current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: IDP00015 UDP-N-acetylenolpyruvoylglucosamine reductase 1 (UDP-N-acetylmuramate dehydrogenase 1) BA_4048 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MEQLVNELIQANVGRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKWTVIGRGSNLLVSDLGIEGVVIRLGEGLDHLEVEKHRVRVGGGYPLIKLSTLLSRQGLAGLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVLQTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDLIEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEIIGRLast
1 -122.0004pyt_A mol:protein length:309 UDP-N-acetylenolpyruvoylglucosamine reductase  ali model follow..  64  1MDKVIQELKDLQVGKVLENEPLANHTTIKIGGPADCLVIPKDIQAVRDTMEVVKNHGVQWRAIGRGSNLLVLDEGIRGVVIKLGAGLDHMEIDGEQVTVGGGYSVVRLSTGISKKGLSGLEFASGIPGSVGGAVYMNAGAHGSDISRILVKALILFEDGTMEWLTNEEMEFSYRTSILQNKRPGICLEAVLQLEQKERDAIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPDHAGRLVEQAGLKGHRIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEIVGE 301
2 -108.0001hsk_A mol:protein length:326 UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE  ali model follow..  39  9NKDIYQALQQIPNEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLS-LDHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQ-KEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 308
3 -107.0003tx1_A mol:protein length:322 UDP-N-acetylenolpyruvoylglucosamine reductase  ali model follow..  39  15QSNAMNNLQTFPHIAIKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRGVILHLDL-LQTIERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIA-EKNYIVLDATFSLALEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 314
4 -101.0002gqt_A mol:protein length:268 UDP-N-Acetylenolpyruvylglucosamine Reductase  ali model follow..  37  4..............MRVERVLLKDYTTLGVGGPAELWTVETREE-------LKRATEAPYRVLGNGSNLLVLDEGVPERVIRLAGEFQTYDLKG---WVGAGTLLPLLVQEAARAGLSGLEGLLGIPAQVGGAVKMNAGTRFGEMADALEAVEVFH-DGAFHVYCPEELGFGYRKSHLPP--GGIVTRVRLKLKERPKEEILRRMAEVDRAR-KGQP-KRKSAGCAFKNPPGQSAGRLIDERGLKGLRVGDAMISLEHGNFIVNLGQARAKDVLELVRRVQ----EELPLELEWEV..... 266
5 -48.5003i99_A mol:protein length:357 UDP-N-acetylenolpyruvoylglucosamine reductase  ali model follow..  31  12..............QIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCH-YTGMIVVNRLNGIEHQQDDDYLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCETGTVKRLTMEECQFGYRDSIFKHQQKAVVTAVGLKFAKASDCAIHDVYQRVCATRMEKDPAVMGNAGSFFKNPV---AGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGE 343
6 -47.7001mbb_A mol:protein length:342 URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAM  ali model follow..  25  1.................MNHSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLED-YRGTVIINRIKGIEIHDEPDALHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVEATGKQVRLTAKECRFGYRDSIFKHEDRFAIVAVGLRLPKETTVTPQQVFNAVCHMRTTKDPKVNGNAGSFFKNPV---AGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGA 331
