current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [S] COG3870 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVDDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLast
1 -74.000[S] COG3870 Uncharacterized protein conserved in bacteria  ali  100  1MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVDDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHF 109
2 -12.400[E] COG0347 Nitrogen regulatory protein PII  ali follow..  23  1MKLIMAIIKPFKLDEVREALSQVGVSGITVTEVKGF-QKGHTELYRGAE---------IVDFLPKVKIEVAVPDDVLERAVEAIEKSARTGKIGDGKIFVTDVEQVIRI 102
3 -7.310[S] COG4843 Uncharacterized protein conserved in bacteria  ali follow..  17  96..ITVNVITKEYEPDIPNTLRDKGYGVTNWVAYGRE--GERLMMEILTSRKSEADLYATIKK............................................... 153
4 -6.210[R] COG4287 PhoPQ-activated pathogenicity-related protein  ali follow..  20  214IPMVTAISQAMRL--AKKELTQ--WNINSFIITGI--KRGWTTWLSAIADPDVEAIVPFAIDLLDIDASL....................................... 278
5 -6.050[S] COG4739 Uncharacterized protein containing a ferredoxin domain  ali follow..  10  36..IEIVYVDGEEMEKIAAKMEEMAEGGDKFIRDAESVRKSQAILLIGAKGDRTVGV-----ESCSEFKKADRKGENFVGPNCAFRMIDLGIALGSAV............ 133
6 -5.450[K] COG2865 Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen  ali follow..  11  3...VSDLIKKGESETIE----KRELNDSVYKTLSAFANTDGGILLLGVSNDGFSGDLDSLARSIRHNLRINPPIKV--------------EEIGEKKVVIIDVSK.... 91
7 -5.370[S] COG4803 Predicted membrane protein  ali follow..  15  118...LIGVALGAASGAIGGALSDVGINDNFMKELARGLQPGNAALFVLVKEMTEDKVLKDISP............................................... 176
8 -5.310[L] KOG3069 Peroxisomal NUDIX hydrolase  ali follow..  16  36..VLVCLYQEQREDKLTKRSTTLSSHPGEVALPGGKRDQEDKDDIIGLDPSLVT-IISVLEPFVNKKGMSVAPVIGFLHDKKAFKQLPNPAEV--EEIFDVPLEMFLK. 154
9 -5.100[T] COG5212 Low-affinity cAMP phosphodiesterase  ali follow..  17  1MHAALEIKEAEFQTDQVVGLVENSFTLYSLGQNGGPLESCCSSHLISDGAFQEIISLD................................................... 58
10 -5.070[S] COG1284 Uncharacterized conserved protein  ali follow..  17  207....FQIITTQPELMVETIRDQLGRSATYKEAYGGFSHEKFKEITCVINRLEETKLKEIIND............................................... 264

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.