current user: public




Query: [N] KOG4794 Thymosin beta, from COG0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst MCLWSLEQDQCSGSNFYNDERLPQLKACFLIIPCPNPAVRFPDCSVPTSFSREHCRPIHIFRENKGRGKVGNEDGERTKFDLCNSRGQISEDRKNVRENQPVFSVEVKFDRSKLKKTNTGEKNRLSSKETIQQEKYGPSFRSQKAEEKLPQGGASGRADPGDLTLRRLERRIHTTQLFAAGTRRPAGDPALEKRQRRGLASWRGARTTRARLAAPASLPRKQGAPRCARGFPGPAFQSLSGFRPTPAPLRAEMLast
1 5.000e-42gi|642913910|ref|XP_008201210.1| PREDICTED: uncharacterized protein LOC663390 isoform X1 [Tribolium castaneum]  clstr ali  18  7...............APALKDLPRVAGD-----LKSELEGFKPTNLKNADTQEKIVLPSAEERTHNALIAGVENFKSSSLKRTDTREKNAQDVAAEKTEKALIAGIEHFDPSKLKHTETQEKNPLPDKDVVLQEKNHLNLKHTTTAEKIVLPDNEVEQEKGQRQLISGIENFDSSKLKHAETCEKNPLPTKEIIDQEKSA..................................................... 207
2 2.000e-41gi|817068427|ref|XP_012256151.1| PREDICTED: uncharacterized protein LOC105686113 isoform X1 [Athalia rosae]  clstr ali  17  6...............SPSLKDLPKVALD-----LKSELEGFNHGCMKKAATAEKNVLPSAEERQHCELIHGVENFNTDRLKHIDTVEKNAQDVAAEKTQQTLIQGIEEFDPAKLKHTETQEKYHLPDKDAVKAEKQHQNLRHAETLEKNLLPDPQAIQEKGKQQLISGIENFDPAKLKHAETLEKNPLPTKEAIDAEKVAA.................................................... 207
3 2.000e-39gi|546681029|gb|ERL91194.1| hypothetical protein D910_08533 [Dendroctonus ponderosae]  clstr ali  18  15..................LKDLPKVAGD-----LKSELEGFSSSKLKNAETQEKIVLPSAEEKTHNALIAGVENFNSSSLKRTDTKEKNAQDLAAEKTEKALIEGIAKFDPAKLKHTETQEKNPLPDKDAVQQEKTHQNLKHAQTSEKIILPNTEVEQEKAQSNLLSGIENFDSTKLKHAETQEKNPLPTKEVIDQEKSA..................................................... 224
4 4.000e-30gi|585637605|ref|XP_006879031.1| PREDICTED: serine/arginine repetitive matrix protein 3-like [Elephantulus edwardii]  clstr ali  29  1................................................................................................MADKPDMGEIASFDKAKLKKTETQE-NTLPTKETIEQEKRSEMSWDPAVVSALVMCD----------TLVVMWRKSH---LQDGHERRAALKEAAEESRSCGSGARRASAGEGKSQVAAAREPERCGGGACGVRLP..................... 128
5 7.000e-28gi|225547769|gb|ACN93679.1| thypedin [Carukia barnesi]  clstr ali  14  44....SFDHSKLKHVETEEKNPLPKEEMRPESLPDVSEVANFDSGKLKHVETQDKTVLPTKEQEEAADSRAEVKSFDHSKLKHVSPEEKNPLPTPQTLKEEPDISEVKSFDPTKLKHVETEDKSVLPTQEVIKEEAAHGKTETCRNGREKPIPTAKEEMRPETLPDVSEVKGFDAHKLKHVETEEKVVLPTQEVIQQEAVDTRAEVKTFDHDALKHV..................................... 281
6 2.000e-27gi|939694855|ref|XP_014291510.1| PREDICTED: uncharacterized protein LOC106690560 isoform X1 [Halyomorpha halys]  clstr ali  20  62..VETFKQDRLKRTNTTEKIILPDVATEKTQKALLEGVEGFDTGKLKHTETHEKNPLPDMQEKVHQNLISGVEGFDKARMKHTTTQEKNPEAIEAEKGQQKLIEGIENFDPKKLKHTETQEKNPLPTKEAIDQEKSA.................................................................................................................... 207
7 2.000e-25gi|913317106|ref|XP_013189523.1| PREDICTED: uncharacterized protein LOC106134105 isoform X1 [Amyelois transitella]  clstr ali  19  63..VEQFQTSSLRRTDTVEKIVLPTEKTQNLWESLFDGIEKFDASRLKHTEIQEKNPLPDAAEKAHQNLLEGVEHFDKSQMKHATTEEKNPEAIEAEKEKNKFLTGIENFDPTKLKHTETCEKNPLPTKDVIEQEKTA.................................................................................................................... 211
8 3.000e-25gi|562867382|ref|XP_006161809.1| PREDICTED: uncharacterized protein LOC102468557 [Tupaia chinensis]  clstr ali  27  1................................................................................................MSDKSNMAEIEKFDKSKLKKTETQERNLLPSKEMIEQEKQASDHNEKEVESSLNDCAARELLTTEVRLPAVKEKNLHVAQPGDGISRSLDIAPCPEPVGRIGQGNSSEGAEVWNRYSVSARERKNNGTGRWKRCQPG.................... 161
9 6.000e-24gi|939264238|ref|XP_014252113.1| PREDICTED: uncharacterized protein LOC106668146 isoform X1 [Cimex lectularius]  clstr ali  16  7......................................................SPSLKDLPKVAVDLKTQLEGFNTDRMKHTDTEEKNPEDVQQERQRNELIHGVENFNTDKLKRTNTAEKIVLPNAQDVAIEKTQRKLKHTETQEKNPLPDKDAVQEKVHQNLISGVEGFDKRTMKHTETKEMNTLPDPEEAEKGQLNLFKGIENFDTTKLKHTETCEKNPLP............................ 196
10 4.000e-22gi|193652608|ref|XP_001951088.1| PREDICTED: uncharacterized protein LOC100160577 [Acyrthosiphon pisum]  clstr ali  20  20..LEGFNPDNMKKADTNEKIILPTVKRERQHNDLIHGVNNFSADKLKRTDTLEKVILPNAQKAITEALIEGVGGFDTNKLKHTETQEKNPLPIEAEKEQQQLIAGIENFDTAKLKPTVTEEKNPLPTKEVIAEEKKA.................................................................................................................... 169
11 5.000e-21gi|817068431|ref|XP_012256153.1| PREDICTED: uncharacterized protein LOC105686113 isoform X2 [Athalia rosae]  clstr ali  17  6......................................................SPSLKDLPKVALDLKSELEGFNHGCMKKAATAEKNAEDVAAEKTQQTLIQGIEEFDPAKLKHTETQEKYHLPDKDAVKAEKQHQN-------------------------LLNGVESFNKAAMRHAETLEKNLLPDPQAIQEEKQQLISGIENFDPAKLKHAETLEKNPLP............................ 157
12 6.000e-21gi|675386935|gb|KFM79832.1| hypothetical protein X975_14257, partial [Stegodyphus mimosarum]  clstr ali  18  20..LAQFDSSKMKHAETQEKNSLPDVEQEKVHNSIITGVEGFERSKLHRTHTQEKVVLPNAEEKIHQNIVSGVETFDKTALHHTETKEKAVLPIEQEKGHQKLVQGIENFDSSVLKHTETLEKNPLPTKEAIAMEKSAA................................................................................................................... 166
13 2.000e-20gi|301016779|dbj|BAJ11759.1| HsjCib isoform1 [Hodotermopsis sjostedti]  clstr ali  20  57..VESFKTERLKRTNTQEKIVLPDVATEKTQKALLQGVEAFDTGKLKHTETQEKNPLPDKQEKVHQNLLEGVEHFDKATMKPTQTQEKNPEAIEQEKEKQNLIAGIENFDTKKLKHTETQEKNPLPTKEAIDEEKKA.................................................................................................................... 202
14 5.000e-20gi|999988998|gb|KXJ28062.1| Thymosin beta-b [Exaiptasia pallida]  clstr ali  18  166....AFDHSKLKHVETQEKNPLPRQEMMPKNKPDRSEVSEFDHSKLKHVIITEKTILPSDIKAEAIETRAEVKTFDTSKLKHVHTEEKNPLPTAQTLRQKPDRSEVSGFDHSKLKHVETSEKVVLPSKDDIKTEAITSKLKHVETQEKNPLPDAKGEYSP--MLFANLDRTIHRKKXRKAE........................................................................ 363
15 7.000e-20gi|1009529709|ref|XP_015926364.1| PREDICTED: uncharacterized protein LOC107453875 isoform X1 [Parasteatoda tepidariorum]  clstr ali  16  11...............................................PSSLKMSSPSKENLPKVPAPLKDELAQFDSSKMKHTETQEKSKDDVQQEKAHNSILTGVEGFERSRLNSVETQEKVILPNAEDVVQEKIHQN-------------------------MVTSLESFDKAALHHAETKEKAVLPSSEEQEKGHQKLVHGIENFDTSNLKHAETLEKNILPS........................... 170
16 9.000e-20gi|795169268|ref|XP_011798348.1| PREDICTED: uncharacterized protein LOC105512495 [Colobus angolensis palliatus]  clstr ali  78  189....................................................................................................................................QNKIGRA--RQKAEEKRPQGGARDRADPGDLTLGRLEWRIHTAQLFAAGPRRPAGDPALEKRQRCGLASWRGARTTRVRPAAPASLPRKPGAPAWTSGVPG.................... 287
17 3.000e-19gi|913317110|ref|XP_013189525.1| PREDICTED: uncharacterized protein LOC106134105 isoform X2 [Amyelois transitella]  clstr ali  18  9.......................................................PSLKDLPKVATDLKSQLEGFNTSCLKDVDTNEKIAEDVATEKTQESLFDGIEKFDASRLKHTEIQEKNPLPDKDVVAAEKAHQNLLE-------------------------GVEHFDKSQMKHATTEEKNPLPPMEAIEAEKEKNKTGIENFDPTKLKHTETCEKNPLP............................ 162
18 3.000e-19gi|239736194|gb|ACS12897.1| thypedin [Chironex fleckeri]  clstr ali  14  450.....FDTRKLKHVETTEKNVLPKEVIKEEAVDSRAEVKSFDHGKLKHVETEEKNTLPSAMRPEFLPDVSEVKDFNTGKLKHVQTEEKTVLPTKEVINQEALRAEVKTFDHTKLKHVETQEKNVLPTPQVLKEELRQGKLKHVETKEKVTVPSKEVIDEEAKNTMAE-VTKFDKGKLKHADTKEKDKLPTAEDIKNEKSA..................................................... 666
19 4.000e-19gi|391346495|ref|XP_003747508.1| PREDICTED: uncharacterized protein LOC100908890 [Metaseiulus occidentalis]  clstr ali  23  22......................................................NMSAQDLPKVPVEIKDELANFSQDKLKACETKEKIVEDVATEKTHQGLIKGVEGFDQAQLKHAETQEKNVLPTKENIEAEK-------------------------GHNQMVSGIQNFDASQLKHTETAEKNVLPTAEMIQEEKQA..................................................... 146
20 2.000e-18gi|957831583|ref|XP_014665778.1| PREDICTED: uncharacterized protein LOC106807827 [Priapulus caudatus]  clstr ali  12  1.............................................MSGAKRKSKMASMKNAPKPAADIKDELQQFDSKKLTHTQTVEKSAL------THDSIMYGVSHYDKEKLTHTEVQEKVVLPDKEDVAQEKTHMNLLESFDKGSMKHAATQEKTSLPHDSALIGVKGFNKAKLHHADTNEKSVLPMPQEAERSHDKFIKGIEHFDAKQLKQVETQEKNQLP............................ 196
21 2.000e-18gi|262401483|gb|ACY66642.1| thymosin beta [Scylla paramamosain]  clstr ali  21  2.............SAETTLKDLPKVDS-----VLKEQLEGFSQDKLKKTDTAEKTSLPTKEEKQHDKLMHNIEDFRSDKLKRTSTSEKIPEDVAAEKQSQALFNAVEGFDASSLKHTDTKEKVILPAKEDIDAEK-------------------------GQQALCQGIEKFDPSALKKTETTEKNILPTKEVIEAEKKA..................................................... 166
22 4.000e-18gi|321471002|gb|EFX81976.1| hypothetical protein DAPPUDRAFT_230815 [Daphnia pulex]  clstr ali  18  9......................................................TPKLEDLPKVAENLKSQLEHFNTGALKDVETQEKVVLPTAEEMATEKVLKGIEDFDPSVLKHTETQEKVVLPDAEAVQQEKTQQNLLH-------------------------GVESFDKSALKPTDTVEKIILPATEDIEKGQQQLREGIETFDPANLKHAETQEKNPLP............................ 160
23 4.000e-18gi|665812554|ref|XP_008554795.1| PREDICTED: uncharacterized protein LOC103576377 isoform X1 [Microplitis demolitor]  clstr ali  16  16......................................................SPSLKDLPKVSMDLKSELEGFKHDCMKKAETFIKNAEDVRQERQHSDLIHGVENFETNKLKHADTKEKIILPNAIDVAAEKN-------------------------QQTLIAGIEKFDPTKLKHTETNEKNPLPDKTAIEQEKQQFISGIENFDPSKLKHAETTEKNVLP............................ 167
24 3.000e-17gi|478432608|gb|AGI98173.1| beta-thymosin 5 [Pacifastacus leniusculus]  clstr ali  16  7.........................................................IKDLPKVDTALKGQLEGFSPDKLKKTDTAEKNKEDVEAEKQAKAHLEAVEGFNSANLKHANTQVKIVLPAKEDIETERTH-------------------------QSIFQGVTGFDKASMRHAETQEKIALPTKEETEKTHQSIFQGVMAFDKSQMRHAETEEKVSLPA........................... 156
25 4.000e-17gi|827556822|ref|XP_012549728.1| PREDICTED: thymosin isoform X3 [Bombyx mori]  clstr ali  16  8......................................................TPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIAEDVAKEKQHNALLQGVELFQPSSLRKTETIEKNILPNAIDVATEKT-------------------------QKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKNGIENFDPTKLKHTETCEKNPLP............................ 159
26 1.000e-16gi|506968227|gb|AGM32457.1| thymosin beta-4 family [Coptotermes formosanus]  clstr ali  22  2...........KKAETQEKNVLPTVKQERQHSELIQGVESFKTERLKRTNTREKIVLPNAQEKTQKALLQGVEAFDTGKLKHTETQEKNKDAIEQEKEKQNLFAGIENFDTKKLKHTETQEKNPLPTKEVIDEEKKA.................................................................................................................... 138
27 3.000e-16gi|119619953|gb|EAW99547.1| thymosin, beta 10, isoform CRA_a, partial [Homo sapiens]  clstr ali  32  105...........................................................................NASGSTRISGSERDCTDCFKKMADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS................................................................................................................. 169
28 3.000e-16gi|926615957|ref|XP_013773076.1| PREDICTED: uncharacterized protein LOC106458160 [Limulus polyphemus]  clstr ali  19  3......................................................SPKKEDLPTVPSAMKNELTNFDSTKMKHTETLYKTVEDIQQEKMHQNLVAGVEEFDKSTLQPTQTQEKNILPKAEDIKQEKVHQE-------------------------LIADVENFNRNVLKHTQTEEKIVLPTKEEIKQEQQELLKGIQSYDTSNLKHAETREKNELP............................ 154
29 3.000e-16gi|1009529721|ref|XP_015926395.1| PREDICTED: uncharacterized protein LOC107453875 isoform X5 [Parasteatoda tepidariorum]  clstr ali  15  3......................................................SPSKENLPKVPAPLKDELAQFDSSKMKHTETQEKSKDDVQQEKAHNSILTGVEGFERSRLNSVETQEKVILPNAEDLAQEKV-------------------------QQSFLNGVRSFKRNSLKHTDTEEKFFLPTNDVIEQEHQKLVHGIENFDTSNLKHAETLEKNILPS........................... 155
30 5.000e-16gi|195331699|ref|XP_002032537.1| GM23472 [Drosophila sechellia]  clstr ali  16 2228...FSFEKTNSAYMLFYEPEHLQRRHSELLVTPTPSPTVEEKSEAEEPTKMETSSSEIKADVDVEVEDEDKDKAQTDTESKETPAKEEIADDKS--KQDEPEEKEIEKQSRECEKKSETDEKPTEITTVSTEEEKQPTANCDNQQTSNNSHSKASNDHQPSTSKAAQKLQLFRP............................................................................... 2402
31 9.000e-16gi|432091441|gb|ELK24523.1| DNA repair protein RAD52 like protein [Myotis davidii]  clstr ali  30  437............................................KLSSCKTSTKKSL----------LRLGGGPRDRTSLIRAP-----CSASSATMSDKPDMAEIEKFAKSKLKKTETQEKNSLPSKETIEQEKQAGES................................................................................................................. 517