7 -46.7004jay_A mol:protein length:340 UDP-N-acetylenolpyruvoylglucosamine reductase  ali model follow..  27  5..............ELQEHCSLKPYNTFGIDVRARLLAHARDEADVREALALARERGLPLLVIGGGSNLLLT-RDVEALVLRMASQGRRIVSDAADVEAEAGEAWDPFVQWSLERGLAGLENLSLIPGTVGAAPMQNIGAYGVELKDVFDSLTALDQDGTLREFDRQACRFGYRDSLFKQEPDWLILRVRLRLTRRASPTARDVSRVICAIRREKDPAVLGNAGSFFKNPL---AGWLIDKGGWKGFRDGPVGVHAQQALVLVNHGGATGAQVRALAERIQEDVRRRFGVELEPEPNL... 339
8 -13.1001i19_A mol:protein length:561 CHOLESTEROL OXIDASE  ali model follow..  16  39....................................VCSPKTPQDVVRLANWAHEHDYKIRPRGAMTPLTVEKGANKVILADTMTHLNGITVNTGTVTAGAGASIEAIVTELQKHDLGWANLPAPGVLSIGGALAVNAGHTYGSLSNLVTELTAVVWNGTTYALETYQRNDPRITPLLTNLGRCFLTSVTMQAGPNPKGADGRTFEKFVAESGGAEAIWYPFTEKPWMK........................................................................ 272
9 -12.2003js8_A mol:protein length:540 Cholesterol oxidase  ali model follow..  16  33....................................TCAPRSADEVVKVANWAKDNGYKVRARGMMSPLTLAAG--AVVLLDTTRYLTAMSIDASKVTAQAGITMEALLTGLEKAGLGVTAAPAPGDLTLGGVLAINGGASYGSISNLVLSLTAVVYDKASGAYALRKFA--QIAPLLAHVGRSLIVEATLQAAPNAAGSGGRTFASYLDSAGRVEAIWFPFTSNPWLK........................................................................ 268
10 -12.2005FXD Entity 1(prereleased)  ali follow..  13  14FDAALQRFRDVVGDKLSTADELEAFRDPYPVGAASAVVSPESTEQVQDIVRIANEYGIPLSPVSTGKNN-----GYGGVIVKTGERMNRINEKYGYALLEPGVTYFDLYEYLQSH---DSGLMLDCPDLGWGSVVGNTLDRGGDHFMWQTGLEVVLPQGEVMRTGMGALPGSFPDGMFTQSNLGIVTKMGIALMQDKEEDLEQIVDIMLPLRINMAPLQ.................................................................................. 272
11 -12.0001w1o_A mol:protein length:534 CYTOKININ DEHYDROGENASE 1  ali model follow..  16  33.PWPASLAALALDGKLRTDSNATAAASTDFGNITSAVLYPSSTGDLVALLSAANSTPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDNVSADGRYVDAGGEQVWIDVLRASLARGVAPRSWTDYLYLTVGGTL-SNAGRHGPQISNVL-EMDVITGHGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRFTDFAAFSADQERLPRPGGGGASFGPMSYVEGSVFVNQS.......................................................... 296
12 -11.8002bvf_A mol:protein length:459 6-HYDROXY-D-NICOTINE OXIDASE  ali model follow..  20  1MVSSKLATPLSIQGEVIYDAIANIWDGRHLQRPS-LIARCLSAGDVAKSVRYACDNGLEISVRSGGHNPNGYATNDGGIVLDLRL-MNSIHIDGSRARIGGGVISGDLVKEAAKFGLAGMHPKVGFCGALNGGVGFLTPKYGLASDNIL-GATLVTATGDVIYCSDDELFWAVRGA---GPNFGVVTEVEVQLYE.......................................................................................................... 204
13 -11.5004o95_A mol:protein length:524 Cytokinin dehydrogenase 4  ali model follow..  17  19........GDVGGGRLSVDASDIAEASRDFGGVARAVFHPRAAGDVAGLVGFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLSWTDYLYL--SVGGTL-SNAGHHGPQISNVY-ELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGGGRRFDYVEGFVVAAEGLIN....................................................... 279
