current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: IDP00007 gene: racE-1; glutamate racemase BA_0847 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MSVCHKHSVIGVLDSGVGGLTVASEIIRQLPKESICYIGDNERCPYGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAATLAALQEALSIPVIGVIHPGARAAIKVTKKGKIGVIGTVGTIQSNMYEKALHELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTKEDIDTLILGCTHYPLLESYIKKELGEDVTIISSAEETAIELSTILQHKGILADNLNPKHRFFTTGSVSSFEHIAERWLGYQISVDCVDLPVKNARICNLast
1 -110.0002dwu_A mol:protein length:276 Glutamate racemase  ali model follow..  100  1MSVCHKHSVIGVLDSGVGGLTVASEIIRQLPKESICYIGDNERCPYGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAATLAALQEALSIPVIGVIHPGARAAIKVTKKGKIGVIGTVGTIQSNMYEKALHELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTKEDIDTLILGCTHYPLLESYIKKELGEDVTIISSAEETAIELSTILQHKGILADNLNPKHRFFTTGSVSSFEHIAERWLGYQISVDCVDLPVKNARICN 276
2 -105.0002gzm_A mol:protein length:267 Glutamate racemase  ali model follow..  50  1....KLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEESDHLFLTTGKIGLFKEIASKWFGQPINVKHIHLEK....... 267
3 -104.0003hfr_A mol:protein length:269 Glutamate racemase  ali model follow..  48  4.....MKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDADEEIEHRFFTTGSTQIFKDIAKDWLNMPDTVEHIKLGK....... 269
4 -104.0002jfq_A mol:protein length:286 GLUTAMATE RACEMASE  ali model follow..  43  15.....MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVIACNTATAVALEYLQKTLSISVIGVIEPGARTAIMTTRNQNVLVLGTEGTIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPITSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEPDHRFFATGDTTHITNIIKEWLNLSVNVERISVND....... 280
5 -103.0002oho_A mol:protein length:273 Glutamate Racemase  ali model follow..  44  7.SHMMDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPRPKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKKIVYDSLAPLVG-KIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFDINGNYHQVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL......... 273
6 -102.0002jfu_A mol:protein length:291 GLUTAMATE RACEMASE  ali model follow..  47  13MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQRTLCQFYTTGSAKLFEEIAEDWLGIGHNVEHIELGGK...... 285
7 -102.0002jfo_A mol:protein length:293 GLUTAMATE RACEMASE  ali model follow..  46  13.SHMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPETQPHEFYTTGSAKMFEEIASSWLGIENKAQQIHLGGNE..... 285
8 -100.0001zuw_A mol:protein length:272 glutamate racemase 1  ali model follow..  51  2.....LEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWELTNYLLEHHIKMLVIACNTATAIALDDIQRSVGIPVVGVIQPGARAAIKVTDNQHIGVIGTENTIKSNAYEEALLALNPDLKVENLACPLLVPFVESGKFLDQTADEIVKTSLYPLKDTSIDSLILGCTHYPILKEAIQRYMGEHVNIISSGDETAREVSTILSYKGLLNQSPIPDHQFLTTGARDQFAKIADDWFGHEVHVECISLQEPIKR... 272
9 -96.4001b73_A mol:protein length:254 GLUTAMATE RACEMASE  ali model follow..  38  2........KIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKSGAYQRKLEE--GGADVFAKACPLFAPLAEEGLLEGEITRKVVEHYLKEFKG-KIDTLILGCTHYPLLKKEIKKFLGD-AEVVDSSEALSLSLHNFIKDDGS------SSLELFFTDLSPNLQFLIKLILGRDYPVKLAEG......... 250