32 1.000e-15gi|755985555|ref|XP_011310892.1| PREDICTED: uncharacterized protein LOC105271208 isoform X1 [Fopius arisanus]  clstr ali  17  6......................................................SPSLKDLPKVSLDLKSELEGFKHDNMKKAPTIVKDAEDVRQERQHSDLIHDVETFKAGKLKHADTKEKIVLPNATDVAAEKT-------------------------QQTLLSGIEAFDTTKLKHTKTEEKNPLPDKTAIEQEKQQFISGIENFDPAQLKHAETLEKNPLP............................ 157
33 2.000e-15gi|939694857|ref|XP_014291511.1| PREDICTED: uncharacterized protein LOC106690560 isoform X2 [Halyomorpha halys]  clstr ali  11  7......................................................SPSLKDLPKVAVDLKSQLEGFNHDNMKRASTTEKNAEDVATEKTQKALLEGVEGFDTGKL--------------------------KHTETHEKNPLPDKDAVQEKVHQNLISGVEGFDKARMKHTTTQEKNVLPDPEEAEKGQQKLIEGIENFDPKKLKHTETQEKNPLP............................ 158
34 3.000e-15gi|667242048|ref|XP_008569575.1| PREDICTED: thymosin beta-4 [Galeopterus variegatus]  clstr ali  46  69..........................................................................................SASSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 118
35 5.000e-15gi|344237102|gb|EGV93205.1| Thymosin beta-10 [Cricetulus griseus]  clstr ali  25  1................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKENEKKREKGNILNRNSLHLVR-LGHAKAKQLPCFPSLALVCWLLYP............................................................................... 77
36 1.000e-14gi|675383133|gb|KFM76030.1| hypothetical protein X975_15094, partial [Stegodyphus mimosarum]  clstr ali  18  3......................................................SPAKEDLPKVPNEFKNELEKFDAAKMKHTETKEKNKEDIQQEKQHLEFLEGVSKFNKGKLKRADTVEKTVLPSKEDVLQEKQHHE-------------------------LLTGVSTFNKAKLKRTNTKEKIVLPTKEVLTQEKIYDRKGVTGFDRSKLKKTQTVVKNFIP............................ 157
37 1.000e-14gi|939264240|ref|XP_014252114.1| PREDICTED: uncharacterized protein LOC106668146 isoform X2 [Cimex lectularius]  clstr ali  17  20.....................................................................................................LKTQLEGFNTDRMKHTDTEEKNPLPTAEDVAIEKTQRKLKHTETQEKNPLPDKDAVQEKVHQNLISGVEGFDKRTMKHTETKEMNTLPDPEEAEKGQLNLFKGIENFDTTKLKHTETCEKNPLP............................ 158
38 2.000e-14gi|820989302|ref|XP_012372871.1| PREDICTED: 40S ribosomal protein SA-like [Octodon degus]  clstr ali  21  127........................................................LLCAMWTLSSPATIRELTLNVSRSARSSGSEQDTSDCFKKMADKRDMGEIVSFDKAPLKKTEMQETNTLLTKETTEQEKRSEIS................................................................................................................. 210
39 2.000e-14gi|594076095|ref|XP_006061809.1| PREDICTED: thymosin beta-4-like [Bubalus bubalis]  clstr ali  46  29..........................................................................................SAPFATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 78
40 2.000e-14gi|149064540|gb|EDM14743.1| rCG46902, partial [Rattus norvegicus]  clstr ali  37  7.......................................................................................KQESTSCKKMADEPDMGEITSFDKAKLKKTETQEKNTLWTKETIEQEKRRVRVRGELQEQK......................................................................................................... 67
41 2.000e-14gi|926634444|ref|XP_013783070.1| PREDICTED: uncharacterized protein LOC106467282 isoform X1 [Limulus polyphemus]  clstr ali  16  58..VEGFQRSKLNPTQPREKIRLPDVELEKVHNSLLQDVEGFERSLLSPTLPHEKIHLPSAEEKIHQSLVTGVEQFDKTSLHHAETTEKNSQEIEKEKGQQQLLEGIKSYDTAQLKNATTNLKNPLPTKDEIEQEKKSCK.................................................................................................................. 205
42 2.000e-14gi|409711855|gb|AFV39710.1| beta-thymosin 4 [Pacifastacus leniusculus]  clstr ali  21  12................................................................................................KVDTALKGQLEGFSPDKLKKTDTAEKSTLPTKEDVEQEKQHDRLKRTSTSEKIVLPTSQVEAEKQAKAHLEAVEGFNSANLKHANTQEKIVLPAKEDIETEHQSIFQGVTAFDKSQMRHAETEEKVALPA........................... 156
43 2.000e-14gi|91077296|ref|XP_976221.1| PREDICTED: uncharacterized protein LOC663390 isoform X2 [Tribolium castaneum]  clstr ali  19  20.....................................................................................................LKSELEGFKPTNLKNADTQEKIVLPSAEDVAAEKTEKKLKHTETQEKNPLPDKDVVQEKNHLNLLNGVEHFDKATMKHTTTAEKIVLPDNEVIEQEKGQRQSGIENFDSSKLKHAETCEKNPLP............................ 158
44 3.000e-14gi|831213323|ref|XP_012665029.1| PREDICTED: uncharacterized protein LOC100960952 [Otolemur garnettii]  clstr ali  31  20....................................................THCPFIATAKNSTEAFKTQMQFSGRHRTDRILLALTTRSALSETMSDKPDMAEIEKCDESKLKKMETQEKNPLPSKEMIQQEKQAGE.................................................................................................................. 106
45 4.000e-14gi|156405936|ref|XP_001640987.1| predicted protein [Nematostella vectensis]  clstr ali  16  207....SFDHTKLKHVTTQEKSIMPSQEDIKEEAVDRAEVKSFDHSKLKHVETVEKNPLPSAAVLKEEPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTEETRAEVKTFDHSKLKHVQTEEKNPLPDAKTIAQEK...................................................................................................................... 346
46 5.000e-14gi|521030367|gb|EPQ12153.1| Thymosin beta-4 [Myotis brandtii]  clstr ali  50  1................................................................................................MSDKPDMAEIEKFDKSKLKKTEMQEKNPLPSKETIEQEKQAGEL................................................................................................................. 44
47 9.000e-14gi|961375352|gb|ALS04420.1| thymosin isoform 1 [Acartia pacifica]  clstr ali  20  5.....................................................KEELPCIGETLKGELLQG------HSLRKTEATEKNAEDMKQEKTHQSMLIGIEGFTATNLKPTETNEKQVLPAPEDIKAEKTHQGLLESFSAEKLKQVKTREPQSPTAALQVELARSFDKTNLKKSETMEKNPLPDTDVIAKEHIKFKTGIEAFDRTSLSRAETVEKNSLP............................ 187
48 1.000e-13gi|947350822|ref|XP_014440084.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106734016 [Tupaia chinensis]  clstr ali  18  172..................................................PKTYNPVTFTIRNPSASLWLSSEPAD-SAVATAETRLHSPSAFSAAMLDKPDIAEIQKFSKSKLNETETQEKYPPPCKDTTEKEKHAGES................................................................................................................. 264
49 1.000e-13gi|1009372181|gb|KYM96314.1| hypothetical protein ALC62_12965 [Cyphomyrmex costatus]  clstr ali  13  58..VETFKADQLKHADTKEKIVLPDVAAEKTQQTLIAGIEKFDTASLKHTETQEKNPLPDQQEKGKQQLISGIENFDPAKLKHAETLEKNPLPTKE.............................................................................................................................................................. 157
50 2.000e-13gi|409711850|gb|AFV39709.1| beta-thymosin 3 [Pacifastacus leniusculus]  clstr ali  21  12................................................................................................KVDTALKGQLEGFSPDKLKKTDTAEKSTLPTKEDVEQEKQHDRLKRTSTSEKIVLPTSQVEAEKQAKAHLEAVEGFNSANLKHANTQEKIVLPAKEDIEKGQQALREGIEGFNPSALKKTETLEKCKLP............................ 155
51 3.000e-13gi|640803523|ref|XP_008058123.1| PREDICTED: uncharacterized protein LOC103262317 [Tarsius syrichta]  clstr ali  27  1................................................................................................MSDKPDMGETKTFDKSKLKKTEMQEKNSLPSKDKTEQEKQAGKLELGKR-----RPTTENKDCVCLSHL--PIWLAGKEKILHA......................................................................... 77
52 4.000e-13gi|828206069|ref|XP_012556825.1| PREDICTED: uncharacterized protein LOC100197829 [Hydra vulgaris]  clstr ali  20  6...................................................................................................KLVVSELGQFDSTALKHVTPIVENTLPSQELIMEEAVATRLKHVETEEKNPLPTAREELRPEVLPDVSEVEKFDASKLKSVTPEVKCHLPTKDVIQEEAVATRAEVKTFDQSNLKHVETEEKNPLP............................ 144
53 5.000e-13gi|808877660|gb|KKF26084.1| Toll-like receptor 8 [Larimichthys crocea]  clstr ali  35 1167.......................................................................................KAYSKASADMGDKPDVTEVLSFDKSKLKPTETEEKNTLPTKDVIEQEKAAS................................................................................................................... 1217
54 5.000e-13gi|607366682|gb|EZA60839.1| hypothetical protein X777_13041 [Cerapachys biroi]  clstr ali  15  58..LETFKPDQLKHADTKEKIVLPDVAAEKTQQTLIAGIEKFDTASLKHTETQEKNPLPDKDEKGKQQLISGIENFDPAKLKHAETLEKNPLPTKE.............................................................................................................................................................. 157
55 8.000e-13gi|291394636|ref|XP_002713716.1| PREDICTED: uncharacterized protein LOC100339394 [Oryctolagus cuniculus]  clstr ali  38  180..........................................................................................SASTATTSDKPDMAEIEKFDKSKLRKTETQEKNPPPSEETMEQEKRAGQS................................................................................................................. 229
56 1.000e-12gi|528768545|gb|EPY88204.1| thymosin, beta 4-like protein [Camelus ferus]  clstr ali  44  1................................................................................................MSDKPDMAEIEKFGKSKLKKTEMQEKNPLPSKETIEQEKQAGESNET.............................................................................................................. 47
57 1.000e-12gi|926624252|ref|XP_013777574.1| PREDICTED: uncharacterized protein LOC106462221, partial [Limulus polyphemus]  clstr ali  16  3......................................................SPKKEDLPKVSPAIKDELAQFDSTRMKHAETKEKTKEDVEKEKVHNSLLQNVEGFQRSTLQHTQPQVRVRLPSAEDLKQERVHHN-------------------------LVTGVEKFDKSSLHHAKTTEKTFLPNSEDVKQEHQSLVTGVEKFDKSTLQHAETAEKIVLPK........................... 155
58 2.000e-12gi|795484063|ref|XP_011770184.1| PREDICTED: uncharacterized protein LOC105499335 [Macaca nemestrina]  clstr ali  45  186............................................................................................SSATMFDKPDMTEIEKFDKSKLKKTEMQEKNPLPSKETIEQEKQAGES................................................................................................................. 233
59 2.000e-12gi|658838715|ref|XP_008398737.1| PREDICTED: thymosin beta-12-like [Poecilia reticulata]  clstr ali  47  25.............................................................................................FAIMSDKPDVAEVTTFDKTKLKKTETQEKNTLPTKETIEQEK...................................................................................................................... 66
60 2.000e-12gi|926634448|ref|XP_013783072.1| PREDICTED: uncharacterized protein LOC106467282 isoform X2 [Limulus polyphemus]  clstr ali  18  20..LVHFDSTKMKPTKTEEKLILPTVQKEKVHNSLLQNVEGFQRSKLNPTQPREKIRLPSAEEKVHNSLLQDVEGFERSLLSPTLPHEKIAEEIEKEKGQQQLLEGIKSYDTAQLKNATTNLKNPLPTKDEIEQEKKSCK.................................................................................................................. 167
61 3.000e-12gi|795209858|ref|XP_011805180.1| PREDICTED: uncharacterized protein LOC105517290 [Colobus angolensis palliatus]  clstr ali  27  15.....................................................HAALLTEKKPDPSRLQSKRESFRNSVVATAQTRLHSFSFSSATMSDKPNMAEMEKFNKSKLKKTETQEKNPLPSKEMTEQEKQAGES................................................................................................................. 106
62 4.000e-12gi|752438856|ref|XP_002930139.2| PREDICTED: thymosin beta-15A isoform X1 [Ailuropoda melanoleuca]  clstr ali  59  51...............................................................................................KMSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSQETIQQEKECIQ.................................................................................................................. 94
63 4.000e-12gi|926609507|ref|XP_013783678.1| PREDICTED: uncharacterized protein LOC106467843 [Limulus polyphemus]  clstr ali  22  3......................................................SPKKENLPKVSPAIKVELTNFDSTKMKHTETREPSKEDVEQEKAHNTLLQNVEGFQRSTLHHTQPQEKIHLPSAEEIEQEK-------------------------GQQQLLEGIKGFDTTKMKHAETEVKNPLPTKDVIDQEKASN.................................................... 128