14 -11.4003pm9_A mol:protein length:476 Putative oxidoreductase  ali model follow..  13  47............................LYRGHSPLVLRPGSTEEVVAICKLANEARVALVPQGGNTGLVGGQTPHNGEVVISLKRMDKIDTSSNTITVEAGAILQRVQEKAAEVDRL-FPLSLGAQGSIGGNLSTNAGGTAGLARDMALGVEVVLADGRVSKLKKDNTGYDLRDLFIGAEGTGIITAATLKLFPKPRAVETAFVGELIAETPLDFSVRHANNRDPLEARYPWYV--LIELSSPRDDALESILERGFEDGIVVDAAIANSVQQQQAFWKLREEISPPEGGSIKHDISV... 358
15 -11.4004fdn_A mol:protein length:481 oxidoreductase DprE1  ali model follow..  18  40....................................VLRTPDAEMIVKAVARVAESGGGRGAIARGLGRSYGDNAQNGLVIDMTNTIHSIDADTKLVDIDAGVNLDQLMKAALPFGL----WVPVLPGTVGGAI--ACDIHGGSFGNHVRSMDLLTADGEIRHLTPTGED--FWATVGGNGLTGIIMRATIEMTPTSTAYFIADGDVTASLDETIALHS.................................................................................. 231
16 -11.1001ahu_A mol:protein length:560 VANILLYL-ALCOHOL OXIDASE  ali model follow..  18  71.................................ASAIVAPRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRSVVLDMGKNMNRVNVEGAYCVVEPGVTYHDLHNYLEANNLR--KLWLDVPDLGGGSVLGNAVERGGDHWMMHSGMEVVLANGELLRTGMGALP-PYIDGLFSQSNMGIVTKIGIWLMPPKDGDLKQAVDIIRPLRLGMALQNVPTIRHILL......................................................................... 316
17 -11.0001f0x_A mol:protein length:571 D-LACTATE DEHYDROGENASE  ali model follow..  16  10.KAFLNELARLVGSSHLLTDPAKTARYRK-QGDALAVVFPGSLLELWRVLKACVTADKIILMQAANTGLT-GNDYDRDVVIISTLRLDKLHVKGEQVLAYPGTTLYSLEKALKPLGEPHSVIGSSCIGAIGGICNNSGGSL-GPAYTEMSLFARINEDGKLTLVNHLGIDLGETPSKLDDDRDDVRHDGRHAHDYDYVHRVRDIEADTPARYNADPDRLFESSGC---------AGKLVFAVRLDTFEAEKNQQ-------VFYIGTNQPEVLTEIRRHILANFEN............... 302
18 -11.0004aut_A mol:protein length:468 DECAPRENYL-PHOSPHORYL-BETA-D-RIBOFURANOSE-2-O  ali model follow..  17  31................................VASVLSTSDPEVIVRAVTRAAEEGGRGVIARGLGRSYGDNAQNGGGLVIDMPNRIHSIDSGTRLVDVDAGVSLDQLMKAALPHGL----WVPVLPGTVGGAI--GCDIHGGSFGNHVRSMELLTANGEVRHLTPAGPD--FWATVGGNGLTGIILRATIEMTPTETAYFIADGDVTGSLDETIAFHS.................................................................................. 224
19 -11.0001dii_A mol:protein length:521 P-CRESOL METHYLHYDROXYLASE  ali model follow..  13  18FNKAVQKFRALLGDDLVESDQLVPYNKIMMPVEPSAAVTATTVEQVQGVVKICNEHKIPIWTISTGRNFGYGSAA--QVILDLKNKIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPSFSAPSAIAGPVGNTMDRGVGY--GEHFMMQCGMEVVLANGDVYRTGMGGVPGSTLDGMFTQANYGICTKMGFWLMPEDEADIVEIVDALRPLRMSN...................................................................................... 272
20 -10.9004ml8_A mol:protein length:501 Cytokinin oxidase 2  ali model follow..  21  50...................................AVLHPGSVSDIAATVRHVEGSPLTVAARGHGHSLMGQSQAAQGIVVRM-ESLRGARLQDGFVDAPGGELWINVLRETLKHGLAPKSWTDYLHLTVGGTL-SNAGVHGPQVSNVN-QLEIVTGRGDVVTCSPEDNSDLFYAALGGLGQFGIITRARIALEP.......................................................................................................... 218
