current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: IDP00014 Protein recA (Recombinase A) BA_3915 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MSDRQAALDMALKQIEKQFGKGSIMKLGEQAERKVSTVSSGSLALDVALGVGGYPRGRIIEIYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGEQGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAINKSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIVGNKTKVKVVKNKVAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRENSKQFLKENTDLREEIAFFIREHHGISEDSGAEGMEDPNLLDLast
1 -144.0001ubc_A mol:protein length:349 RecA  ali model follow..  65  6.PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPV 347
2 -143.0001g18_A mol:protein length:350 RECA PROTEIN  ali model follow..  63  5.PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSNDGVLPA 346
3 -138.0001u94_A mol:protein length:356 RecA protein  ali model follow..  59  8.ENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGV 349
4 -134.0001xp8_A mol:protein length:366 RecA protein  ali model follow..  56  19.KERSKAIETAMSQIEKAFGKGSIMKLGAESKLDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLTAILSKTGTAAIFINQVREKIGVMYGNPETTTGGRALKFYASVRLDVRKIQPTKVGNDAVANTVKIKTVKNKVAAPFKEVELALVYGKGFDQLSDLVGLAADMDIIKKAGSFYSYGDERIGQGKEKTIAYIAERPEMEQEIRDRVMAAIRAGNAGEAPALAPAPAAP 361
5 -134.0003hr8_A mol:protein length:356 Protein recA  ali model follow..  59  5.KQKKSVLEKALKRIEENFGKGSIMILGDETQQPVEVIPTGSLAIDIATGVGGYPRGRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQPDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKIAGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRMEVRRGEPIKEGKDVIGNVISVKIVKNKVAPPFKTAQTYIIYGKGIDREYELFNIAVNEGIVDRKGSWYYYTTLSLGQGSSNAVQFLKDNPEIAGEIERRIREKYGLLSVEKEEQRKEKKSSG 352
6 -86.9003cmu_A mol:protein length:2050 Protein recA  ali model follow..  62  328.ENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE.................... 649
7 -79.9003io5_A mol:protein length:333 Recombination and repair protein  ali model follow..  22  2................................SHMDVVRTKIPMMNIALSTGGMQSGLLI-LAGPSKSFKSNFGLTMVSSYMRQDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLIDMVNQLIERGEKVVVFIDSLGNLASKKETEDALNEKVVSTRAKTMKSLFRIVTPYFSTKNIPCIAINHTYETQEMF---SKTVMGGGTGPMYSADTVFIIGKRQIKDGSDLQGYQFVLNVEKSRTVKEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKKNGWYAFLDEETGEMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLGAIDSNE 321
8 -24.1002cvf_A mol:protein length:220 DNA repair and recombination protein radB  ali model follow..  23  1....................................MLSTGTKSLDSLLG-GGFAPGVLTQVYGPYASGKTTLALQTGLLS---GKKVAYVDTEGGFSPQMAETRGLNLSRFILFTPSDFKEQRRVIGSLTVDSNFALVVVDSITAHY-RAEENRS--------LIAELSRQLQVLLWIARKHNIPVIVINQVHFDSR---TEMTKPVAEQTLGYRCKDILRLDKLPK--------PGLRVAVLERHRFRPEGLMAYFRIT-ERGIE............................................................................ 217
9 -23.5004dc9_A mol:protein length:266 DNA repair and recombination protein radA  ali model follow..  20  16.............................KQRSTVWKLSTSSSELDSVLG-GGLESQSVTEFAGVFGSGKTQIMHQSCVNLQ-AQPKAVYIDTEGTFRPEMAEHAGIDLDNTFVARAYNSDMQMLFEDLIQEGNNIKLVVIDSLTSTF-RNEYTGR---GKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGK----------GDKRVAKLYDSPHLPDAEAIFRIT-EKGIQ............................................................................ 265
