current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [C] COG2441 Predicted butyrate kinase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MISAGIDPGTGSYDVVAIEDGKVVFRKNIPTEEVRASPDVIVEVIEESGAEVAAGLSGYGLPVKRFSELDEVDLLLMTLNFDSERAIGLRNIIKAVKERNVNLYTVPAVIHLPTVPPWRKMNRIDIGTADKLCSAVLAVAKLSEEEELTKLNFILAEVGEGFNAFIAVRNGRIVDGMGGTTSFPGYSSLGAMDAELAYIIGEFPKKLIFSGGVKSFASEWKVNENEVTNILSEFVLKGIRAMEVSTDADFYMLSGRFAPDVLRKLRGEGKEVRLLGGFGRGKQSAQGAAIIANAIAGGEYREIVDYMRIFEAKGTLLDYITSDIMEYVRRGLKRRGDLast
1 -35.6001saz_A mol:protein length:381 Probable butyrate kinase 2  ali model follow..  18  2FRILTINPGSTSTKLSIFEDERMVKMQNFSHDQLEFREKIARQFVEETGYSAFVSRGGLLDPIPGGVYVDGLMIKTLKSGKNGEHASNLGAIIAHSSETGVPAYVVDPVVVDEMEDVARVSGHPNYQRKHALNQKTVAKEARMMNKRYEEMNLVVAHMGGGI-SIAAHRKGRVIDVNNAGDGPFTPERSGTLPLTQLFTYEEMKKRIVGNGGLVAYLGTSDEWAKRVYRAMAYQIAKWIGKMAAVGEVDFIVLTGGLAHEKITKRVSFIAPVLVFPGSNEEKALALSALRVLRGEEKPKNYS................................... 356
2 -16.0003vov_A mol:protein length:302 Glucokinase  ali model follow..  14  1MKVVGLDLGGTKIAAGVFDGKRLLSKVVVPTPKEGGEREALAEAAERAEREAGVRGEAIGL--------------------------GTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFLENDANAAALAEHHLGAAQGEE--SSLYLTVSTGIGGGVVL-GGRVLRGERGQGGELGHLLEGCLEAALERDATYAFQRPVDTRELFRLFQAGDPKAERLVLQAARYVGIGLASLVKAFDPGVVVLGGGVALEAYRRYLQGWEAPPLRRARLGAEAGLLGAALTA-------------YLEVKDGSG....................... 302
3 -15.2002aa4_A mol:protein length:289 Putative N-acetylmannosamine kinase  ali model follow..  12  1MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQRVAI--------------------------ASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGDI---TDMVFITVSTGVGGGV-VSGCKLLTGPGGLAGHIGHTRTGCVEGRGIAAAAQGELAGADAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLATYLAQEPAAFHVDLLAAHYRHDAGLLGAALLAQG........................................... 288
4 -12.6002ews_A mol:protein length:287 Pantothenate kinase  ali model follow..  11  15.MKVGIDAGGTLIKIVQEQDNQRTFKT-------TKNIDQVVEWLNQQQIEKLCLTGGNAGVIAENINI-------------------------------------------------------PAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTG-TSLHYFDGQSQRRVGGIGTGGGMIQGLGYLQITDYKQLTDMAQHTAANFGHVLHHLDADFTPSNKLAAVIGVVGEVVTTMAITVKTENIVYIGSSFHNKVVEDYTVLRGCKPYYVENGAFSGAIGALYLEK............................................ 281
5 -12.4004htl_A mol:protein length:297 Beta-glucoside kinase  ali model follow..  10  4MKIAAFDIGGTALKMGVVLPHGEIILTKSAEISGSDGDQILAEMKVFLAENTDVTGIAVSAP----------------------------GYVNPKTGLITMGGAIRRFDNFNLKEWLEAETGLPVAIENDANCALLAEKWLGKGQDLD--DFLCLTIGTGIGGGI-FSNGELVRGGRFRAGEFGYMFSERPGRRQYAELTGRPLEEITGEEIFANYDAHDAVSERLITEFYTGICTGLYNLIYLFDPTHIFIGGGITSTFIAELKHHMESFGLRDTIIETATHKNQAGLL------GAVYHFLQEENRHE.......................... 297