10 -96.4003out_A mol:protein length:268 Glutamate racemase  ali model follow..  32  2.NAMLDNRPIGVFDSGIGGLTIVKNLMSILPNEDIIYFGDIARIPYGTKSRATIQKFAAQTAKFLIDQEVKAIIIACNTISAIAKDIVQEIAAIPVIDVITAGVSLV---DNLNTVGVIATPATINSNAYALQIHKKNPNIEVYSNPCGLFVSMIEEGFVSGHIVELVAKEYLSYFHDKNIQALILGCTHYPIIKESIAKILD--VKLIDPSLQASKMLYSLLFENKLLNTTKSPEYRFYVTDIPLKFRSVGEMFLQTEMHLEIVSLDS....... 267
11 -94.2003uhf_A mol:protein length:274 Glutamate racemase  ali model follow..  32  12LYFQSNAMKIGVFDSGVGGLSVLKSLYEARLFDEIIYYGDTARVPYGVKDKDTIIKFCLEALDFFEQFQIDMLIIACNTASAYALDALRAKAHFPVYGVIDAGVEATIKADKNKEILVIATKATIKSEEYQKRLLS-QGYTNINALATGLFVPMVEEGIFEGDFLQSAMEYYFKNIT--TPDALILACTHFPLLGRSLSKYFGDKTKLIHSGDAIVEFLK---ERENIDLKNHKAKLHFYASSDVESLKNTAKIWLNLLRK............... 268
12 -88.6002jfx_A mol:protein length:255 GLUTAMATE RACEMASE  ali model follow..  32  2........KIGVFDSGVGGFSVLKSLLKARLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHEIELLIVACNTASALALEEMQKYSKIPIVGVIEPSILAIKRQVKNAPILVLGTKATIQSNAYDNALK-QQGYLNISHLATSLFVPLIEESILEGELLETCMHYYFTPLE-ILPEVIILGCTHFPLIAQKIEGYFMGHFALIHSGDAIVEYLQQKYALKN--NACTFPKVEFHASGDVIWLERQAKEWLK................... 254
13 -69.2002jfn_A mol:protein length:285 GLUTAMATE RACEMASE  ali model follow..  29  15ATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPYGEKSEAFIVERVVAIVTAVQERPLALAVVACNTASTVSLPALREKFDFPVVGVV-PAIKPAARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSLDALKRILRPWMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLEHEAPDAKSADANIAFCMAMTPG.............................. 262
14 -21.8003s7z_A mol:protein length:268 Putative aspartate racemase  ali model follow..  17  14FQSNAMKHTIGIL-GGMGPAATAEKFVELRHASSIPDIPDRTACLLS--GGPSPYRYLERYLHMLEDAGAECIVIPCNTAHYW-FDDLQNVAKARMISILDATLGDIPPSAR--HVGLLATNATLATGLYQKKALARGLTLIQPEDAGQALVMQAIYTLKRGTAAQALLLPQIDSLIARGAQAIIMGCTEIPLIVAGHERAIA--CPMIDSTASLVRAA......................................................... 240
15 -21.2001jfl_A mol:protein length:228 ASPARTATE RACEMASE  ali model follow..  20  2.......KTIGIL-GGMGPLATARRIVIKTPAKR-VIIFNNPQIPDRTAYIEDPRPQLIWTAKRLEECGADFIIMPCNTAHAF-VEDIRKAIKIPIISMIEETAK-KVKELGFKKAGLLATTGTIVSGVYEKEFSKMTPTEDEQKDVMRGIYEGVKAGNLK--LGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDL----KVPLIDPMDVIAEVAVKV...................................................... 224
16 -15.6002zsk_A mol:protein length:226 226aa long hypothetical aspartate racemase  ali model follow..  19  2.......KKIGI----IGGTTSREKFEKYFYPELIIYSINFKEFFQNPEGWEGRKKILINAAKALERAGAELIAFAANTPHLVF-DDVQREVNVPMVSIIDAVAE-EILKRGVRKVLLLGTKTTMTADFYIKTLEEKGLEVVVPNDEEKEELNRI-FGNLKNKEWIVRLIEKY--RESEGIEGVILGCTELPLA.................................................................................. 199