10 -23.2002bke_A mol:protein length:324 DNA REPAIR AND RECOMBINATION PROTEIN RADA  ali model follow..  20  56.STAQKIIKEARDALDIRFKTALEVK---KERMNVKKISTGSQALDGLLA-GGIETRTMTEFFGEFGSGKTQLCHQLSVNVQ-LSGKAVYIDTEGTFRWERIENMAKAMNNIYYIRAINTDHQIAIQELVSKDPSIKLIVVDSVTSHF-RAEYPGR---ENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMARPDMFYGDPTVAVGGHTLYHVPGIRIQLKKSR----------GNRRIARVVDAPHLPEGEVVFALT-EEGIRDAEE........................................................................ 324
11 -23.2001n0w_A mol:protein length:243 DNA repair protein RAD51 homolog 1  ali model follow..  21  2.................................EIIQITTGSKELDKLLQ-GGIETGSITEMFGEFRTGKTQICHTLAVTCQ-GEGKAMYIDTEGTFRPAVAERYGLSLDNVAYARAFNTDHQTQLASAMMVESRYALLIVDSATALY-RTDYSGR---GELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDMFAADPKKPIGGNIIAHASTTRLYLRKGR----------GETRICKIYDSPCLPEAEAMFAIN-ADGVGDAKD........................................................................ 243
12 -22.8004hyy_A mol:protein length:265 Meiotic recombination protein DMC1/LIM15 homo  ali model follow..  23  10.............................EKRKMVFHITTGSQEFDKLLG-GGIESMAITEAFGEFRTGKTQLSHTLCVTAQ-PGGKIIFIDTENTFRPDIADRFNVDLDNVLYARAYTSEHQMELLDYVAEAGIFKLLIIDSIMALF-RVDFSGR---GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGTFQADPKKPIGGHILAHASTTRISLRKGR----------GELRIAKIYDSPEMPENEATFAIT-AGGIG............................................................................ 253
13 -22.6001t4g_A mol:protein length:322 DNA repair and recombination protein radA  ali model follow..  19  47.KAAAKMIMGARDLCDLGFKSGIDLL---KQRSTVWKLSTSSSELDSVLG-GGLESQSVTEFAGVFGSGKTQIMHQSCVNLQ-AQPKAVYIDTEGTFRPQMAEHAGIDLDNTFVARAYNSDMQMLFEDLIQEGNNIKLVVIDSLTSTF-RNEYTGR---GKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAKPDAFFGMAEQAIGGHIVGHAATFRFFVRKGK----------GDKRVAKLYDSPHLPDAEAIFRIT-EKGIQ............................................................................ 321
14 -22.1001pzn_A mol:protein length:349 DNA repair and recombination protein rad51  ali model follow..  21  78....EGTALKIIQAARKAANLGTFMRADEKKRATIGRISTGSKSLDKLLG-GGIETQAITEVFGEFGSGKTQLAHTLAVMVQ-LNGSVIWIDTENTFRPEIAQNRGLDLKHIYVARAFNSNHQMLLKELLNTDRPVKLLIVDSLTSHF-RSEYIGR---GALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGK----------GGKRIARLIDAPHLPEGEAVFSIT-EKGIE............................................................................ 348
15 -22.1001v5w_A mol:protein length:343 Meiotic recombination protein DMC1/LIM15 homo  ali model follow..  22  71.AKVDKIKEAANKLIEPGFLTAFEYS---EKRKMVFHITTGSQEFDKLLG-GGIESMAITEAFGEFRTGKTQLSHTLCVTAQ-PGGKIIFIDTENTFRPDIADRFNVDLDNVLYARAYTSEHQMELLDYVAEAGIFKLLIIDSIMALF-RVDFSGR---GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGTFQADPKKPIGGHILAHASTTRISLRKGR----------GELRIAKIYDSPEMPENEATFAIT-AGGIGDAKE........................................................................ 343
16 -22.0003etl_A mol:protein length:322 DNA repair and recombination protein radA  ali model follow..  19  47.KAAAKMIMAARDLCDLGFKSGVELL---KQRQSVWRLSTGSTELDTVLA-GGIESQSVTEFAGMFGSGKTQIMHQTCVNLQ-EAPKAVYIDTEGTFRPEMAEGAGIDLDNTFVARAYNSDMQMLFEDLIKGGNNIKLVIIDSLTSTF-RNEFTGR---GKLAERQQKLGRHMATLNKLADLYNCIVLVTNQVAAKPDAYFGVAEQAIGGHVVGHAATFRFFLRKSK----------GDKRVAKLYDSPHLPDSEAVFRIT-EKGIQ............................................................................ 321