64 4.000e-12gi|906541852|gb|AKS48191.1| THY domain-containing protein-1, partial [Mytilus galloprovincialis]  clstr ali  12  56..IEGFDAGKLKPTETQEKNPLPDITAEKAERYRKQSIEDFNKKKLKRANTEEKNTLPDAQEKRECEMRHSIGDFNKSKLRHSQTEVKNPLPSTEEKQEVEKIQEIEGFKKDSLKHTEPTVKNVLPDQDTLDAE....................................................................................................................... 198
65 4.000e-12gi|301016775|dbj|BAJ11761.1| HsjCib isoform3 [Hodotermopsis sjostedti]  clstr ali  16  6..........................................................KDLPKVNVDLKSELEGFKTGSMKKAETQEKNAEDVKQERQHSELIQGVESFKTERLKRTNTQEKIVLPNAQVVKQEKVHQNLLE-------------------------GVEHFDKATMKPTQTQEKNPLPDPEEQEKEKQNLIAGIENFDTKKLKHTETQEKNPLP............................ 153
66 5.000e-12gi|640793419|ref|XP_008052687.1| PREDICTED: uncharacterized protein LOC103256725 [Tarsius syrichta]  clstr ali  40  93......................................................................................GKPLSAPSETPSDRPDMAEIEKFGKSKLKKTETQEKHPLPSKETIEQEKQAGES................................................................................................................. 146
67 5.000e-12gi|919102022|ref|XP_013387392.1| PREDICTED: uncharacterized protein LOC106156609 isoform X2 [Lingula anatina]  clstr ali  21  2..............................................................................................ADQAHAAVVKSAATFDHSQLKHTETEEKNPLPTKEALKQAKQHQNLRHAETLEKNSLPDPTSEAEKKEVELRQGIESFNRESMHHTETEVKNPLPDPDAIEKRESELRSGIEQFSKDTLSHTDTVEKNPLP............................ 147
68 6.000e-12gi|402910796|ref|XP_003918037.1| PREDICTED: uncharacterized protein LOC101003062 [Papio anubis]  clstr ali  41  74............................................................................................SSATMFDKPDMTEIEKFDKSELKKTEMQEKNPLPSKETTEQEKQAGES................................................................................................................. 121
69 6.000e-12gi|296210868|ref|XP_002752215.1| PREDICTED: uncharacterized protein LOC100403451 [Callithrix jacchus]  clstr ali  35  1................................................................................................MADKPGMAEMEKFEKSKQKRTETQEKNPPPSKEAIEQEKQAGKSSRVTRRQYAP....................................................................................................... 54
70 7.000e-12gi|119583800|gb|EAW63396.1| hCG1643102 [Homo sapiens]  clstr ali  42  1................................................................................................MSDKSNMDEIEKFSKSKLKKTEMQEKNPQPSKEWIEQEKQAG................................................................................................................... 42
71 1.000e-11gi|947321666|ref|XP_014437581.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC102490149 [Tupaia chinensis]  clstr ali  45  273.................................................................................................SDKPNMAEIETSDKSKWKKTXTQEKTPLRSKETIEQEKQAGES................................................................................................................. 315
72 1.000e-11gi|431839474|gb|ELK01353.1| Thymosin beta-15A [Pteropus alecto]  clstr ali  47  20...............................................................................................KMSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKESKSWDGWGAREW................................................................................................................ 65
73 1.000e-11gi|119612020|gb|EAW91614.1| thymosin, beta 4, Y-linked, partial [Homo sapiens]  clstr ali  45  58.........................................................................................PTASSAAMSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES................................................................................................................. 108
74 1.000e-11gi|939264244|ref|XP_014252116.1| PREDICTED: uncharacterized protein LOC106668146 isoform X4 [Cimex lectularius]  clstr ali  11  24..LEGFNTDRMKHTDTEEKNPLPTVAIEKTQRDLLLGVQSFETCKLKHTETQEKNPLPDEAEKGQLNLFKGIENFDTTKLKHTETCEKNPLPTTEIINQEK........................................................................................................................................................ 129
75 2.000e-11gi|1009579740|ref|XP_015921319.1| PREDICTED: uncharacterized protein LOC107450102 isoform X2 [Parasteatoda tepidariorum]  clstr ali  26  19........................................................................................................ELEKFDAGKMKHADTKEKNPLPSKEDVLQEKQHAKLKRTNTKEKIVLPTKEEKANQGYGAILQGIESFDTAKLKPTETQEKNPLPTKEVIAQEKGAA.................................................... 131
76 2.000e-11gi|908506783|ref|XP_013064284.1| PREDICTED: uncharacterized protein LOC106053297 isoform X1 [Biomphalaria glabrata]  clstr ali  12  133....SFSKEQLQHIRIEEKINLPTIQHEKVEQELRERIGSFHKEDLNPTETAVKVVLPTEDEKVEQELRERIGSFHKEDLNPTETTVKVVLPIEQEKQEQELKNSINSFKRASLKHAETQEKNPLPQSD............................................................................................................................ 268
77 2.000e-11gi|766917432|ref|XP_011505718.1| PREDICTED: uncharacterized protein LOC105368403 [Ceratosolen solmsi marchali]  clstr ali  22  19.....................................................................................................LKSELEGFNYSCMKKAETAEKNVLPSAGDVAAERA-------------------------QQTLIAGIEHFDTSRLKHTETNEKNPLPDKDAIQQEKQQLISGIENFDPAKLKHAETLEKNPLP............................ 119
78 3.000e-11gi|641708206|ref|XP_008143129.1| PREDICTED: uncharacterized protein LOC103289071 [Eptesicus fuscus]  clstr ali  40  166.............................................................................................QAMRSDKPDTAEIGKFTESKLKKTETQEKNPLPPKEKTEQEQQAGES................................................................................................................. 212
79 3.000e-11gi|442620937|ref|NP_001262923.1| puffyeye, isoform H [Drosophila melanogaster]  clstr ali  15 2364...FSFEKTNSAYMLFYEPEHLQRRHSELLVTPTPSPTVEEKSEAEEPTKMETSSSEIKADVDVEVEVEEKDKAQTDTESKETPAKEEIADDKS--KQDEPEEKKIEKQSREGEEKSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKASNDQQPSTSKAAQKLQLFRP............................................................................... 2538
80 3.000e-11gi|358341075|dbj|GAA48842.1| hypothetical protein CLF_102101 [Clonorchis sinensis]  clstr ali  11  17.....FDKSGLEHVVPEEKIVLPEIKQEKSEKALLDEIEKG--TQLKHTCTVEKNPLPTKQEIQHEKTEKQLEITHHPKLRRASTLEKNPLPIAQEKKEKQLLDEIEH--HPKLKPAQTMEKNPLPTQEGVLASTQTDTVNECQRESSREQSSGEPE................................................................................................ 173
81 4.000e-11gi|431911891|gb|ELK14035.1| Thymosin beta-4 [Pteropus alecto]  clstr ali  34  1................................................................................................MSDEPDMAEIEKSDKSELKKTETREKNPLPSKETIEQGKQAGGSQGGARRTAHATSSAFVFYSFSCLTL........................................................................................ 69
82 4.000e-11gi|478253766|gb|ENN74060.1| hypothetical protein YQE_09350, partial [Dendroctonus ponderosae]  clstr ali  22  454.....................................................................................................LKSELEGFSSSKLKNAETQEKIVLPSAEDVAQEKTHN-------------------------ALIAGVENFNSSSLKRTDTKEKIVLPNAQDLAAEKTEKAEGIAKFDPAKLKHTETQEKNPLPDKDGEFP..................... 561
83 8.000e-11gi|987905739|ref|XP_015440470.1| PREDICTED: uncharacterized protein LOC107195189 isoform X3 [Dufourea novaeangliae]  clstr ali  22  25.....................................................................................................LKSELEGFNHGCMKKAATAEKNVLPSAEDVAAEKT-------------------------QQTLIAGIEKFDPASLKHTETQEKNPLPDKDVIQQEKQQLISGIENFDPAKLKHAETLEKNPLP............................ 125
84 9.000e-11gi|29825534|gb|AAO92284.1| putative beta thymosin [Dermacentor variabilis]  clstr ali  16  5.............................................................PKVADEIQQELASFNAASLKHTETQEKVKEDVQQEKIHNSLLEGVEQFEKTSMKHAQTQEKVCLPKKEDIESEKEHKQ-------------------------MIEGIETFDPSKLKHAETSVKNPLPTKEVIEQEKAA..................................................... 122
85 1.000e-10gi|47222942|emb|CAF99098.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  17  233..............................................KHVEGEAKSAMACLWKDRQRKHYTDTSHLLRRPTLH--TPAPDQSQKSARMSDNPVKQEVENFNRRSLKKTETKMNTSLPTKEDIEQEKQAQKEQK............................................................................................................... 329
86 1.000e-10gi|852810692|ref|XP_012893120.1| PREDICTED: zyxin-like, partial [Dipodomys ordii]  clstr ali  31  1................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKESECAPAPGAAGLRPAPHPALPRPAS................................................................................................... 58
87 1.000e-10gi|939694861|ref|XP_014291513.1| PREDICTED: uncharacterized protein LOC106690560 isoform X4 [Halyomorpha halys]  clstr ali  10  24..LEGFNHDNMKRASTTEKNVLPTVATEKTQKALLEGVEGFDTGKLKHTETHEKNPLPDEAEKGQQKLIEGIENFDPKKLKHTETQEKNPLPTKEAIDQEK........................................................................................................................................................ 129
88 2.000e-10gi|569011523|ref|XP_006528691.1| PREDICTED: thymosin beta-15A isoform X2 [Mus musculus]  clstr ali  50  34...............................................................................................KMGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVK.................................................................................................................. 77
89 2.000e-10gi|312084628|ref|XP_003144352.1| hypothetical protein LOAG_08774 [Loa loa]  clstr ali  14  12..........................................................KKVRAPRLPLDIAAEVTKGQQLKHVEVSEKTASDIRQEKIDLQLKEEIRKHDRDKLRHADIIEKNVLPKPEDMYREKVNENLKGE-------------------------IKTYDTSRLRHSDVIEKNVLPTSADIAHEKEA--ALIVDFDTEKLKHVDPTVKIALPS........................... 156
90 3.000e-10gi|444707470|gb|ELW48745.1| Thymosin beta-10 [Tupaia chinensis]  clstr ali  27  43......................................................................................ERDASDGFKKKADKPDMGEIAIFDKVKLKKIEMQGKDTLPTKETIEPKKRSEIS................................................................................................................. 96
91 3.000e-10gi|939682988|ref|XP_014299646.1| PREDICTED: uncharacterized protein LOC103576377 isoform X2 [Microplitis demolitor]  clstr ali  21  29.....................................................................................................LKSELEGFKHDCMKKAETFIKNVLPSAEDVAAEKN-------------------------QQTLIAGIEKFDPTKLKHTETNEKNPLPDKTAIEQEKQQFISGIENFDPSKLKHAETTEKNVLP............................ 129
92 4.000e-10gi|675768640|ref|XP_008987898.1| PREDICTED: thymosin beta-15A isoform X1 [Callithrix jacchus]  clstr ali  61  25...............................................................................................EMSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQ.................................................................................................................. 68
93 4.000e-10gi|556781037|ref|XP_005985541.1| PREDICTED: thymosin beta-4-like [Pantholops hodgsonii]  clstr ali  46  42..........................................................................................SAPSATVSDKPDTAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 91
94 4.000e-10gi|560897402|ref|XP_006175163.1| PREDICTED: thymosin beta-4 [Camelus ferus]  clstr ali  44  1................................................................................................MSDKPDMAEIEKFGKSKLKKTEMQEKNPLPSKETIEQEKQAGESNET.............................................................................................................. 47
95 6.000e-10gi|724922920|ref|XP_010381587.1| PREDICTED: thymosin beta-4 [Rhinopithecus roxellana]  clstr ali  50  1................................................................................................MSDKPDMAEIEKFDKSKLKKTETQEKNPLP............................................................................................................................... 30
96 6.000e-10gi|585160324|ref|XP_006732410.1| PREDICTED: thymosin beta-4-like [Leptonychotes weddellii]  clstr ali  44  31..........................................................................................SASSATTSDKPDMAEIEKFDKSKLKKPETQEKNPLPSKETIEQEKQAGES................................................................................................................. 80
