current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [S] COG4894 Uncharacterized conserved protein, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MEVLMKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYDAAGEQVSEISKEILTLLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNLGLRIEGNIWDLNFKLLDDRDQLIAEIKKELFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSHLast
1 -92.700[S] COG4894 Uncharacterized conserved protein  ali  100  1MEVLMKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYDAAGEQVSEISKEILTLLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNLGLRIEGNIWDLNFKLLDDRDQLIAEIKKELFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSH 165
2 -24.100[M] KOG0621 Phospholipid scramblase  ali follow..  16  90....TNSLMVVQCIFETPNRYVVHDMYCRPLLYCMERSNVFARGMQIMDTHGAQVMTCFRGRPCCSCDDFLSTQFLDQQIGMMKRECCNPNFELIGSGLLIQSCGGTQKFPVMTYNGALVGEIVRLYFTDADTYIVHFPMDMPKLLLVTSVFLIDFTYFEDRNQD 286
3 -6.380[S] COG4116 Uncharacterized protein conserved in bacteria  ali follow..  5IEIEFKNMLTKQEFKNIASALQLTEKD-KNHYF-SFALKQKHAALRIRRKNGKYVLTLKEPLLETHQQLSEVSDLAGFSVPEGPVKDQLHKLQIDTDAIQYFGSLATNRAEKETEKGLIV--LDHSRYLNKEDYEIEFEAADWHEGRQAFEKLLQQFSIPQRET. 175
4 -5.770[M] COG1462 Uncharacterized protein involved in formation of curli polymers  ali follow..  14  72................................................DRLGGQAKTILITHLQQTNRFNV-LDRDNMSEIQQEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNIVNISTSEVVYSTQG............. 174
5 -5.620[O] COG2077 Peroxiredoxin  ali follow..  12  1....MSKITLAGTEIEVSGVFPQVGDVVTDFTTVSAKL----EDTTLANFAG------KRKILNIFPSIDTGICATSVRKFNEQAAKLANTAVL------LSTDFAQARFCGAEGLENVFTVSTFRNKDVHKQLGVDIVEGPLAGLTARAVIVLDE......... 139
6 -5.170[G] COG4211 ABC-type glucose/galactose transport system, permease component  ali follow..  15  207...........................GKNIFAIGGN--------EAARVSGVNVARNLVVIYMIAGMFYGFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGV-----SFAGGVGTVIGVVTGVIIFTVINYGLTYWQYIIKGSIIILAVAIDSLKYAKKK.. 336
7 -4.640[Q] COG1021 Peptide arylation enzymes  ali follow..  16  329...........QQVFGMAENYTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPMTRGPYTFRGYFNSPLHNASAFDANGFYCSGDLISIDQDGYITVHGREKD----QINRGGEKIAEIENLLLRHPVVIHAALVSMEDELLGEKSCAYL........... 478
8 -4.330[S] COG4918 Uncharacterized protein conserved in bacteria  ali follow..  10  64IDSEFGPIYYKDGSYFFQDEMSTKINPSYNLIELRSTAELLSPNLLIVDFRGKQKAS............................................................................................................ 121
9 -4.200[Z] KOG0532 Leucine-rich repeat (LRR) protein, contains calponin homology domain  ali follow..  10  110LNLYQNCIRYIPEAILNLQALTFLNISRNQLSTLPVHLCNL--PLKVLIASNNKLVSLPEEIGHLRHLMELDVSCNEIQTIPSQIGNLEALRDLNVRRNHLVHELAELPLIRLDFSCNKITTIPVCYRNLRHLQTITLDNNPLQSPPAQI............... 260
10 -4.130[S] COG1692 Uncharacterized protein conserved in bacteria  ali follow..  12  56LDAGAQAVTLGNHSWDNREIFEFIDQAPALVRPINYPEGTPGQGYTFIKVNAIEVAVVNVMGRTFMSPNDFQAMDTALDDIRKRTPFIFVDMHGEATSEKQAGWYLDGRVSAIIGTHTHVQTADERILPKGTAYLSDVGMTGPYDGVLGM............... 208

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 6 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.