current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [S] COG4075 Uncharacterized conserved protein, homolog of nitrogen regulatory protein PII, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MIHLQHTPPAVTALMIPAVLSCWSLHPHQIYYLHSTYLCMVILMKVHLRVFIEVENLGRVMNILADEGVTGFYIVEYKGVSPTEWKGFSVKEDPESAISLIHDYARDAVLICSVVDEELVEPIVNRFGEELASEKYTIIEIPIRRIIVNSPLast
1 -104.000[S] COG4075 Uncharacterized conserved protein, homolog of nitrogen regulatory protein PII  ali  100  1MIHLQHTPPAVTALMIPAVLSCWSLHPHQIYYLHSTYLCMVILMKVHLRVFIEVENLGRVMNILADEGVTGFYIVEYKGVSPTEWKGFSVKEDPESAISLIHDYARDAVLICSVVDEELVEPIVNRFGEELASEKYTIIEIPIRRIIVNSP 151
2 -7.100[R] COG3093 Plasmid maintenance system antidote protein  ali follow..  9........................VSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWDTRNRYQEEAKF............................................ 91
3 -6.390[S] KOG2990 C2C2-type Zn-finger protein  ali follow..  15  9....KYYPPDFNPEKHGSLNRYHNSHPERARKLSQGILIIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDMADNEQVLTTEHEKKQKLETDAMFRLE........... 150
4 -6.250[S] COG5410 Uncharacterized protein conserved in bacteria  ali follow..  17  63...VINVPPG-KTELVAINVMARGLNPYARFLHISYSDDLALLNSETAREIVQSDKAGGVYAVSLGGQVTGF-----AGHMAPGWQGAIIIDDPLKVEDAYSKTGRSKANIIVIMQRLAQDDPTGFIQSGGFPGAWECIEIPAL....... 246
5 -6.080[E] COG0347 Nitrogen regulatory protein PII  ali follow..  20  3..............................................LIMAIIKPFKLDEVREALSQVGVSGITVTEVKGFGRQKGHT-ELYRGAEYIVDFLPK-----VKIEVAVPDDVLERAVEAIEKSARTGK................ 85
6 -5.790[D] KOG4660 Protein Mei2, essential for commitment to meiosis, and related proteins  ali follow..  16  669.LIIKNIPNKYTYKMLVAEIDEKHKGDYDFLCLPTD--------------FKNKCNMGHAINMVSPLHIVPF----QQTFNGKIWEKFNSGKVASLAYAEIQ--GKSALA-PSSMKEQK................................ 771
7 -5.630[R] KOG2945 Predicted RNA-binding protein  ali follow..  10  1...MQLAEKHIVALMFPAIVSTFTF----VSGVKFYIMDNSGNNRYEL-LFMDDDDSSGLAQPQIAAVVAAPKKPEPAKAPKAPKSKSEKENKPVVAARKANAPVAKNASPVKGGKGPAGGDVGRPKNPTANGAN................ 128
8 -5.380[O] KOG0960 Mitochondrial processing peptidase, beta subunit, and related enzymes (insulinase superfamily)  ali follow..  21  9............................................RSQTDLELEVENLGAHLNAYTSREQTVFYAK-------------CLSKDVPKAVEILADIIQNSKLGEAEIARERSVILREM......................... 77
9 -5.350[V] COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases  ali follow..  11  258........................MRSYQIQATHTTGSGKTVTSFKVAQLLASAPRIKNVLFIVDRIDLIDQTLENFKSFAYAHFKNRIKKVNGRELKRELKRKGSSQILLISV------QGLTKAVKKGLENDDWNVIIMD......... 393
10 -5.330[C] KOG0768 Mitochondrial carrier protein PET8  ali follow..  18  212..........PTAGAMGNIISSAIMVP-------------KELITQRMQAGASGRSYQVLLKILEKDGILGLY----AGYSAT-----LLRNLPAGVLSYSSFEYLKAAVLEKT-KQSHLEPLQSVCCGALAGAISASITTPLDVVKTR.. 327

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.