21 -10.8002uuu_A mol:protein length:584 ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE  ali model follow..  19  139..................................DLIVLPHSHEEVERLVQLAHKYNVVIIPMGGGSNIIEPVSNERFTVMRRMNKVLWVDRREMTACIQVGIMGPELEKQLHKQGVSSFEFS-----TLGGWLATCSSGHQGDIEDMAVSFRTVTPTGTLELRNGARSGAGINYKHISEGTLGIITEAVMKVHA.......................................................................................................... 313
22 -10.8001zr6_A mol:protein length:503 glucooligosaccharide oxidase  ali model follow..  15  45...................................AIAIPRSTEDIAAAVQCGLDAGVQISAKGGGHSY-YGFGGEDGHLMLELDRMYRVSVDDNVATIQGGARLGYTALELLDQG--NRALSHGTCPAVGVGGHVLGGGYGGLTLDWLIGATVVLADASIVHVSNADLFWALRGG---GGGFAIVSEFEFNTFEAPEIITTYQVTTTWNRKQHVAGLKALQDWAQNTMPRELSMRLEINANAWEGNFFGNAK................................................ 270
23 -10.8002exr_A mol:protein length:524 Cytokinin dehydrogenase 7  ali model follow..  19  38.............GEILCGGAAADIAGRDFGGMNCAVVRPVGPEDIAGAVKAARSDKLTVAARGNGHSINGQAMAEGGLVVDM-STTAENHFETAFVDVSGGALWEDVLKRCVEYGLAPRSWTDYLGLTVGGTL-SNAGVYGPQTSNVT-ELDVVTGNGDVVTCSEIENSELFFSVLGGLGQFGIITRARVLLQP.......................................................................................................... 237
24 -10.6002vfr_A mol:protein length:422 XYLITOL OXIDASE  ali model follow..  16  21.................................AKELLRPHSLDALRALVADSAR----VRVLGSGHSF-IAEPGDGGVLLSLAGSVVDVDTAARTVRVGGGVRYAELARVVHARGLALPNMASLPHISVAGSVATGSGVGNGSLASVVREVELVTADGSTVVIARGD----FGGAVTSLGALGVVTSLTLDLEPALAGLDPATFETVMAAAYSVSLFTAPGFRQVWLKVPGMPAVNCTEQFGVPGPWH--AEFTPSSGAELQSEYLMPREHALAALHAMDAIRETLAPVLQTCEIRTVA. 329
25 -10.4003w8w_A mol:protein length:468 Putative FAD-dependent oxygenase EncM  ali model follow..  20  51...................................LIARCTSTPDVVAAVSFARKSGLLVAVRGGGHSMAGHSVCDGGIVIDLSLMNSKVSRRLRRARAQGGCLLGAFDTATQAHMLAGVVSHTGLGGVLGGGFGWLSRKYGLSIDNLT-SVEIVTADGGVLTASDTENPDLFWAVRGGGGNFGVVTAFEFDLHR.......................................................................................................... 214
26 -10.0003rj8_A mol:protein length:473 Carbohydrate oxidase  ali model follow..  14  39...................................AIAQTQTTAHIQSAVQCAKKLNLKVSAKSGGHSYASFGFGGEHLMVQLDRMIDVISYNDKTAHVEPGARLGHLATVLNDKY--GRAISHGTCPGVGISGHFAHGGFGGLAVDSVVGVTVVLADGRIVEASNADLFWGIKGA---GSNFGIVAVWKLATFPAPKVGVTLNWKNKTSALKGIEAVEDYARWVAPREVNFRIGDYGAGNPGIEGLYYGTPE................................................ 268
27 -9.8504bby_A mol:protein length:658 ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE, PERO  ali model follow..  16  201............................MFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSCPADETRTIITSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCSLEFS-----TVGGWISTRASGMKGNIEDLVVHMKVVTPRGVIEKGPRMSTGPDIHHFIMGSEGTLVITEATIKIRP.......................................................................................................... 383

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;