6 -12.4004m7x_A mol:protein length:273 Type II pantothenate kinase  ali model follow..  11  1.MKVGIDAGGTLIKIVQEQDNQRTF-----KTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAENINI-------------------------------------------------------PAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTG-TSLHYFDGQSQVGGIGTGGGMIQGLGYLLSQITDYKQLTDMAQHTAANFGHVLHHLDADFTPSNKLAAVIGVVGEVVTTMAITVKTENIVYIGSSFHNKVVEDYTVLRGCKPYYVENGAFSGAIGALYLEK............................................ 267
7 -12.2001hux_A mol:protein length:270 ACTIVATOR OF (R)-2-HYDROXYGLUTARYL-COA DEHYDR  ali model follow..  14  3IYTLGIDVGSTASKCIILKDGKEIVAKSLVAVGTSGPARSISEVLENAHMKKMAFTLATGYGRNSLEGIADKQMSELSCHAMGAS------------------FIWPNV--------------------------------------------TVIDIGGQDVKVIHVENGTMTNFQMNDKCAAGTSDLAELGAKSTKRVAISSTCTVFAESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKVVMTGGVAQNYVRGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAAKSAWSH.................................. 265
8 -12.2004nb4_A mol:protein length:285 Type II pantothenate kinase  ali model follow..  11  13.MKVGIDAGGTLIKIVQEQDNQRTF-----KTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAENINI-------------------------------------------------------PAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTG-TSLHYFDGQSQVGGIGTGGGMIQGLGYLLSQITDYKQLTDMAQHTAANFGHVLHHLDADFTPSNKLAAVIGVVGEVVTTMAITVKTENIVYIGSSFHNKVVEDYTVLRGCKPYYVENGAFSGAIGALYLEK............................................ 279
9 -11.9003htv_A mol:protein length:310 D-allose kinase  ali model follow..  16  8.VVAGVDMGATHIRFCLRTEGETLHCEKKRTAEVIAPGSGIGEMIDEQLRRFNARCHGLVMGFPALVSKDKRTISTPNLPLTAADLYDLADKLEN--TLNCPVEF---------------------------RDVNLQLSWDVVENRLTQQLVLAAYLGTGMGFAVWM-NGAPWTGAHGVAGELGHINPGCLETNCSMALRRWYEQQPRNYPLRDLFVH--AENAPFVQSLLENAARAIATSINLFDPDAVILGGGVMDETLVAMTQKYLVVRFIAASSSDFNGAQGAAILAH............................................ 298
10 -11.7004db3_A mol:protein length:327 N-acetyl-D-glucosamine kinase  ali model follow..  12  19.MYYGFDVGGTKIEFGAFNEKLERVATPTPTDDYPLLLETIAGLVAKYDQEF-EGKIGLGLP------------GMEDADDATVLTVNVPAAKGKPLRADLEAKIGRSVKIENDAN-------------------CFALSEAWDEELQDAPSVMGLILGTGFGGGLIY-EGKVFSGRNNVAGELGHMKKGCLDSGFELLYAHYYGEEKKAIDIIKANAAGDEKAAEHVERFMELLAICFGNIFTANDPHVVALGGGLSNFELKYLLSVAKCPKIIKAKHGDSGGVRGAAFL.............................................. 317
11 -11.6003r8e_A mol:protein length:321 Hypothetical sugar kinase  ali model follow..  14  15..ILGIDVGGTSVKFGLVTEGEIQNATRFMTADWVNGIGFVESMKLEIGNFLKQYPIVKGVGI------------------------GWPGLVSLDRTKVILLPNIPSVVNVPIVEIRSEFPHIHFKIENDAKCAALGEYYFGENKRMQ--TFILLALGTGVGSGVMM-NGKLFIGGRGNGTEVGHMLTTRLALDVAKKSSLHTIAELSPKVIADHAAQGDALALAVWADIGTIIGESLVNIVRVMDLNNILLGGGISGPNLKKAMLEHLDMYIGKATLENDAGLLGAAGLI............................................. 311