17 -21.0004a6p_A mol:protein length:231 DNA REPAIR AND RECOMBINATION PROTEIN RADA  ali model follow..  21  2................................ATIGRISTGSKSLDKLLG-GGIETQAITEVFGEFGSGKTQLAHTLAVMVQ-LNGSVIWIDTENTFRPEIAQNRGLDLKHIYVARAFNSNHQMLLKELLNTDRPVKLLIVDSLTSHF-RSEYIGR---GALAERQQKLAKHLADLHRLANLYDIAVFVTNQV------------QANGGHILAHSATLRVYLRKGK----------GGKRIARLIDAPHLPEGEAVFSIT-EKGIE............................................................................ 230
18 -20.8004b2i_A mol:protein length:231 DNA REPAIR AND RECOMBINATION PROTEIN RADA  ali model follow..  21  2................................ATIGRISTGSKSLDKLLG-GGIETQAITEVFGEFGSGKTQLAHTLAVMVQ-LNGSVMWIDTENTFRPEIAQNRGLDLKHIAYARAFNSNHQMLLKELLNTDRPVKLLIVDSLTSHF-RSEYIGR---GALAERQQKLAKHLADLHRLANLYDIAVFVTNQV------------QANGGHILAHSATLRVYLRKGK----------GGKRIARLIDAPHLPEGEAVFSIT-EKGIE............................................................................ 230
19 -20.8005FOS Entity 1(prereleased)  ali follow..  21  2................................ATIGRISTGSKSLDKLLG-GGIETQAITEVFGEFGSGKTQLAHTLAVMVQ-LNGSVMWIDTENTFRPEIAQNRGLDLKHIAYARAFNSNHQMLLKELLNTDRPVKLLIVDSLTSHF-RSEYIGR---GALAERQQKLAKHLADLHRLANLYDIAVFVTNQV------------QANGGHILAHSATLRVYLRKGK----------GGKRIARLIDAPHLPEGEAVFSIT-EKGIE............................................................................ 230
20 -20.6003lda_A mol:protein length:400 DNA repair protein RAD51  ali model follow..  19  127.AKADKLLNEAARLVPMGFVTAADFH---MRRSELICLTTGSKNLDTLLG-GGVETGSITELFGEFRTGKSQLCHTLAVTCQ-GEGKCLYIDTEGTFRPSIAQRFGLDLNNVAYARAYNADHQLRLLDAAMSESRFSLIVVDSVMALY-RTDFSGR---GELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDAFNPDPKKPIGGNIMAYSSTTRLGFKKGK----------GCQRLCKVVDSPCLPEAECVFAIY-EDGVGDPRE........................................................................ 397
21 -17.1002w0m_A mol:protein length:235 SSO2452  ali model follow..  22  2..................................VSRLSTGILDFDKLIQ-GGIPQGFFIALTGEPGTGKTIFSLHFIAKGLRDGDPCIYVTTEESRDSIIAKQFNWDFEEYILVNLTPEELVNKVIEAKQKLGGKARLVIDSVSALFLDKPAM--------------ARKISYYLKRVLNKWNFTIYATSQY--------AITTSQAFGFGVEHVADGIIRFRRMIRNGE-------HRYILIEKMRQTDHDKHVEIDIVNGKGIVLKGRLEE..................................................................... 235
22 -17.0004wia_A mol:protein length:233 Putative flagella-related protein H  ali model follow..  18  2..............................GIMELARIDLSRDDLDKRIG-GGIPHGSLIIIEGEESTGKSVLCQRLAYGFLQNRYSVTYVSTQLTTLEFIMNSLNYSINKKLLSDNKKKDGFLKKVMETRAFYEKDVIIFDSISALIANDASEVNV-------------DDLMAFFKRITALKKIIICTVNPKELPESVLTIIRTSATMLIRTELFTFGGDLKNL---------------AKILKYNMAP--KNIVFRVEPKIGIA............................................................................ 226
23 -16.3002zts_A mol:protein length:251 Putative uncharacterized protein PH0186  ali model follow..  17  1..........................MRIMAYQPVRRVKSGIPGFDELIE-GGFPEGTTVLLTGGTGTGKTTFAAQFIYKAEEYGEPGVFVTLEERARDLRMASFGWDFEKYVLEDRFNVDNFLRYIYRVVKAINAKRLVIDSIPSIALRLE------------EERKIREVLLKLNTILLEMGVTTILTTEAPDPQHGKYGIEEFIARGVIVLDLQEKNIELKRY---------------VLIRKMRETRHSMKKYPFEIGPNGIV............................................................................ 243