97 6.000e-10gi|313235627|emb|CBY11081.1| unnamed protein product [Oikopleura dioica]  clstr ali  14  12....SFQKEDLKKTSVDEKQVLPS-SEDLSRERVLVDCAEFKKCSLKKTDTAEHSKLKKVEVKNENSFLTKEKTFDKSKLNHVKPVEKD------TVSETKTIMSVEKFDKNTLKKAETTEKSVLPSASDITREKFVADA-AQFDKNALKKTTTNESSLLIQESSKIQAANFDHTKLKKVETSENQFLNKEKTI--------LGAAGFDKSKLNHVKVVEK................................ 235
98 7.000e-10gi|938054731|gb|KPP60253.1| thymosin beta-like [Scleropages formosus]  clstr ali  24  7............................................................VRQIHRLRQTQTQHQSSPRQTHVQFSHTAHPDKRAIMSDKPDLKEIANFDKTKLKKTETREKNPLPTKE............................................................................................................................ 75
99 7.000e-10gi|936680962|ref|XP_014237499.1| PREDICTED: uncharacterized protein LOC106659441 [Trichogramma pretiosum]  clstr ali  21  19.....................................................................................................LKSELEGFDHSNMKRAEVKVKNVLPSAEDLAAAKT-------------------------QQTLIAGIEKFDTSRLKHTETNEKNPLPDKEEQEKGKQQLMSGIENFNPSQLKHAETLEKNPLP............................ 119
100 8.000e-10gi|313229177|emb|CBY23762.1| unnamed protein product [Oikopleura dioica]  clstr ali  15  135..VENFEKNELKHQEVVEKNVLPN-AEDVSRENIPSDINNFDKSQLKKMETVEKVVLPKTEEIAREKISSEIESFKQETLNHVEIMEKEIPAETLTMRN------VATFDTAKLNHVETEEKVVLPSVEDIAKEKTLEQITE-FDMSKLKVSEAAKEVETEKP.......................................................................................... 287
101 9.000e-10gi|1008428659|ref|XP_015840562.1| PREDICTED: uncharacterized protein LOC663390 isoform X4 [Tribolium castaneum]  clstr ali  19  20.....................................................................................................LKSELEGFKPTNLKNADTQEKIVLPSAEDVAAEKTEK-------------------------ALIAGIEHFDPSKLKHTETQEKNPLPDKDVIEQEKGQRQSGIENFDSSKLKHAETCEKNPLP............................ 120
102 1.000e-09gi|432105631|gb|ELK31825.1| Thymosin beta-10 [Myotis davidii]  clstr ali  46  1................................................................................................MADKPDMGEVASFDKAKLKKTETQEKSTLPTKETIEQEKRS.................................................................................................................... 41
103 1.000e-09gi|521035103|gb|EPQ16885.1| Thymosin beta-4 [Myotis brandtii]  clstr ali  48  34...........................................................................................ASSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIE......................................................................................................................... 74
104 1.000e-09gi|443704234|gb|ELU01379.1| hypothetical protein CAPTEDRAFT_20184 [Capitella teleta]  clstr ali  25  1................................................................................................MADHKLPTDIAKFDQSKLKHAETAEKNPLPSKEDIKGEKTHLSLITTSTQEKNTLPDPTVTLEKREVELRSSIEHFSKAELRKSQTQEKNPLPDAQSLKAEK....................................................... 119
105 1.000e-09gi|762093809|ref|XP_011429369.1| PREDICTED: uncharacterized protein LOC105329712 isoform X6 [Crassostrea gigas]  clstr ali  14  17.............................................................................HNLTHVKTEEKNPEDVQQERHHLEHLQNVEAFNAGQLQHTRTKERVMLPDSSMLLEEKNREELRPTEPLEKVVLPDITIAQEKTEEELKSGIEQFDKDQLRPQKTEEKNPLPDKDAIQQEKVNIRKSLTEFEKGNLKHVKTEEKNPLP............................ 183
106 2.000e-09gi|498972154|ref|XP_004527242.1| PREDICTED: uncharacterized protein Tyb12 [Ceratitis capitata]  clstr ali  14  20..LEGFNTDKLKNASTAEKIVLPTVAAEKTQQSLISGIAAFNPSNLKHTETNEKNPLPDKEEKEKNQLISGIENFDSKKLKHTETCEKNPLPTKEVIEEEK........................................................................................................................................................ 125
107 3.000e-09gi|354480991|ref|XP_003502686.1| PREDICTED: uncharacterized protein LOC100763771 isoform X1 [Cricetulus griseus]  clstr ali  37  111..................................PGAAVRGKEEEFPRGKPRERSSP-------TWRDLKGPKAFQRQASGAAHSRGPGPWARLATVSDKPDMAEIKKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 211
108 3.000e-09gi|954375037|gb|KRY40998.1| hypothetical protein T01_11253 [Trichinella spiralis]  clstr ali  18  35...........................................................................................ESQPKVTHEEFQNELRNFDSDQLRHIEPTEKVVLPSKEDVIQEKVEIAHQSQFQRHSLQHADTNERVYLPTKDEVKQERTFERNSLTHSEPVEKYHMPTKEELAREKV--MHQVPGFDQSKLKHAET................................... 178
109 3.000e-09gi|762093801|ref|XP_011429364.1| PREDICTED: uncharacterized protein LOC105329712 isoform X2 [Crassostrea gigas]  clstr ali  14  17.............................................................................HNLTHVKTEEKNPEDVQQERHHLEHLQNVEAFNAGQLQHTRTKERVMLPDSSMLLEEKNREELRPTEPLEKVVLPDITIAQEKTEEELKSGIEQFDKDQLRPQKTEEKNPLPDKDAIQQEKVNIRKSLTEFEKGNLKHVKTEEKNPLP............................ 183
110 4.000e-09gi|795082643|ref|XP_011821007.1| PREDICTED: thymosin beta-10 isoform X1 [Mandrillus leucophaeus]  clstr ali  47  1................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKET........................................................................................................................... 34
111 4.000e-09gi|675714597|ref|XP_008977551.1| PREDICTED: thymosin beta-4-like [Callithrix jacchus]  clstr ali  42  1................................................................................................MSDKPDVDEIGKLSKSKLRKTEIQEKNPLPSKELIKQEKQAG................................................................................................................... 42
112 4.000e-09gi|260833060|ref|XP_002611475.1| hypothetical protein BRAFLDRAFT_117203 [Branchiostoma floridae]  clstr ali  19  2.............................SEKPDVSEVKQFDTGKLKHVETEEKNPLPTEQEKASERSSKILEGLDPSKLKHAETNVKEMKPDAEALHQDLTAAAVSGFDKSKLKHAETTEKSHLPTKEEIEAEKAAK................................................................................................................... 117
113 4.000e-09gi|256017087|dbj|BAH97322.1| thymosin beta-b [Danio rerio]  clstr ali  50  1................................................................................................MSDKPDVSEVSHFDKNKLKKTVTHEKNTLPTKETIEQEKKCE................................................................................................................... 42
114 5.000e-09gi|594061508|ref|XP_006054834.1| PREDICTED: thymosin beta-4-like [Bubalus bubalis]  clstr ali  43  39.............................................................................................SATMSEKPDMAEIEKFGKSKLKKTETQEKNPLPSKAAIEQKQTGES.................................................................................................................. 84
115 5.000e-09gi|940757720|ref|XP_014319944.1| PREDICTED: translation initiation factor IF-2-like [Myotis lucifugus]  clstr ali  58  103.................................................................................................SDKPDMAEMEKFDKSKLKKTETQEKNPLPSKETI.......................................................................................................................... 136
116 6.000e-09gi|954218578|gb|KRX27425.1| hypothetical protein T07_9803, partial [Trichinella nelsoni]  clstr ali  18  64..LRNFDSDQLRHIEPTEKVVLPQEKVEIAHQNVLVDVSQFQRHSLQHADTNERVYLPTKDEVKQERMEQEVSTFERNSLTHSEPVEKYHMPTKEELAREKVMHQVPGFDQSKLKHA........................................................................................................................................ 191
117 6.000e-09gi|586478685|ref|XP_006869875.1| PREDICTED: thymosin beta-4-like [Chrysochloris asiatica]  clstr ali  44  1................................................................................................MFDKPDKAEIEKFNKLKLKKTEMQEKNPLLSKEMIEQKQVGES.................................................................................................................. 43
118 7.000e-09gi|557288483|ref|XP_006026916.1| PREDICTED: thymosin beta-11-like isoform X1 [Alligator sinensis]  clstr ali  51  21................................................................................................MSDKPNFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSES.................................................................................................................. 63
119 1.000e-08gi|938070068|gb|KPP68867.1| Thymosin beta-a-like [Scleropages formosus]  clstr ali  40  47..............................................................................................SKMSDNPVNQEVENFDKKCLKKTNTAEKNTLPTKDDIEQEKKACGGQGPK............................................................................................................. 97
120 1.000e-08gi|1016654501|ref|XP_016044604.1| PREDICTED: thymosin beta-4-like [Erinaceus europaeus]  clstr ali  40  30.............................................................................................SATKSDKPHMAEIEKFDKLKLKKTGTQEKTPLPSKEMTEQEKQASES................................................................................................................. 76
121 1.000e-08gi|762093795|ref|XP_011429361.1| PREDICTED: uncharacterized protein LOC105329712 isoform X1 [Crassostrea gigas]  clstr ali  14  17.............................................................................HNLTHVKTEEKNPEDVQQERHHLEHLQNVEAFNAGQLQHTRTKERVMLPDSSMLLEEKNREELRPTEPLEKVVLPDITIAQEKTEEELKSGIEQFDKDQLRPQKTEEKNPLPDKDDIEKQEQEVKKEIVSFPRSKLRRANTEEKISLPS........................... 184
122 1.000e-08gi|736191769|ref|XP_010771603.1| PREDICTED: thymosin beta-10-like [Notothenia coriiceps]  clstr ali  46  1................................................................................................MADKPDISEVEKFDKAKLKKTETQEKNVLPTQDIIEQEKKDKS.................................................................................................................. 43
123 2.000e-08gi|637269936|ref|XP_008103076.1| PREDICTED: thymosin beta-12-like isoform X1 [Anolis carolinensis]  clstr ali  37  9...............................................................................LRPSKGSGGERSRTGSIMSDKPDFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSK................................................................................................................... 67
124 2.000e-08gi|936564194|ref|XP_014218288.1| PREDICTED: uncharacterized protein LOC106646695 [Copidosoma floridanum]  clstr ali  23  18....................................................................................................NLKSQLHGFNSSCLAKAETAEKNVLPSAEDVAAEKN-------------------------QQTLIANIEKFDPSKLKHTETQEKNPLPDKDAIQQEKQQLISGIENFQKDKLKHADTLEKNLLP............................ 119
125 2.000e-08gi|325197228|ref|NP_001191437.1| thymosin beta [Aplysia californica]  clstr ali  55  2..............................................................................................SDKHDKPDISEVTKFDKSKLKKTETHEKNPLPTKETIDQEKQG.................................................................................................................... 44
126 3.000e-08gi|585704498|ref|XP_006898254.1| PREDICTED: thymosin beta-4-like protein 3-like [Elephantulus edwardii]  clstr ali  41  39.................................................................................................SDKLDVAEIEKYDKPKLKKTETQEENPLPSKEMIQEEKQAGES................................................................................................................. 81
127 3.000e-08gi|296483262|tpg|DAA25377.1| TPA: hypothetical protein BOS_10837 [Bos taurus]  clstr ali  42  1................................................................................................MSDKPHKAEVEKFDKLKLKKTQTQEKNALPSKETIEQEKQAGSQKSNYAESNENNGDILKRSLAPTAT......................................................................................... 68
128 3.000e-08gi|568254867|gb|ETN63767.1| thymosin 1 [Anopheles darlingi]  clstr ali  25..LESFRPETLTKADTQEKNPLPTVQSEKAQRSVFEGIESFDASQLKHAETCEKNPLPDQEEKGVQHFIECIESFDTSRLKHAETLEKNPLPTREIIEEEK........................................................................................................................................................ 130