17 -13.7005ell_A mol:protein length:238 Asp/Glu_racemase family protein  ali model follow..  16  26............IKQRLGGLHSAQVLLHSVDFHEIEECQRRGE--------DKTGDILAEAALGLQRAGAEGIVLCTNTMHKVA-DAIESRCTLPFLHIADATGR-AITGAGMTRVALLGTRYTMEQDFYRGRLTELIPEADERAKINQIIFEELCLGQFT-EASRAYYAQVIARLAEQGAQGVIFGCTEIGLL.................................................................................. 203
18 -13.7003ojc_A mol:protein length:231 Putative aspartate/glutamate racemase  ali model follow..  18  27............VKAQLGGLHSAKIILYSVDFHEIEQLQAKGD--------QTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVA-DDIEAACGLPLLHIADATAV-QIKQQGIDKIGLLGTRYTMEQGFYRGRLTEITPDDTDREAVNRIIYEELCLGIIS-ETSRDAYRRVIKKLEAQGVQGIIFGCTEITLL.................................................................................. 204
19 -13.2002eq5_A mol:protein length:228 228aa long hypothetical hydantoin racemase  ali model follow..  20  23...................LNLHGRIIESAFPELKVVSRCIEDQPKGIYNEETEREAEPKIIRLAKEEGVDAIIISC--AADPAVEKVRKLLSIPVIGAGSSVSALALAY--GRRVGVLNLT--------EETPKVIRSILGNNLIAEDHPSGVSNTLDLLTDWGRREVINAAKRLKEKGVEVIALGCTGMS-IAPVLEEEVG--IPVIDPVIASGAVALHAL..................................................... 217
20 -11.4003qvj_A mol:protein length:245 Putative hydantoin racemase  ali model follow..  15  34.......................................LAVCPRAGVPSIEGHFDEAIAAVGVLREQGVDGHVIAC---GDPGLLAARELAQGPVIGIAEAAMHMA--TMVATRFSIVTTLPRTLI-IARHLLHQYGFHQHCAALHA---LPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGCGGMATLAQQLTRELR--VPVIDGVSAAVKMVESLVA.................................................... 216
21 -9.6302dgd_A mol:protein length:223 223aa long hypothetical arylmalonate decarbox  ali model follow..  10  1..MPGGRGRIGVI----NNAGMEYDLWKMAPEGVSIHSTRMKPTKGCEPENVEEFEKELKYSYSLLAEVSDIIIYGR-TYGTHKHAHVIKRVIKDVVIPEE-SVYELLKKLNVRKLWIGTPYIKERTLEEVEWWRN--KGFEIVGYDGLGKIRGIDISNTPIFTIYRLVKRHLNE--VLKADAVYIACTALSTYEAVQYLHEDLDMPVVSENAAAMWEALNKL..................................................... 214
22 -9.2101j6o_A mol:protein length:268 TatD-related deoxyribonuclease  ali model follow..  16  63.......CSVGVHPHDAKEVPFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLGIGGPVKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVD........................................................................................... 246
23 -9.1801yix_A mol:protein length:265 deoxyribonuclease ycfH  ali model follow..  18  62.......FSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLH--AGKLLDL--GFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTD...................................................................................... 248
24 -9.0302vlb_A mol:protein length:251 ARYLMALONATE DECARBOXYLASE  ali model follow..  14  11.........IGMIVPPAA--GLVPADGARLYPDLPFIASGLGLGSVTPEGYDAVIESVVDHARRLQKQGAAVVSLMGTSLSAALTVAMREATGLPCTTMST-AVLNGLRALGVRRVALATAYIDDVNERLAAFLAE--ESLVPTGCRSLGITGVEAMARVDTATLVDLCVRAFEA--APDSDGILLSCGGLLTLDAIPEVERRLGVPVVSSSPAGFWDAVRLA..................................................... 225

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;