12 -11.4002gup_A mol:protein length:292 ROK family protein  ali model follow..  15  4MTIATIDIGGTGIKFASLTDGKILDKTSISTPENLED-AWLDQRLSEQDYSGIAM---------SVPGAVNQETGVIDGFSAVPYIHGF-SWYEALSSYQLPVHL-----------------------ENDANCVGLSELLAHPELE----NAACVVIGTGIGGAM-IINGRLHRGRHGLGGEFGYMQLASTGNMVRYVIEKSGHTDWDGRKIYQEAAAGNILCQEAIERMNRNLAQGLLNIQYLIDPGVISLGGSISQN............................................................................. 240
13 -11.2002ap1_A mol:protein length:327 putative regulator protein  ali model follow..  12  19.MYYGFDIGGTKIALGVFDSTRRLQWEPTPHTSYSAFLDAVCELVEEADQRF-KGSVGIGIP------------GMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDAN-------------------CFALSEAWDDEFTQYPLVMGLILGTGVGGGLVL-NGKPITGQSYITGEFGHMQMGCIENGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGGGLSNRLPRHLLPVARAPRIERARHGDAGGMRGAAFL.............................................. 317
14 -11.2003eo3_A mol:protein length:333 Bifunctional UDP-N-acetylglucosamine 2-epimer  ali model follow..  15  14LSALAVDLGGTNLRVAIVSKGEIVKKYTQFNPK---TYEERINLILQMCVEAAAEAVGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSD--TLHLPVWV-----------------------DNDGNCAALAERKFGQGKGLE--NFVTLITGTGIGGGIIH-QHELIHGSSFCAAELGHLSHGCIEALLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLAKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMV............................................. 320
15 -11.2004apw_A mol:protein length:329 ALP12  ali model follow..  11  7EYVMTLDAGKYETKLIGKNKKGTTEDIK-NLEDGYIDIEGNSHKIELDGKEYLIGEQGVEDSSETSKTNLIHKLAAYT---------AITQVLDSNKNNKVQLVLACPLSVRDYIKGNGEITVKVDDKEYSFEITDITIKAEGSGENFKNKNVAVIDFGGLNMGFSLYRNCVVNPSERFIE------EHGVKDLIIRVGITNEQAESALNNGYMKKGGEIDTESSTVIKKVKEKFLKDAIKLI-LDQLDSLIFIGG-TTQKLKEQISKTYPNNSIITNNSQWTTCEGLYKVAVAKYCIQ...................................... 329
16 -10.9003sk3_A mol:protein length:415 Acetate kinase  ali model follow..  15  13KLVLVLNCGSSSLKFAIIDDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSLNKPVEELNIITCHLGNG-GSVSAIRNGKCVDTSMGLTPLEGLVRSGDIDPAIIMSVDQINKMLTKESGLLGLTEVTKEDAKRAMDVYCHRLAKYIGSYTALGRLDAVVFTGGIGENAAELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDAS..................... 405
17 -10.8003r9p_A mol:protein length:391 AckA  ali model follow..  13  12RRVLVINSGSSSLKFQLVDPEFIVERIGEESSPVPDHDAALTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALQGIEVARRLLPDIAHVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSLDRPLRGLKQIVLHLGNG-CSASAIAGTRPLDTSMGLTPLEGLVRSGDIDPSIVMGVDDVESMLNHRSGVVGLSGVRDFRAQLAYSVFTHRLRKYIGALAVLGHTDVISFTAGIGENDAAVR----------------RDAVSGMEELGIVLDERRNLAGGKGARQISADDSPITVLVVPTNEELA........ 380
