current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: [S] COG3323 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst PTYTDPLKKLAVYVPKEYEEQVRAALGNAGAGHIGEYSHCAFSSEGIGSFKPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIKSHPYEEVAYDIYPVEQTPLast
1 -80.800[S] COG3323 Uncharacterized protein conserved in bacteria  ali  100  1PTYTDPLKKLAVYVPKEYEEQVRAALGNAGAGHIGEYSHCAFSSEGIGSFKPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIKSHPYEEVAYDIYPVEQTP 110
2 -25.200[R] KOG4131 Ngg1-interacting factor 3 protein NIF3L1  ali follow..  12  130........SKAPNYPTEGNHRVE-----FNVNYTQDLDKVMSAVKGIDGV----SVTSFSARTGNEE---QTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPL. 218
3 -10.600[E] COG0347 Nitrogen regulatory protein PII  ali follow..  21  1......MKLIMAIIKPFKLDEVREALSQVGVSGI-----TVTEVKGFG--RQKGHTELYRGAEYIVDFLPKVKIEVAVPDDVLERAVEAIEKS................. 80
4 -9.670[P] COG1324 Uncharacterized protein involved in tolerance to divalent cations  ali follow..  20  43..............................................................NEQVEEQNEIALLVKTDSSRLDEIIKAVKSLHTYDLPAIEFWEIEGEQ 90
5 -7.060[J] COG0081 Ribosomal protein L1  ali follow..  21  53PRHADQMVRGAVVLPHGTGKKVRVAVFNAGADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPK---LMPNPKTGTVTMDIAKA................. 153
6 -6.560[S] COG1844 Uncharacterized protein conserved in archaea  ali follow..  12  1......MLNTIVLIRTDNFDKALTALSDL--------RYGGMKIRGKPRIIPPALSDWAFEQIVGEKPRKKVRAHVVAQDLPASKAIGRIRDIHPPAHIV.......... 88
7 -6.260[C] KOG1626 Inorganic pyrophosphatase/Nucleosome remodeling factor, subunit NURF38  ali follow..  20  337PRDWALFTHMLWYAPPFEEIKV-----------FASHRLCSWSAEDSADVIPNMGSEPHLAQREMLKQDEGTKLEGSL--------LAAMPEKRPFERLPADVSPIN... 432
8 -6.130[O] KOG2018 Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis  ali follow..  16  106...REQLARNYAFFGEDGMERLRNSVIVVGCGGVGSWVINMLARSGVQKIRIVDFDQVSLSSLNRLQDVGTPKTLAI----------KAIKKFAPWIEV........... 198
9 -5.730[H] COG0113 Delta-aminolevulinic acid dehydratase  ali follow..  23  163...........IIAPSNMMDAIRAGLDSAGFTDVPVMSYAVYASAFYGPFRDAAHSSPVFGDANRLEALREARSDVVKPALSYLDIIREVKNETGLPVVAYNV....... 275
10 -5.730[C] COG3262 Ni,Fe-hydrogenase III component G  ali follow..  10  35........QVTITVKINLLPDVVQYLYYQHDGWLPVL---------FGNDERTLNGHYAVYYALSMEGAEKCWIVVKALVDADSREFPSVTPRVPGEREIRDMYGL.... 127

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.