129 3.000e-08gi|1000762497|ref|XP_015604306.1| PREDICTED: uncharacterized protein LOC107272073 isoform X1 [Cephus cinctus]  clstr ali  11  61..VETFKPDRLKHADTHEKEDVAAEKTQQTQQTVIAGIEKFDPARLKHTETQEKNPLPDKQREKGKQLISGIESFNPAKLKHAETLEKNPLPTKE.............................................................................................................................................................. 162
130 3.000e-08gi|929108188|ref|XP_014065330.1| PREDICTED: thymosin beta-b [Salmo salar]  clstr ali  50  1................................................................................................MADKPDVSEIAQFDKTKLKKTETEEKNTLPTKEVIDQEKQ..................................................................................................................... 40
131 3.000e-08gi|9954120|gb|AAG08963.1|AF155935_1 beta-thymosin [Sycon raphanus]  clstr ali  50  1................................................................................................MGDKPDVSEVASFDKTKLKKTETAEKNPLPTKETIEQEKSAS................................................................................................................... 42
132 4.000e-08gi|918300879|gb|KOF74645.1| hypothetical protein OCBIM_22035829mg [Octopus bimaculoides]  clstr ali  32  1................................................................................................MDGKPDLNEIATFDKSHLKKAETQEKNTLPTKETSSVSESADQQSR............................................................................................................... 46
133 4.000e-08gi|749715656|gb|KII64482.1| hypothetical protein RF11_03890 [Thelohanellus kitauei]  clstr ali  12  165.....FDRTKLKHSVSIEKNTLPDSPDELPPKPELKELVKFAHTGLKHVNPNVKQLMPTQIEQEKVECRTEVKLFKKDSLKKVKTIEKNPLPTEADLWEKPELTALKNFVQSSLRHVKTVEKVFKPTKTELISER...................................................................................................................... 313
134 4.000e-08gi|585185412|ref|XP_006744240.1| PREDICTED: thymosin beta-4-like [Leptonychotes weddellii]  clstr ali  47  1................................................................................................MSEKPNMAKIEKFDKSKLKKTEMEDKNPLPSKEMIEQEKQAA................................................................................................................... 42
135 5.000e-08gi|674032110|ref|XP_008826278.1| PREDICTED: thymosin beta-4-like [Nannospalax galili]  clstr ali  35  5..............................................................................................APMSDKPDMGEIKKFGKSKLKKTETQEKNPLPSKETIEQEKQAGEVRSSRWKDGLQIPSINEKNLDPCVS......................................................................................... 74
136 5.000e-08gi|1011595413|gb|KYO38137.1| solute carrier family 25 member 53 [Alligator mississippiensis]  clstr ali  48  274...........................................................................................PLAAKMCDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS................................................................................................................ 323
137 5.000e-08gi|397776320|gb|AFO64974.1| beta thymosin [Haliotis discus discus]  clstr ali  52  1................................................................................................MGDKPDISEVATFDKGKLKKTETQEKNPLPSKETIEQEKAEQ................................................................................................................... 42
138 7.000e-08gi|985391167|ref|XP_015380275.1| PREDICTED: uncharacterized protein LOC107174000 isoform X2 [Diuraphis noxia]  clstr ali  12  20..LEGFNPDNMKKADTNEKIILPTAEDKAITEALIEGVGGFDTNKLKHTETQEKNPLPDEAEKEQQQLIAGIENFDPTKLKPTVTEEKNPLPTKEVIAEEK........................................................................................................................................................ 129
139 8.000e-08gi|676262288|gb|KFO19279.1| Thymosin beta-4 [Fukomys damarensis]  clstr ali  46  23...........................................................................................PLLATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 71
140 8.000e-08gi|998719678|ref|XP_015497764.1| PREDICTED: thymosin beta-4-like isoform X1 [Parus major]  clstr ali  40  30.....................................................................................QLKREQPDGPIMSDKPDFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSES.................................................................................................................. 83
141 8.000e-08gi|14906089|gb|AAK72482.1| thymosin beta-4 [Branchiostoma belcheri]  clstr ali  48  1................................................................................................MSDKPDLSEVEKFDKSKLKKTETSVKNTLPSKEAIEQEKQTVQQQ................................................................................................................ 45
142 1.000e-07gi|62901868|gb|AAY18885.1| thymosin [synthetic construct]  clstr ali  46  26.................................................................................................ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS................................................................................................................. 68
143 1.000e-07gi|676460126|ref|XP_009055522.1| hypothetical protein LOTGIDRAFT_209434 [Lottia gigantea]  clstr ali  50  12.........................................................................................PEHTISIMSDKPDVSEVAKFDKSKLKKAETNEKNTLPTKETIEQEKTG.................................................................................................................... 59
144 1.000e-07gi|749727038|gb|KII72707.1| hypothetical protein RF11_15216 [Thelohanellus kitauei]  clstr ali  38  2...........................................................................................DDKAPGSNSDLLKGVASFDKHKLKKTETNEKNVLPSKEAIASEKSQKGVIGGHLN........................................................................................................... 56
145 1.000e-07gi|740855343|ref|WP_038640595.1| hypothetical protein [Pseudoalteromonas sp. OCN003]  clstr ali  14  441..................LKGLKEKSLDVGPVPFLQQIQEFDTASLKKVS-----------QKKDKTLLEEVREFNKSALNHVTTKEKRGLG---------LLDEITRFNKSKLTHSDTVIKS---GTSVLDQVELFNKAKLNKASTSVKRG----------VSVLDQVELFGKSQLSKTTT--KQHDPLVEMRKLEMQ...................................................... 586
146 1.000e-07gi|157136879|ref|XP_001663844.1| AAEL013661-PA [Aedes aegypti]  clstr ali  12  23..LESFKTENLSKADTQEKIVLPTVQAEKTQKSLFAGIESFDATKLKHAETCEKNPLPDKEEKGQKNLINCIESFDTSKLKHTETHEKNPLPTKETIEEEK........................................................................................................................................................ 128
147 1.000e-07gi|913317114|ref|XP_013189527.1| PREDICTED: uncharacterized protein LOC106134105 isoform X4 [Amyelois transitella]  clstr ali  18  21.....................................................................................................LKSQLEGFNTSCLKDVDTNEKIVLPSAEDVATEK-TQNLWE---------------------SLFDGIEKFDASRLKHTEIQEKNPLPDKDAIEAEKEKNKTGIENFDPTKLKHTETCEKNPLP............................ 124
148 1.000e-07gi|89114258|gb|ABD61717.1| thymosin beta [Scophthalmus maximus]  clstr ali  56  1................................................................................................MSDKPDVSAVKDFDQSKLKKTETAEKNTLPTKETIEQEKSG.................................................................................................................... 41
149 2.000e-07gi|675795933|ref|XP_008954499.1| PREDICTED: thymosin beta-4-like [Pan paniscus]  clstr ali  40  1................................................................................................MSDKSNMDEIEKFNKLKLKKTEMQEKNPQPSKEWIEQEKQAG................................................................................................................... 42
150 2.000e-07gi|1011564514|gb|KYO20342.1| thymosin beta-12-like [Alligator mississippiensis]  clstr ali  51  27................................................................................................MSDKPNFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSES.................................................................................................................. 69
151 2.000e-07gi|731198967|ref|XP_010609601.1| PREDICTED: thymosin beta-10-like [Fukomys damarensis]  clstr ali  32  1................................................................................................MAYKPDMGEITSFNKAKLKMTKTQEKNALLTKETFEQGKWSEISKEHRGF........................................................................................................... 50
152 2.000e-07gi|625275433|ref|XP_007629323.1| PREDICTED: uncharacterized protein LOC100763771 isoform X2 [Cricetulus griseus]  clstr ali  33  111..................................PGAAVRGKEEEFPRGKPRERSSPPKAFPWQRQASRLEQRPGDFAKLKKT-TGGAQKNYAFSTVSDKPDMAEIKKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 234
153 2.000e-07gi|641692181|ref|XP_008143980.1| PREDICTED: putative thymosin beta-4-like protein 2 [Eptesicus fuscus]  clstr ali  30  2...........................................................DWREQEWKQRDQLKDYDDGGLGEDDSTGDREKQMYSAVSDTPDTAETEKFDKLKLKKTETQEKDPLPSKETTEQEKQAGES................................................................................................................. 87
154 2.000e-07gi|194764408|ref|XP_001964322.1| uncharacterized protein Dana_GF20776 [Drosophila ananassae]  clstr ali  11  23..LEGFNTEKLKNASTQEKIILPTVAAEKTQKSIFEGITAFDQNNLKHTETNEKNPLPDEQEKEKNEFIAGIENFDAKKLKHTETNEKNVLPTKE.............................................................................................................................................................. 122
155 2.000e-07gi|242009701|ref|XP_002425621.1| conserved hypothetical protein [Pediculus humanus corporis]  clstr ali  21  15................................................................................................KVNTDLKSQLECFNQRNLKDVNTLEKNILPSAQDVAAEKTQKALLE-------------------------GVEAFDTSKLKHTETNEKNPLPDKEVVEKVHQKLFDGVEHFDKKTMKHAETQEKNPLP............................ 120
156 2.000e-07gi|82619124|gb|ABB85285.1| thymosin beta-4 [Lymnaea stagnalis]  clstr ali  51  1................................................................................................MSDKPDLSEVSKFDKNKLKKVETTEKNPLPTKETIAQEKEA.................................................................................................................... 41
157 3.000e-07gi|444731992|gb|ELW72319.1| Thymosin beta-10 [Tupaia chinensis]  clstr ali  30  40.....................................................................................SEGDARDRFKKMADKQDMGEIATFQKAKLKKREMQKKKILLTKETIEQER...................................................................................................................... 89
158 3.000e-07gi|625206108|ref|XP_007644327.1| PREDICTED: thymosin beta-10 [Cricetulus griseus]  clstr ali  34  1................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKESEFAPASGFPPQHS.............................................................................................................. 47
159 3.000e-07gi|944210259|gb|KQK77105.1| thymosin beta-12-like isoform 2 [Amazona aestiva]  clstr ali  45  20............................................................................................SAPTMSDKPDFAEIETFDKTKLKKTETREKNPLPTXETIEQEKQSES.................................................................................................................. 66
160 3.000e-07gi|966653768|gb|KTF88622.1| hypothetical protein cypCar_00028874, partial [Cyprinus carpio]  clstr ali  46  33................................................................................................MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGES.................................................................................................................. 75
161 3.000e-07gi|119115116|ref|XP_310894.3| AGAP000235-PA [Anopheles gambiae str. PEST]  clstr ali  22  17...................................................................................................KPDKSELESFRTETLAKADTQEKNCLPTAADVQSEKA-------------------------QRSVIEGIEGFDASRLKHAETKEKNPLPDVEAIQAEKQQFIAGIESFDTKSLKHADTVEKNLLP............................ 120