18 -10.8002hoe_A mol:protein length:380 N-acetylglucosamine kinase  ali model follow..  11  83..VLGIEVTRDEIAACLIDASMNILAHEAHPLPSQSDREETLNVMYRIIDRAKD-----------------------MMEKLGSKLSALTVAAPGPIDTERGIIIDPRNFPLSQIPLANLLKE-KYGIEVWVENDADMGAVGEKWYTKRDDSFAWILTGKGIGAGIII-DGELYRGENGYAGEIGYTEYVFLEDVCNENVVLKHVLSMGFSSLAEARDSGDVRVKEYFDDIARYFSIGLLNLIHLFGISKIVIGGFFKKIEVETHLLYKHSVDMSFSKVQEPVIAFGAAVHA............................................. 363
19 -10.8003p4i_A mol:protein length:392 Acetate kinase  ali model follow..  13  13RRVLVINSGSSSLKFQLVDPESIVERIGEESSPVPDHDAALTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALLGIEVARRLLPGIAHVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSLDRPLRGLKQIVLHLGNG-CSASAIAGTRPLDTSMGLTPLEGLVRSGDIDPSVVMGVDDVESMLNHRSGVVGLSGVRDFRAQLAYSVFTHRLRKYIGALAVLGHTDVISFTAGIGENDAAVR----------------RDAVSGMEELGIVLDERRNLPGAKGARQISADDSPITVLVVPTNEELA........ 381
20 -10.8004dq8_A mol:protein length:391 Acetate kinase  ali model follow..  15  12RVVLVLNSGSSSLKFQLVEPDSNIERIGEESSSVPDHDAALSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSLGKPIGDLNQIVLHLGNG-ASASAVAGGRPVETSMGLTPLEGLVRSGDLDPGVILGVDEIESMLNHRSGMLGLAGERDFRAELAYDVFIHRLRKYVGALAVLGHTDVVSFTAGIGEHDAAVR----------------RDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELA........ 380
21 -10.8002yhw_A mol:protein length:343 BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-EPIMER  ali model follow..  14  24LSALAVDLGGTNLRVAIVSKGEIVKKYTQFNPK---TYEERINLILQMCVEAAAEAVGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSD--TLHLPVWV-----------------------DNDGNCAALAERKFGQGKGLE--NFVTLITGTGIGGGIIH-QHELIHGSSFCAAELGHLSHGCIEALLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALVVVSDLVDPALLGAASMV............................................. 330
22 -10.7004ijn_A mol:protein length:398 Acetate kinase  ali model follow..  14  17VTVLVVNSGSSSLKYAVVRSGEFLADGIIEEPDHDAALRAAFDELAAAGLRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLPHIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSLDRPLESLNQIVLHLGNG-ASASAVAGGKAVDTSMGLTPMEGLVRSGDIDPGVIMSVDDIESMLNRRSGVLGLGGASDFRAKLAYDVYIHRLRKYIGAMAVLGRTDVISFTAGVGENVPPVR----------------RDALAGLGGLGIEIDDALNSAKSDEPRLISTPDSRVTVLVVPTNEELA........ 383
23 -10.7003khy_A mol:protein length:384 Propionate kinase  ali model follow..  16  2SEILVLNCGSSSVKFALINPHTSQSLVTGLAENIATKNCKVLEKIVAIGHRVVHGGQYFSKSVLINADSLEKIKACIALAPLHNPAHIEGIRFCQQIFPELPQVAVFDTAFHQTMPSYIAEYAIPYELTHKHNIRKYGAHGTSHKLTQQKANVIVAHLGNG-CSITAVVDGKSIDTSMGLTPLDGLVRSGCIDPSIFWSVTEITNMLNKQSGLLGICGHNDMRAKLAIEIFSHRVAKFVASYMIFNKLDALVFTGGIGENAANIRKNIISKLANL-GFMIDHQKNSNSETFINSKNSHNIMVIATNEELMIAQETQ..................... 381
24 -10.7003mcp_A mol:protein length:366 Glucokinase  ali model follow..  10.IVMTLDAGGTNFVFSAIQGGKEIADPPACADCLDKCLGNLVEGFKAIQAGLPEAPVAISFAFPGPADYQAGIIGDLPNFPSFRGGVALGPFLED--IFGIPVFI-------------NDGSLFAYGEALTGVLPEINRRLREAGSTKRYKNLLGVTLGTGFGAGVVI-DGELLRGDNAAGGYVWCLRNKK-ESVSIRAVMRVYAERSGDAGAEGIRPGNREAAIAAFEELGEMAGDALASAITLID-GLIVIGGGLSGAILPVLLKEMNAQTGMMDGARFGRLQKEVYDLDEEKS-GFARGEAVEVLVPGTNRK----VGYDPCKRIGVTFSKQG. 347
