current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: [E] COG0404 Glycine cleavage system T protein (aminomethyltransferase), from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst TALHAWHVKNGAEFEDVGQWKRPWYFPRRGEDMHAAVARECRAVREAVGLLDASTLGKIDIQGPDAREFLNRVYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACLADNHFVMTTTTGGAARVLEWLELYHQTEWPELKVYFTSVTDHYATLTLSGPNSRKLLAEVTDIDLDKDAFPFMTWKEGKVAGVPARVFRISFTGELSYEVNVQADYAMGVLEALAEHGAKYGLTPYGTETMHVLRAEKGFIIVGQDTDASVTPDDLNMGWAVGRSKPFSWIGWRGMNRADCLREDRKQLVGLRPSNPQEVLPEGAQLVFDTQQAIPMKMVGHVTSSYMSASLGHGFALAVVKGGLKRMGQKVYAPLADGRFIEAEICSSVFYDPKGERQNVDLast
1 -144.000[E] COG0404 Glycine cleavage system T protein (aminomethyltransferase)  ali  100  1TALHAWHVKNGAEFEDVGQWKRPWYFPRRGEDMHAAVARECRAVREAVGLLDASTLGKIDIQGPDAREFLNRVYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACLADNHFVMTTTTGGAARVLEWLELYHQTEWPELKVYFTSVTDHYATLTLSGPNSRKLLAEVTDIDLDKDAFPFMTWKEGKVAGVPARVFRISFTGELSYEVNVQADYAMGVLEALAEHGAKYGLTPYGTETMHVLRAEKGFIIVGQDTDASVTPDDLNMGWAVGRSKPFSWIGWRGMNRADCLREDRKQLVGLRPSNPQEVLPEGAQLVFDTQQAIPMKMVGHVTSSYMSASLGHGFALAVVKGGLKRMGQKVYAPLADGRFIEAEICSSVFYDPKGERQNVD 389
2 -61.800[E] KOG2770 Aminomethyl transferase  ali follow..  22  39TALYDFHVAHGGKMVPFAGWSMPIQYK-------DSIMDSTVNCRENGSLFDVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVTDEHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVSWHIHDERSLLALQGPLAAPVLQHLTKEDLSK--LYFGNFQILDINGSTCFLTRTGYTGEDGFEISVPDEHAVDLAKAILEKSEG-KVRLTGLGARDSLRLEAGLCLYGNDMEQHISPVEAGLTWAIGKRREGGFLGADVILQQLKDGPTIRR-VGFFSSGPP--ARSHSEVHDESGNK-----IGEITSGGFSPNLKKNIAMGYVKSGQHKTGTKVKILVR-GKPYEGSITKMPFVATKYYK.... 406
3 -58.400[E] KOG2844 Dimethylglycine dehydrogenase precursor  ali follow..  24  463APIYHQLRDAGAVFGEIMGYERPLWFEKTPKEWFERVASEYEACRERVGLMDMSSFSKYDITGEDAVEYLQFLCSANVDE-PIGTTVYTGMQHQKGGYVTDCTLSRLGEKKFFMVAPTIQQERVLVWMKKWQAIL--KARVHVQDVTGAYTALDLIGPSSRYLMGDITGLSMSSNDFPTFRCQEINIGMATIRAISVTHCGELGWVIYVPNEVAQNVYEKILDAGKEYSLQHAGYYTLRQLRIEKFYVYWGQDINATVTPVECGRLFRVDFKK--DFIGKKALEEQVERGVSK-RFVQLLVDGHDKPWPQGGETILKDGR-----AVGLTTSAAYGFTLGCQVCIGYVENKEFGVSGHFEIDIA-GKRFTCRLNVHSPSLPMISSEH.. 864
4 -29.900[E] COG4583 Sarcosine oxidase gamma subunit  ali follow..  11  2.............................SDPKTDFKSGFRPALRPVLGAKAAIASAAIKLSPLPEGAIVHVL-----------ASPDASDMEARLRSLGKGDVRAVSPGQWFIVGEQPLSGVDMKTLLAALEP-----QAAGVDQSQGRVRIRIEGKMTERVLAKGTAVNLSLATFPVGRSAATLIGHIAAHITRI---DISAFEIIVLRGFAESLWDDLVRMSLEFN................................................................................................................................................................ 182