24 -16.1002dr3_A mol:protein length:247 UPF0273 protein PH0284  ali model follow..  15  2..................................TRRVKTGIPGVDEILH-GGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRMAQFGWDVKPYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAM--------------ARSIILQLKRVLAGTGCTSIFVSQV--------SVGERGFGGPGVEHGVDGIIRLDLDEIDGE-------KRSLIVWKMRGTSHSMRRHPFDITDKGIIKRGKVLEL.................................................................... 247
25 -15.6004yds_A mol:protein length:228 Flagella-related protein H  ali model follow..  19  3.....................................ISTGNDDLDRRLG--GIPYPASIMIEGDHGTGKSVLSAQFVLGFLLSDKKGYVITTEQTTKDYLMKEIKIDLIPYFIRNSSLAEKILDVIVNFIRSKNIDFIVIDSLSILAAFSK-------------EKQLLQFMKDIRVLVNTGKMILFTIHPDTFDEEMKSKITSIVDVYLKLSAATIGGRRVKILERVKTTGGISGSDTI---------------SFDVDPALGIK............................................................................ 219
26 -15.0001oft_A mol:protein length:161 HYPOTHETICAL PROTEIN PA3008  ali model follow..  14  12........................LPLFQEAFWASNGAPLLDDVIDSPSSASIEEPAAFSELSLSGLPHCLTLLAPILRELEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVV----------------------SWLEPLSRAARKQLSRAAQLGQAQSLNIR........................................................................................................................................................ 159
27 -11.9004o0m_A mol:protein length:524 Circadian clock protein kinase KaiC  ali model follow..  16  8.......................QSSPTEQSSAEVKKIPTMIEGFDDISH-GGLPQGRTTLVSGTSGTGKTLFAVQFLYNITIFNEPGIFVTFEESPQDIIALSFGWNLQSLIDQSPDP-SALIERIQYAIRKYKATRVSIDSVTAVFQQYD------------AASVVRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEF---ILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGIN-SSGVKTLDEMCGGGFFKDSIILATGATGTGKTLLVSKFLETGCQQGE-EESRAQLSRNASSWGIDFEELERR.................... 341
28 -11.7001tf7_A mol:protein length:525 KaiC  ali model follow..  14  7.......................TSPNNNSEHQAIAKMRTMIEGFDDISH-GGLPIGRSTLVSGTSGTGKTLFSIQFLYNIIEFDEPGVFVTFEETPQDIIARSFGWDLAKLVDESPDP-SALIERINYAIQKYRARRVSIDSVTSVFQQYD------------ASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEF---ILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDNIFPLGAMRLLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKE-EESRAQLLRNAYSWGMDFEEMERQ.................... 341
29 -9.8901cr0_A mol:protein length:296 DNA PRIMASE/HELICASE  ali model follow..  14  10.............................SSEESVGLLFSGCTGINDKT---GARGGEVIMVTSGSGMGKSTFVRQQALQGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFMRSGLGCDVIILDHISIVVSASGESDE---------RKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDK----SITDLRGSGALRQLSDTIIALERNQQGDMP-----NLVLVRILKCR............................................................................................... 252
30 -9.3303bs4_A mol:protein length:260 Uncharacterized protein PH0321  ali model follow..  10  3.....................................LSWEIEELDREIG-KIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIILSRFGVDVIKYLENH--------------------RLAIVDTFGSFHGIKATMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRE..................................................................................................................................................... 140

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;