25 -10.6004eht_A mol:protein length:276 Activator of 2-hydroxyisocaproyl-CoA dehydrat  ali model follow..  13  1MYTMGLDIGSTASKGVILKNGEDIVASETISSGTTGPSRVLEKLYGKTGLAKKVVVTGYGRMNYSDADKQISELSC--------HARGVNFIIPETR--------------------------------------------------------TIIDIGGQDAKVLKLNNGRLLNFLMNDKCAAGTSELGSISMNSQNEVSISSTCTVFAESEVISHLSENAKIEDIVAGIHTSVAKRVSSLVKRIGVRNVVMVGGVARNSIVRAMAREINTEIIVPDIPQLTGALGAALYAFDEAKESQKEVKNISAWSHPQ........................ 273
26 -10.3003js6_A mol:protein length:355 Uncharacterized ParM protein  ali model follow..  4VYVMALDFGNGFVKGKINDEKFVIPSRIGRKTNENNQLKGFVDNKLDVSEFIINGNNDFGNDLDKTTNTGKDTASTNDRYDIKSFECSIGLLAREVPEEVVNVVIATGMPSNEIGTDKQAKFEKLLNKSRLITLLDLNMENGKVFKAFTEGKYSVLDFGSGTTIIDTYQNMKRVE-----------EESFVINKGTIDFYKRIASEKGLEYKQCKLNQKTVIDFKDEFYKEQDSLIEEVMSNFEINSIDRIIVTGG-GANIHFDSLSHYYSDVFEKADDSQFSNVRGYEKLGELLKNKVEQE................................... 344
27 -10.2001iv0_A mol:protein length:98 hypothetical protein  ali model follow..  16  1MRVGALDVGEARIGLAVGEEGVPLASGYLVRKTLEEDVEALLDFVRREGLGKLV----VGLPLR-------------TDLKESAQAGKVLPLVEALRARGVEVELWD...................................................................................................................................................................................................................................... 92
28 -10.1004h0o_A mol:protein length:404 Acetate kinase  ali model follow..  11  8SNVLIFNVGSSSLTYKVFCSDNIVCSGKSNRVNVTGTEKLIIQFLKENHISIAFVGHRF---VHGGSYFKKSAVIDEVVLKELKECLPLAPIHNPSSFGVIEISELPTTRQYVAIDTAFHSTISQAERTYAIPQPYYVINSLKNVIDVSHSKIIACHLGTGGSSCCGIVNGKSFDGNSTLAGLVMSTRCGDIDPTIPVGIEKVVDILNKKSGLLGVSELSSKTCQLAFDVYIKQLAKTIGGMVEIGGLDLLVFTDQMGLEQVRKAICDKMKFLGIELDDSLNEKSMGKKIEFLTMPSSKVQVCVEELVILQKGKELFQF.................. 398
29 -9.9104xh1_A mol:protein length:416 Propionate kinase  ali model follow..  14  13PVVLVINCGSSSIKFSVLDVAT--KPINLAHSNYEDALKAIAFELEKRDLTDSVALIGHRI-AHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAALFPAVRQVQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSLDLDEKDSGLIVAHLGNG-ASICAVRNGQSVDTSMGMTPLEGLMRSGDVDFGAMQTLSDLERVVNKESGLLGISGLSHERARLAIKTFVHRIARHIAGHAALHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSHGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA.......... 405
30 -9.8604h0p_A mol:protein length:438 acetate kinase  ali model follow..  12  6EYLLAINCGSSSIKGKLFASFELLANLAVTNIRYASLVPILLDHLTNSTHVKKEEIKYVCHRVVHGGMHDKGIRVVKGHEEGLMEMDKLSEFAPLHNHRAVLAVALPHHTSLLLFDTIFHRTIAPEGLSYASIVQSLAEH---LKKPSDQINVVVAHLGSG-SSSCCIKNGKSIDGLTPLEGLLGGTRSGTIDPTAIFTVSKAEIILNKNSGFKALAGTTNEKAKLTYAVFLDRLLNFVAQYLFIESIDGLVFSGGIGEKELRRDVLKKLAWLGAEVDEEANNSNSGGAVKCITKEGSKLKGWVEEGWMARMAKEEFGFLE................ 432
