current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [G] COG3925 N-terminal domain of the phosphotransferase system fructose-specific component IIB, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MKTLLIIDANLGQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGKNVWLGDISRAVAHPELFLSEAKGHAKPYTAPVAATAPVAASGPLast
1 -65.400[G] COG3925 N-terminal domain of the phosphotransferase system fructose-specific component IIB  ali  100  1MKTLLIIDANLGQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGKNVWLGDISRAVAHPELFLSEAKGHAKPYTAPVAATAPVAASGP 103
2 -44.200[G] COG1445 Phosphotransferase system fructose-specific component IIB  ali follow..  16  5.FIVAVTACPTGIAHTYMAEEALKKQAAEMGVAIKEDIQRAKGVIVAADKAVEMDRFDGKQFIARPVADGIKKSQELISLILNEGNTYHAKNGKSETAVSTE. 121
3 -13.600[G] COG3414 Phosphotransferase system, galactitol-specific IIB component  ali follow..  14  1MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNLSGADIIIASTHIAGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKE................... 94
4 -9.020[R] COG4551 Predicted protein tyrosine phosphatase  ali follow..  22  1MRALFI--CSRNRLRSPTAESIFAHDTDSAGLATADQLEWAEVIFVMERSHRRRPWLRGKRVVCLDIPDDYLFMQPELVALLERR.................. 100
5 -8.850[G] COG1440 Phosphotransferase system cellobiose-specific component IIB  ali follow..  18  2KNILLI--CGSGASSGFMAAA-IRKAAKKRGEQIDERINEIDYLLIGPHLAYMLDDLKDVLVSVIPQATGTLNGEKALDLILN.................... 98
6 -6.990[K] COG3711 Transcriptional antiterminator  ali follow..  12  400.KIKAIIVCTQGTSVSQMMLYELRNLFPEIIFTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRK.............................. 478
7 -6.710[CH] COG4635 Flavodoxin  ali follow..  12  1MKTLILFSTRDG--QTREIASYLASELKELGIQAEPQWENYDRVVIGASIRYGHYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNS....... 103
8 -6.260[P] COG1226 Kef-type K+ transport systems, predicted NAD-binding component  ali follow..  12  151......................IRGHAADDGTLKRANITEAESVMITADQYKSETDADMLSVLTLLSVKGLNPLAYCIVEILTDRFVTNAERAGANQ...... 225
9 -5.780[E] COG4810 Ethanolamine utilization protein  ali follow..  13  28ERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGTLTPGETAMIAGDLALKAARFSGALVIYGSVGAVEEALSQTVS........................ 119
10 -5.620[O] COG3526 Uncharacterized protein conserved in bacteria  ali follow..  17  7VTILYCTQCNWLLRAGWMAQELLSTFADTLG----------EVALIPGTGGNFEIRVDGALIWERKRDGGFPGPKELKQRIRD.................... 79

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.