162 3.000e-07gi|291230738|ref|XP_002735323.1| PREDICTED: uncharacterized protein PF11_0207-like isoform X1 [Saccoglossus kowalevskii]  clstr ali  277....SFDQSKLKHVETEEKNVLPTPQDMRAEKPDISEVSKFDASKLKHVETQEKNILPTTIKEEAVDSRAEVKSFDHSKLKHVETEEKNPLPTADAIKQEKGKA..................................................................................................................................................... 383
163 3.000e-07gi|410978666|ref|XP_003995710.1| PREDICTED: putative thymosin beta-4-like protein 2 [Felis catus]  clstr ali  43  1................................................................................................MFDKPIMAEIEKFNKLKLKKTETQKKNPLTSKETTEQEKQAGKS................................................................................................................. 44
164 4.000e-07gi|755985561|ref|XP_011310894.1| PREDICTED: uncharacterized protein LOC105271208 isoform X2 [Fopius arisanus]  clstr ali  21  19.....................................................................................................LKSELEGFKHDNMKKAPTIVKDVLPSAEDVAAEKT-------------------------QQTLLSGIEAFDTTKLKHTKTEEKNPLPDKTAIEQEKQQFISGIENFDPAQLKHAETLEKNPLP............................ 119
165 4.000e-07gi|975136319|ref|XP_015284406.1| PREDICTED: thymosin beta-4-like [Gekko japonicus]  clstr ali  35  1................................................................................................MADKPDVAEIKKCYKSKLKETERQEKSPLPSKETIEQEKQAGESQRNQPFQ.......................................................................................................... 51
166 4.000e-07gi|557010482|ref|XP_006005968.1| PREDICTED: thymosin beta-12-like [Latimeria chalumnae]  clstr ali  42  1................................................................................................MANKPDVSEVTTFNKQGLKKTETQEKNPLPTKEMIEQEKKAEQSS................................................................................................................ 45
167 5.000e-07gi|987956326|ref|XP_015422852.1| PREDICTED: uncharacterized protein LOC107183964 [Myotis davidii]  clstr ali  38  62..........................................................................................SASSATTSDKPDTAAIEKLAKSKRKRTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 111
168 5.000e-07gi|998719680|ref|XP_015497765.1| PREDICTED: thymosin beta-12-like isoform X2 [Parus major]  clstr ali  51  14................................................................................................MSDKPDFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSES.................................................................................................................. 56
169 5.000e-07gi|532051826|ref|XP_005368667.1| PREDICTED: thymosin beta-15A homolog [Microtus ochrogaster]  clstr ali  53  1................................................................................................MCDKLDMSEVKRLDRSKLKKTITEGKNTLPLKETIQQEK...................................................................................................................... 39
170 6.000e-07gi|675871456|ref|XP_009021288.1| hypothetical protein HELRODRAFT_175630 [Helobdella robusta]  clstr ali  59  1......................................................................................................MSEVEKFDKSKLKKAETAEKNPLPTKE............................................................................................................................ 27
171 6.000e-07gi|41763910|gb|AAS10353.1| thymosin beta a [Cyprinus carpio]  clstr ali  47  1................................................................................................MSDNPVKEEVQKFDKRCLKKTNTAEKNTLPTKEDIEEEKKAG................................................................................................................... 42
172 6.000e-07gi|556973772|ref|XP_005994847.1| PREDICTED: thymosin beta-12-like [Latimeria chalumnae]  clstr ali  38  1................................................................................................MADKVDLAEIQDFDHTKLKMTETKEKNPLATKETTEQKKQNQ................................................................................................................... 42
173 6.000e-07gi|759094901|ref|XP_011356741.1| PREDICTED: thymosin beta-4-like protein 3 [Pteropus vampyrus]  clstr ali  45  1................................................................................................MSNKPDMAEIEKFDKPKLKMTETHEKNLPPSKETTEQEKQVGES................................................................................................................. 44
174 7.000e-07gi|821494481|ref|XP_003775081.2| PREDICTED: thymosin beta-15B [Sarcophilus harrisii]  clstr ali  42  243.........................................................................................VSDPNTKTSDKPDLSEVKTFDKRKLRKTTTVEKNTLPSKETIEQEKELDKSS................................................................................................................ 294
175 7.000e-07gi|908434843|ref|XP_013077121.1| PREDICTED: uncharacterized protein LOC106063332 [Biomphalaria glabrata]  clstr ali  16  6............................................................AKTAPTELLAEINKSGSTNLHHVNPQEKNPLPIAEEKHHQEHIENIGKFKRTSLKRTESMEKGCLPSQDGMLRQDQTQ................................................................................................................... 87
176 8.000e-07gi|836711740|ref|XP_012790133.1| PREDICTED: zonadhesin [Sorex araneus]  clstr ali  13  628..................PTEKPTVPTEKPTVPTKKPTVPTEKPTFKRTFPTEKCTVPTEKPTVEKPTVPTEKPTDPTE-KPTDPTEKPTNP-----TEKPTVPTKKPIDPTK-KTIDPTEKPIVPTEKPIIPTK-----KPTDPTEKNTDPTKKPTDPTEKPTDPT-EKTTDPTK-KPTDPTEKTIDPTEKPTDPTKKPTDPTEKPTDPPTEKPTDPTEKNTVPTKKTTDP..................... 838
177 9.000e-07gi|649147674|gb|AIC61696.1| TMSB15B [synthetic construct]  clstr ali  50  1................................................................................................MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKEKLHYVRYGKRESE............................................................................................................... 46
178 9.000e-07gi|227150231|gb|ACP19740.1| thymosin-repeated protein 1 [Eriocheir sinensis]  clstr ali  11  21..LEGFSPDKLKKTDTAEKTALPTVEQEKQHNELIHDITEFRSDKLKRTSTSEKIVLPTDAEKGQQALCQGIEGFDPSALKKTETQEKNVLPTKEVIEQEK........................................................................................................................................................ 126
179 9.000e-07gi|734543966|gb|KHN72844.1| hypothetical protein Tcan_03900 [Toxocara canis]  clstr ali  24  76.................................................................................................................LKHVETQEKNILPSSKDVYSEKV-------------------------DPDLKEEIKAHETSKLRHTDTIEKIVLPTHEDVKRERVEMKSGIKNFDPQKLRSVSTEEKCVLPS........................... 165
180 1.000e-06gi|1008773551|ref|XP_006985641.2| PREDICTED: thymosin beta-4-like [Peromyscus maniculatus bairdii]  clstr ali  50  11..............................................................................................ATMSDKPEEAEIEKFDKSKLKKTGTQEKNPLPSKETIEQEKQAGKL................................................................................................................. 56
181 1.000e-06gi|961881611|ref|XP_014897969.1| PREDICTED: thymosin beta-15B isoform X1 [Poecilia latipinna]  clstr ali  37  40.............................................................................................SSKMGDNPVNQEVEQFNKQKLKKTNTEEKNRLPTKEAGCEQKYLTKSKKRR............................................................................................................. 91
182 1.000e-06gi|759184946|ref|XP_011380733.1| PREDICTED: histone H3.3-like [Pteropus vampyrus]  clstr ali  33  1......................................................................................................MAENEKFDKSKSKKTETHEKNPLPSKETIKQEKQPARKSTGGKTPRKQLATKAAKSVPSTRGMKKPHR................................................................................... 69
183 1.000e-06gi|699027634|pdb|4PL8|H Chain H, Structure Of Rabbit Skeletal Muscle Actin In Complex With A Hybrid Peptide Comprising Thymosin Beta4 And The Lysine-  clstr ali model  36  3...............................................................SDKPDMAEIEKFDKSKFKPV------VQRPVPKDSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 73
184 1.000e-06gi|944345546|ref|XP_014376871.1| PREDICTED: thymosin beta-11-like isoform X2 [Alligator sinensis]  clstr ali  44  9.........................................................................................VTPSGPIMSDKPNFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQSES.................................................................................................................. 58
185 1.000e-06gi|31745565|gb|AAN08022.1| beta-thymosin domain repeat protein CSP29KDa_v1 [Hermissenda crassicornis]  clstr ali  19  16...............................................................................................................AKLKSVETVEKNPLPTAEAIKDEKQHQSLKKSESVEKSNLPSLAAISQERSQDVRERIGSFNKDELKKTDTSEKTVLPSIDDIGQEKVALKESISGFDKSNLKHSEVVEKNSLP............................ 143
186 1.000e-06gi|506965349|gb|AGM32065.1| thymosin beta-4 family protein [Coptotermes formosanus]  clstr ali  19  14................................................................................................KVNLDLKSELEGFKTVTMKKAETQEKNVLPTAEDVATEKT-------------------------QKALLQGVEAFDTGKLKHTETQEKNLLPDKDEQEKEKQNLFAGIENFDTKKLKHTETQEKNPLP............................ 119
187 1.000e-06gi|672021850|ref|XP_008774691.1| PREDICTED: putative thymosin beta-4-like protein 6 [Rattus norvegicus]  clstr ali  36  1................................................................................................MSDKLDMAQTEKINMSKLKKAEMSKKNYLHSKEMIEQEKQAGGS................................................................................................................. 44
188 1.000e-06gi|20140816|sp|Q9I955.3|TYBA_CYPCA RecName: Full=Thymosin beta-a  clstr ali  46  1................................................................................................MSDNPVKEEVQQFDKKCLKKTNTAEKNTLPTKEDIDQEKKAAE.................................................................................................................. 43
189 1.000e-06gi|431904060|gb|ELK09482.1| Thymosin beta-4-like protein 1 [Pteropus alecto]  clstr ali  35  1................................................................................................MFDKPDMAEMDKSDKLKLKKTETQEKNLLPAKEMIEQKKQAGELTSDNEGQSCPSH..................................................................................................... 56
190 1.000e-06gi|354491586|ref|XP_003507936.1| PREDICTED: thymosin beta-15A [Cricetulus griseus]  clstr ali  66  1................................................................................................MSDRPDLSEVQRFDRSKLKKTNTEEKNTLPSKETIQQEK...................................................................................................................... 39
191 1.000e-06gi|972976399|ref|XP_006631822.2| PREDICTED: thymosin beta-12-like isoform X1 [Lepisosteus oculatus]  clstr ali  45  3.............................................................................................QAKMSDKPDLTEIEGFDKSKLKKTETKEKNPLPTKETIEQERKGEA.................................................................................................................. 48
192 1.000e-06gi|940775044|ref|XP_014303325.1| PREDICTED: thymosin beta-4-like [Myotis lucifugus]  clstr ali  45  1................................................................................................MSEKHDMAEIEKFDKLKLKKTEKQDKNPLPSKETI.......................................................................................................................... 35
193 2.000e-06gi|537189817|gb|ERE76849.1| thymosin beta-4-like protein [Cricetulus griseus]  clstr ali  33  11..............................................................................................ATVSDKPDMAEIKKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESYIPPILQKLRRAPLVKYTQFEQQREASVV.................................................................................... 85
194 2.000e-06gi|808878254|gb|KKF26523.1| Thymosin beta-12 [Larimichthys crocea]  clstr ali  47  1................................................................................................MSDKPDISEVTSFDKSKLKKTETQEKNPLPTKESKT......................................................................................................................... 36