31 -9.7301z6r_A mol:protein length:406 Mlc protein  ali model follow..  87..YLSLRISRGEIFLALRDSSKLVVEESQELA--LKDDLPLLDRIISHIDQFFIRHQKKLERLTSI-------------------AITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVIT---DGHLLHAGSSSLVEIGHTNHGCLETIASVDSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKPVISDSIRQQAHISVESTQFSNQGTMAGAALVKDAMYNGS...................................... 398
32 -9.6204a61_A mol:protein length:326 PLASMID SEGREGATION PROTEIN PARM  ali model follow..  10  1.MLVFIDDGSTNIKLQWQESDGTIKQHISPNSFKREWAVSFGDNYTLNGEQYSFDPISPDAVVTTNIAWQYSDVNVVAVHHALLTSGLPVSEVDIVCTLPLTEYYDRNNQPNTENIERKKANFRKLNGGDTFTIKDVKVMPESIPAGYERDSLLIIDLGGTTLDISQVMGKLSGISKIYGDSSLGVSLKDALSLARTKGSSYLADDIIIHRKDNNYLKQRINDETEAMNEALRKLEQRVLNLNEFSGYTHVMVIGG-GAELICDAVKKHTQIRFFKTNNSQYDLVNGMYLIGN............................................ 320
33 -9.1602qm1_A mol:protein length:326 Glucokinase  ali model follow..  14  8..IIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNMKKEDFVGI-------------------GMGTPGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGENNP--DVIFITLGTGVGGGIVA-AGKLLHGVAGCAGEVGHVKRGCLETQAIDDGQDVSSKDVFEF-----AEKGDHFALMVVDRVCFYLGLATGNLGNTLNPDSVVIGGGVSASRVEKYFQEFTSTKIKLAELGNEAGVIGAASLA............................................. 319
34 -9.1304ija_A mol:protein length:397 XylR protein  ali model follow..  10  90..FISLDLTYSSVEVMYNYDGNVIKHESYDLPD--EKVSSILSIIKKH-------------------------IDIQEKLDTYNGLLGVSVSIHGVVDNEQHVTYLPFHETEGISIAKKIKEITNVPVVVENEANLSALYERNFNHNLSYNNLIALSIHKGIGAGLII-NNQLYRGANGEAGEIGKTLVHKIEDALLHNLSNQLNEKMTLSKLIQFYNEKNPVVVEEMEQFINKIAVLIHNLNTQFNPNAIYINCPLFNEAIKNQFKQYSEIQIKLTSNVKFATLLGGTLAI............................................. 375
35 -9.0103vgk_A mol:protein length:321 Glucokinase  ali model follow..  14  3.LTIGVDIGGTKIAAGVVDEGRILSTFKVATPP---TAEGIVDAICAAVAGASEGHDVEAVGIGAAGYVDDKRATVLFAPNIDWRHEPLKDKVEQ--RVGLPVVV-----------------------ENDANAAAWGEYRFGAGQGHD--DVICITLGTGLGGGIII-GNKLRRGRFGVAAEFGHISQGCWEAAVLLGLGDGSVDGIEGKHISEAARQGDPVAVDSFRELARWAGAGLADLASLFDPSAFIVGGGVSDDPIRKSFRRWLHAQVLAAQLGGKAGLVGAADLAR............................................ 311
36 -9.0103h1q_A mol:protein length:272 Ethanolamine utilization protein EutJ  ali model follow..  11  30..KVGVDLGTADIVLVVTDQEGIPVAGALKWASVVKD--------------------GLVVDYIGAIQIVRELKAKVERLLGSELFQA--------------ATAIP-----PGTVGRNAEACGHVVAGAGLELVTLVDEPVAAARALGINDGIVVDIGGGTTGIAVIEKGKITATFDEPTG-------GT---HLSLVLAGSYKIPFEEAETIKKDFSRHREIMRVVRPVIEKMALIVKEIKNYDQTLPVYVVGGTA-TGFSEEFSRFLGKEVQVPIHPLLVTPLGIALFG............................................. 272

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.