|ref|ZP_02026702.1| hypothetical protein EUBVEN_01966 [Eubacterium ventriosum ATCC 27560]gi|149734731|gb|EDM50648.1| hypothetical protein EUBVEN_01966 [Eubacterium ventriosum ATCC 27560]  ali follow..  188TDTFRVSEQIEVPHGKPPIGTIVWSDIRIKNQNIKTMEGSIIINSVFIIYIPEMENMPEQWLEQTID----NGQLEMSEATEDVVSLNNVNVQPEINQDNEMRNLSV.... 299
6 -2.910PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete)  ali follow..  72..............GRSASLKITIDENLFPLLSIKSNNGRLAITQYVIEGSSKTLKYLKTSGPMDFEAQNAFSEDQLEIKISGSSDVK------PHNVKLRLGEFSVSG.. 171
7 -2.840HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;  ali follow..  95.KRFSLTLAMNNPFMDNYRIGCENWNRRAGNTSYQYVNETSRMLLVKVTYGMDFGRKRKTAAKRIQNEDTDTGILKGN................................. 171
8 -2.710PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali follow..  13  46............................LSEINIYGLEKEVPLQEVLTMIHTKEEGKQCSVKPKSPADELEAYFFDVFQDYDEERVIKKIIQWYN................ 116
9 -2.700PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  109.............................RNTEIKGEYEKLTDNEYLVKLSVIEQGTPIFNLKLSVGNVKQAKDMCEKWRSDAQELYGQI..................... 169
10 -2.120PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;  ali follow..  15............................YKEMLARTNQTDVYYKAFFYCMGICETTRKHIEDLFDFKEGGMPEHLHQPYQTGTSYKVTRMAY................... 79

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 7 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.