195 2.000e-06gi|545489234|ref|XP_005616899.1| PREDICTED: thymosin beta-15A-like [Canis lupus familiaris]  clstr ali  60  1................................................................................................MSDKSDLSEVEKFDRSKLKKTNTKEKNTLLSKETIQQEKNSVQ.................................................................................................................. 43
196 2.000e-06gi|440899196|gb|ELR50536.1| hypothetical protein M91_15546, partial [Bos mutus]  clstr ali  32  8..........................................................................................LAPSAAMSYKPDAAEIEKFGKSTLKKAEMQEKNPLPSKEMIEEERQAGES................................................................................................................. 57
197 2.000e-06gi|662187805|ref|XP_008487549.1| PREDICTED: uncharacterized protein LOC103524312 [Diaphorina citri]  clstr ali  12  3........................VKAEKTHNALIEGVEAFDTAKLKHAETQEKNPLPDEDKKSKEKLISGIENFDTGKLKHTETVEKNPLPTKE.............................................................................................................................................................. 77
198 2.000e-06gi|919082943|ref|XP_013378854.1| PREDICTED: uncharacterized protein LOC106150532 isoform X1 [Lingula anatina]  clstr ali  165..IEQFSKDTLSHTDTVEKNPLPTLKSEKQHQGLIDEVEHFSKQGLHHTDANVKNPLPDAEEKVERQRLSSIETFDKSNLQHAETAEKNPLPDQKT............................................................................................................................................................. 265
199 2.000e-06gi|919082949|ref|XP_013378856.1| PREDICTED: uncharacterized protein LOC106150532 isoform X3 [Lingula anatina]  clstr ali  127..IEQFSKDTLSHTDTVEKNPLPTLKSEKQHQGLIDEVEHFSKQGLHHTDANVKNPLPDAEEKVERQRLSSIETFDKSNLQHAETAEKNPLPDQKT............................................................................................................................................................. 227
200 2.000e-06gi|594624116|ref|XP_007166672.1| PREDICTED: LOW QUALITY PROTEIN: putative thymosin beta-4-like protein 2-like [Balaenoptera acutorostrata scammoni] :  clstr ali  41  1................................................................................................MSDKPDMAEIEKFGKSKLKNKNEREKKPLPSKETTEXEKQAD................................................................................................................... 42
201 2.000e-06gi|354483836|ref|XP_003504098.1| PREDICTED: thymosin beta-4-like protein 3 [Cricetulus griseus]  clstr ali  45  1................................................................................................MSNNLNKAEMEKFDKPKLKKTETQEKNPLPSKRTIEREKQVGDS................................................................................................................. 44
202 2.000e-06gi|974078727|ref|XP_015237024.1| PREDICTED: thymosin beta-a-like [Cyprinodon variegatus]  clstr ali  54  9....................................................................................................PVNEEVEKFNKQKLKKTNTQEKNMLPTKEDIEKEKMA.................................................................................................................... 45
203 2.000e-06gi|641703061|ref|XP_008140239.1| PREDICTED: thymosin beta-4-like [Eptesicus fuscus]  clstr ali  48  1................................................................................................MPIKPNMSQIEKFDMLKLK-TETQEKNPLPSKETIEQGKQTGKS................................................................................................................. 43
204 2.000e-06gi|634852085|ref|XP_007940447.1| PREDICTED: thymosin beta-4-like [Orycteropus afer afer]  clstr ali  45  1................................................................................................MSNKPSMVETEKFSKSKLKKTNTKEISPTFSKETIKEEKQAGES................................................................................................................. 44
205 3.000e-06gi|196006231|ref|XP_002112982.1| hypothetical protein TRIADDRAFT_25752 [Trichoplax adhaerens]  clstr ali  29  4.................................................................KPDRSEVKSFDVSKLKHIETTEKNPLP-----SDKPNISEVTKFDKSKLKHTETSEKNPLPTKESK.......................................................................................................................... 64
206 3.000e-06gi|712043359|gb|AIW64741.1| thymosin beta [Penaeus monodon]  clstr ali  10  21..LEGFSAVNLKKTETEEKIHLPDVEAEKKVQAHLQAVEGFNTAQLKHANTQEKIVLPAQEEKGQQALRQGIEGFDHAALKKAQTTEKNTLPTKEMIEEEK........................................................................................................................................................ 126
207 3.000e-06gi|1009579735|ref|XP_015921317.1| PREDICTED: uncharacterized protein LOC107450102 isoform X1 [Parasteatoda tepidariorum]  clstr ali  22  19........................................................................................................ELEKFDAGKMKHADTKEKNPLPSKEDVLQEKQHHE-------------------------LLTGVSTFNKAKLKRTNTKEKIVLPTKEVLTQEKVYERQNLVGFDRSKLKKTVTVEKNFLP............................ 119
208 3.000e-06gi|426349712|ref|XP_004042433.1| PREDICTED: thymosin beta-15B-like [Gorilla gorilla gorilla]  clstr ali  61  1................................................................................................MSYKPDKSKVGKFDREKLKKINNKEKNTLLSKETIQQEK...................................................................................................................... 39
209 3.000e-06gi|634857864|ref|XP_007942527.1| PREDICTED: putative thymosin beta-4-like protein 2 [Orycteropus afer afer]  clstr ali  35  5........................................................................................TSLASSTTVSDKLGTGEIEKFDKSKLK-TDTQENNPRPSTETTEQEKQARES................................................................................................................. 55
210 4.000e-06gi|541041873|gb|ERG81070.1| cre-tth-1 protein [Ascaris suum]  clstr ali  15  20................................................................................................................................EIAEGVTKGHDLKHVETHEKNILPTSKDVYEKVDPNLKEEIKAHEPAKLRHTDTIEKNVLPTHEDMKREKVEMKSGIKNFNPQKLRSVSTEEKYVLPSSG......................... 122
211 5.000e-06gi|498048598|ref|WP_010362754.1| hypothetical protein [Pseudoalteromonas citrea]  clstr ali  10  440..................LKGLKTKADEVGPAPFLQHIQTFDKSQLSKVELSKPSSLLNDIRQ-----------FDKSSLKQVDTEVK---------RGKGLLDEIELHNNNSLRATNTVEK-------------RGLGVLDEITRFNRSALQETETQVKQGTSVLDQVELFNKKKLSQVNTLVKRGTSVLDQVELFNKGNLAQQRTQQFDYLAQIKKLE................................. 608
212 5.000e-06gi|591308857|ref|XP_007081046.1| PREDICTED: thymosin beta-10-like [Panthera tigris altaica]  clstr ali  41  24.......................................................................................RNSTDPFKKRADKPDMGEITSLDKTKLKKTETQEKNTLPTKGTIEQEKRSE................................................................................................................... 74
213 5.000e-06gi|325111404|gb|ADY80039.1| thymosin [Procambarus clarkii]  clstr ali  10  21..LEGFSPDKLKKTDTAEKSTLPTVEQEKQHTELLENISHFRSDKLKRTSTSEKIVLPTDAEKGHQALREGIEGFNPSALKKTETLEKCKLPTKEEIEQEK........................................................................................................................................................ 126
214 6.000e-06gi|676434677|ref|XP_009047305.1| hypothetical protein LOTGIDRAFT_203463 [Lottia gigantea]  clstr ali  11  91....SFNKNDLSHAQTVEKTVLPKVKQEKTHQQLLTGVTNFDHDQLSQTQTKERTVLPDTQEKQDIEMRKSIEGYHKDNLKKTDCVEKIHLPSKDEIDQEKRLS..................................................................................................................................................... 197
215 6.000e-06gi|444721971|gb|ELW62677.1| hypothetical protein TREES_T100003104 [Tupaia chinensis]  clstr ali  22  56...........................................................................................PGFKKMSDKLHVEETASFNKAKHKKMEMQENN-LLTEQTIEQKKQSEIS................................................................................................................. 103
216 7.000e-06gi|930663613|gb|KPJ05117.1| hypothetical protein RR46_03954 [Papilio xuthus]  clstr ali  18  16................................................................................................KVANDLKSQLESFNTGCLRDVDTNEKIVLPSAEDIAQEKQHTALLQD-------------------------LEKFQPSVLRKTDTVEKVVLPNALDVEKTQKSLFDGIEKFDASRLKHTETQEKNPLP............................ 121
217 8.000e-06gi|987952002|ref|XP_015421446.1| PREDICTED: thymosin beta-15A-like [Myotis davidii]  clstr ali  48  1................................................................................................MSDKPDLSEV-KFDKSKLKKTNTKEKIILPPKETIQQRKSEFKYCKTILSE.......................................................................................................... 50
218 8.000e-06gi|431905100|gb|ELK10155.1| Thymosin beta-4 [Pteropus alecto]  clstr ali  48  33..................................................................................................QRPDRAEIEKFNKSKLKKTETQEKNPLPSKETIEREKRAGESQ................................................................................................................ 75
219 8.000e-06gi|71980588|ref|NP_001020985.1| Muscle M-line assembly protein unc-89 [Caenorhabditis elegans]  clstr ali  11 1558.......KSPVKKEKSPEKEEKPASPTKKEKSPEKPASPTKKSENEVKSPTKEKSPEKSVVEELKSPKEKSPEKAD-DKPKSPTKKEKSPEKSATEDVKSPTKKE-KSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAE--EKPKSPTKKEKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSP..................... 1780
220 8.000e-06gi|281341403|gb|EFB16987.1| hypothetical protein PANDA_000865, partial [Ailuropoda melanoleuca]  clstr ali  43  1................................................................................................MANKLDMGEITSFDKVKLKKTETPEKNTLQTKETTEEEKQSESS................................................................................................................. 44
221 1.000e-05gi|440900576|gb|ELR51677.1| hypothetical protein M91_00741, partial [Bos mutus]  clstr ali  47  13.............................................................................................FATMSDKPHKAEVEKFDKLKLKKTQTQEKNALPSKETIEQEKQAGSQK................................................................................................................ 60
222 1.000e-05gi|537212430|gb|ERE80777.1| thymosin beta-10-like protein [Cricetulus griseus]  clstr ali  42  78.................................................................................................ANKLDLEEIASFDKAKLKKTETQE-NTLLTKETIEQKKRSEIS................................................................................................................. 119
223 1.000e-05gi|800962233|ref|WP_045989255.1| hypothetical protein [Pseudoalteromonas piscicida]  clstr ali  12  440..................LKDLKTKASEVGPAPFLQQVQNFDKSLLSKVESKPKSVL------------DEVRGFDKSSLKPTVTVEKRGHG---------LLDDIELFNSKKLNSVTTLEKRGLPSK---TQVKRGVSVLDQVELFNNKSLSSANTVVKQGVSVLDQVELFNKKVLKQQSTNKLDYLTQLKKLEME........................................................ 610
224 1.000e-05gi|984139759|ref|XP_015361932.1| PREDICTED: LOW QUALITY PROTEIN: thymosin beta-4-like [Marmota marmota marmota]  clstr ali  47  26..............................................................................................ETLSDKPDMAEIEKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 71
225 1.000e-05gi|923867948|ref|XP_013770779.1| PREDICTED: titin-like [Pundamilia nyererei]  clstr ali  13 7413..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKAERRQVETSEKEPVELKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 7641
226 1.000e-05gi|664766338|ref|XP_008540663.1| PREDICTED: thymosin beta-15A [Equus przewalskii]  clstr ali  54  15...............................................................................................KISAKPDLSEVEKFDRSKLKKANTEGKNALPLKETIQQEKKCVQ.................................................................................................................. 58
227 1.000e-05gi|1011580791|gb|KYO30272.1| toll-like receptor 7 isoform A [Alligator mississippiensis]  clstr ali  16  328.......................................................................................................................................WSAEEQLQRPELLLCRASVLGSAKMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA..................................................... 392