5 -21.800[R] COG0354 Predicted aminomethyltransferase related to GcvT  ali follow..  17  1...........................................MMTASKTVNLSYRALVHITGEEAEKFLQAVITTNLDQLGPHELKPGALLTPQGKILFDFLVSR-IEGGLRFDLPADVAGDFVKRITLYR-----RAKAEIVQVPESLVSVCWQGD--------------SPASDNDSIKRDSRFPAQLNVLRLYHQASANA-----------------------------GLDAWVQLRAEYGIAEGEADFAGDVFPHDVNFDQTVSFPK---FIGQEVVSRMQHRGTTRRRVLIARSDVP---LPPMGTPITVEGRE-----IGAMGSSA------SQIGLALVRIDRVKDAMDTGNSILAGDAAITLSLPP............. 273
6 -17.600[K] KOG2929 Transcription factor, component of CCR4 transcriptional complex  ali follow..  13  22.......................................HSGLEDAGPMASRLKSRSVVRFSGPDTVKFLQGLLTNDVRRFGESSGEYAALLTPQGRFLYDFFLYSPSRPDEKLDRTGSGPGSD-------------------GRDGSVELFADVDVDVLDELLETLK----------YRLRSKVDIENVAEEFS-QRYGRNLTGSSSVGWGGGVDRAAPLVEADKETDESNY-----LLWRLEHGVAEGSAEIPGEAIPLEYNFVGLISFDK---YVGQELIARTHHRGVIRKRLIPLRFIDSNQKIAAGAEVVESGTG----KKMGTVSTAL------GSRGMGVMR........................................ 315
7 -12.500[A] KOG3322 Ribonucleases P/MRP protein subunit  ali follow..  14  179.PTHLWVCKR-AHMINAWGYAIPE---KPTEKSYRPTHR--AAFRKDAIAFDMSYEPLFCISGPYEAEKFGNSFANGLPVFLNSSRSFTSYLVKSD-KKQIPVKNPTECVQLVIRLHPSAFLQAWNYLSGIAVL---DDRIAMHDWRLDLASFDIHGPDSNIMLHKVFDVELDEAGKVWQSISNYSSACLPM-VYITYRKEWNGLTVILPWDYAKFVWRKMMYQK---GIRFGGLENLHQIAFEKRMPFFPIDYPDTISGQLCEEERKKRNEDSWK-FGDNFSEIGNPFCCDWVYLNEMVKASRDEDKTLQLVRVLYPKCPNETAIIGFVTTGNFNLNAGKPSGIANVLAKTIKNEKSGYCIIRNVGCSVPRLAQWKFNQSH....... 698
8 -5.670[E] COG2716 Glycine cleavage system regulatory protein  ali follow..  12  33..........................................................ITALGADRPGIVNTITR---------------HVSSCGCNIEDSRLAMLG-EEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVPPMPASVWVQVDVADSPHLIERFTA---------LFDAHHMNIAELVSRTQPAENERAAQLHIQITAHSPANIEQAFKALCTELNA............................................................................................................................................................... 193
9 -5.630[S] COG5551 Uncharacterized conserved protein  ali follow..  14  143.......................................................................................................................................YPSPQRMAYSLAKAYKELF-IKPIADRAPTALEIVGMRTKAVRVNIGDSRLVPA---------FLGRAQLAVFGNVD----AWLSLLKLGESVGVRAIGFGKYKIEEVVLH............................................................................................................................................... 245
10 -4.570[T] COG3830 ACT domain-containing protein  ali follow..  10  32..........................................................ITVSGKDRPGVTAAFFR---------------VLSANQVQVLDVEQSMFRGF-AFVGIAPERVETVTTGLTDTLKVHGQSVVVELQETRSSHVVVVLGDPVDALDISRIGQT---------LADYDANIDTIRGISDYPVTGLELKVTVPDVSPGGEAMRKALAALTSELNV-DIAIERSGLLR................................................................................................................................................... 200

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 6 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.