228 1.000e-05gi|374074231|pdb|3SJH|B Chain B, Crystal Structure Of A Chimera Containing The N-terminal Domain (residues 8-29) Of Drosophila Ciboulot And The C-ter  clstr ali model  48  14...................................................................................................ENLKSQLEGFNQDKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 54
229 1.000e-05gi|20140392|sp|Q9DFJ9.3|TYB_GILMI RecName: Full=Thymosin beta  clstr ali  46  1................................................................................................MSDKPDVKEVESFDKTTLKKTTTNEKNTLPTKEVIEQEKSGGS.................................................................................................................. 43
230 2.000e-05gi|835994728|ref|XP_012780379.1| PREDICTED: titin-like isoform X3 [Maylandia zebra]  clstr ali  13 8339..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8567
231 2.000e-05gi|835994734|ref|XP_012780380.1| PREDICTED: titin-like isoform X4 [Maylandia zebra]  clstr ali  13 8315..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8543
232 2.000e-05gi|835994738|ref|XP_012780381.1| PREDICTED: titin-like isoform X5 [Maylandia zebra]  clstr ali  13 8247..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8475
233 2.000e-05gi|987945868|ref|XP_006763874.2| PREDICTED: thymosin beta-4 [Myotis davidii]  clstr ali  38  1................................................................................................MSDKPDMAEIEKFDKSKLKKTETKEKNPLPSKE-------------SKLNPPSPLPGLRKTQVPPGMHRSSLQLNGHT............................................................................... 65
234 2.000e-05gi|514685264|ref|XP_004990211.1| thymosin beta-15A [Salpingoeca rosetta]  clstr ali  27  19.......................................................................TKQQQRQPRDKQVQRQRNIQAPLEAMSDQRDVKEVESFDRSKLKKVDVVEKNVLPTAEDIAADKLSDNQ................................................................................................................. 88
235 2.000e-05gi|946793282|ref|XP_014405601.1| PREDICTED: zonadhesin [Myotis brandtii]  clstr ali  14  219..LTGPSETPLSTEKPMAPTEKPTLPTEKTTLPTEKPTLPTEKPTLKPTLPTEKPTLPTEKPTLPTE-------------KPTLPTEKPTLPTEKPTTEKPTLP-TEKPTLPTEKPTLPTEKPTLPTKPTLTTEKPTPTEKPTLPTEKPTLPTEKSTLPTEKPTLPTEKSTLPTE--KPTLPTEKSTLPTEKPTEKSTLPTEKPTLPTEKSTLKPTLPTEKSTLPTEKPTVPKPTLSTEKPTVPTEKP..... 463
236 2.000e-05gi|662187831|ref|XP_008487563.1| PREDICTED: thymosin beta-4-like [Diaphorina citri]  clstr ali  26  11................................................................................................KVAEDLKSQLETFDSSKLNNTETLEKNVLPTKEDVLQERQHNDLIHS-------------------------VENFNADKLKRINTCEKIILPNAQ............................................................. 82
237 2.000e-05gi|961122924|ref|XP_014783166.1| PREDICTED: uncharacterized protein LOC106878465 isoform X1 [Octopus bimaculoides]  clstr ali  61....SFDKTKLNPTETQEKINLPEIDQEKTEQELRSNITEFDKNQLKHANVEEKNPLPDKQEKTEQELKASINKFDKADLKCTKTCEKGVLPTKADIAEEK........................................................................................................................................................ 164
238 2.000e-05gi|699027631|pdb|4PL7|A Chain A, Structure Of Komagataella Pastoris Actin-thymosin Beta4 Hybrid  clstr ali model  16  391.................................................................................................................................................................DKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESG................................................. 433
239 2.000e-05gi|1011580792|gb|KYO30273.1| toll-like receptor 7 isoform B [Alligator mississippiensis]  clstr ali  16  438.......................................................................................................................................WSAEEQLQRPELLLCRASVLGSAKMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA..................................................... 502
240 2.000e-05gi|871212086|ref|XP_005091491.2| PREDICTED: involucrin-like [Aplysia californica]  clstr ali  15  1............................................................................................MSSNKAPSDLIKEINQKDSTKLNHVDPKEKNPLPSAEDVQQERLHQRLSHAKTKQRHILPDTTIADERQHQSHMGNIAQFKRTSLKRTESQEKGCLPSQEVIVQEKTEARDRIGTFNKEQLKPTATEEKGVLPS........................... 149
241 2.000e-05gi|470655956|ref|XP_004330378.1| PREDICTED: thymosin beta-10-like [Tursiops truncatus]  clstr ali  38  1................................................................................................MAGEQDMGEITSFNKAKLKKTEAQEKNTLLTKETTEQEKQAE................................................................................................................... 42
242 3.000e-05gi|667290734|ref|XP_008577629.1| PREDICTED: putative thymosin beta-4-like protein 6 [Galeopterus variegatus]  clstr ali  41  5............................................................................................SSATRSDKRSMAEINKFDNLKLKKTETQEKNPLPSKEMIKQDKQAGES................................................................................................................. 52
243 3.000e-05gi|999970200|gb|KXJ09374.1| Collagen alpha-1(VII) chain [Exaiptasia pallida]  clstr ali  12  126...EELNNDRKQVKSPEPKKTAETTADDSTEVEPQGEXGSAPTEELNNDSKQVKSPEPEKATETPADDSTENSNVESQEEKNAVPTEEFNNDSKQLKSPEPEKTETPADDSTENSNVESQEKNAVPTEEDSKQTKSPEAEKTAEDLAKSTDESSDATVTEPFQHVKDEESN--------TETSSEDPEETMPELERE-----DETDELVKRQTIARIEPSXNCCPPKTFCPTLPPCQELASAAFAPEPVKAE. 379
244 3.000e-05gi|835994718|ref|XP_012780377.1| PREDICTED: titin-like isoform X1 [Maylandia zebra]  clstr ali  13 8505..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8733
245 3.000e-05gi|835994722|ref|XP_012780378.1| PREDICTED: titin-like isoform X2 [Maylandia zebra]  clstr ali  13 8380..............EAKEQKETPKDAWTRQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8608
246 3.000e-05gi|670980953|ref|XP_008702744.1| PREDICTED: late histone H2B.L4-like [Ursus maritimus]  clstr ali  59  63...............................................................................................KMSDKPDLSEVEKFDRSKLKKTNTKEK................................................................................................................................... 89
247 3.000e-05gi|674660328|ref|YP_009052475.1| pp1ab [Ball python nidovirus]  clstr ali  12 2599......................................EQFQEEKPQQVKPQEKPQEVKPQEKLHQEEKPQ----------QVKPQEKPQEVKPQEKLQQEEKQQVKPQEKPQ--EVKPQEK--LQQEEKPQQVKPKEKPQEVKPQEQLQEEKPQQVKPKEKPQEVKPQEQFQKEKNQEVKPQEKSIKP-FEQVQSLTIATQQPSNHTNTSSL........................................ 2761
248 3.000e-05gi|768187848|gb|KJH44494.1| thymosin beta-4 family protein [Dictyocaulus viviparus]  clstr ali  25.......KVELKKVSTLEKNILPTVTKERQHAAILSGIENFSANQLKHSPLEEKIALPSSEEKQHIELNQKIESFSVEQLRHAETDEKIVLPTKE.............................................................................................................................................................. 119
249 3.000e-05gi|586462574|ref|XP_006861925.1| PREDICTED: putative thymosin beta-4-like protein 6-like [Chrysochloris asiatica]  clstr ali  41  1................................................................................................MSDKLHMVETEKFNKSKLK-TEKHEKNPLPSNETIEQEKQAGES................................................................................................................. 43
250 3.000e-05gi|918655849|ref|XP_013363971.1| PREDICTED: LOW QUALITY PROTEIN: thymosin beta-15A [Chinchilla lanigera]  clstr ali  45  1................................................................................................MSDKPDLLKVEKFVRLKLKKTNTEXKNTLFSKEIRKWD....................................................................................................................... 38
251 3.000e-05gi|742091431|ref|XP_010895199.1| PREDICTED: thymosin beta-a [Esox lucius]  clstr ali  51  4..................................................................................................NNPVKQGVETFDKKCLKKTNTAEKNTLPTKEDIEQEKKAEK.................................................................................................................. 44
252 3.000e-05gi|602731783|ref|XP_007472099.1| PREDICTED: LOW QUALITY PROTEIN: thymosin beta 15a [Lipotes vexillifer]  clstr ali  50  1................................................................................................MSGKPDLSEVEKFDRSKLKKANTEGKSTLPSKETIXREKESVQSS................................................................................................................ 45
253 4.000e-05gi|586460310|ref|XP_006860812.1| PREDICTED: putative thymosin beta-4-like protein 6-like [Chrysochloris asiatica]  clstr ali  43  1................................................................................................MSDKLDMVKIEKFDKLKLRKTETQKKNPLPSKETIEQEKQAGAM................................................................................................................. 44
254 4.000e-05gi|908434494|ref|XP_013127228.1| PREDICTED: uncharacterized protein LOC100706016 isoform X1 [Oreochromis niloticus]  clstr ali  32  48..........................................................................................SPLPAKMSDKPDMTEIARFDXXXXXXXXXXXXNPLPTKETIEQERKGDA.................................................................................................................. 96
255 4.000e-05gi|521037657|gb|EPQ19434.1| Thymosin beta-4 [Myotis brandtii]  clstr ali  42  1................................................................................................MSDKPDMAEIERFDKSKLKKTETQKNSPLPSKE............................................................................................................................ 33
256 4.000e-05gi|731220761|ref|XP_010624599.1| PREDICTED: thymosin beta-15B [Fukomys damarensis]  clstr ali  53  1................................................................................................MSDKPDLLEVEKFDRSKLRKTNTEEK................................................................................................................................... 26
257 4.000e-05gi|586455512|ref|XP_006839580.1| PREDICTED: thymosin beta-4-like [Chrysochloris asiatica]  clstr ali  44  1................................................................................................MSSKPSVAEIEKFNKLKLKKTETQEKNPLPAEETIEQKQEGES.................................................................................................................. 43
258 5.000e-05gi|444525894|gb|ELV14189.1| Thymosin beta-10 [Tupaia chinensis]  clstr ali  47  42.......................................................................................................GDIASFDKAKLKKTETQ-KNTLLTKETTEQEKQSGIS................................................................................................................. 77
259 5.000e-05gi|585171752|ref|XP_006737844.1| PREDICTED: putative thymosin beta-4-like protein 6-like [Leptonychotes weddellii]  clstr ali  33  1................................................................................................MSHKHDMAEIEKLNKSKLKKIEMQEKN.................................................................................................................................. 27
260 6.000e-05gi|406855500|pdb|3TU5|B Chain B, Actin Complex With Gelsolin Segment 1 Fused To Cobl Segment  clstr ali model  55  269...............................................................................................................ARLRKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 297
261 6.000e-05gi|76161984|gb|AAX30141.2| SJCHGC00690 protein [Schistosoma japonicum]  clstr ali  24  18....................................................................................................KVLEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTEKQLQEIETPPSLKHTSTKEKNPLPTKDDIVAEKAIH................................................................................ 91
262 6.000e-05gi|640776811|ref|XP_008052662.1| PREDICTED: thymosin beta-15A-like [Tarsius syrichta]  clstr ali  58  1................................................................................................MSDKPDLSQMEKFDRSKLKKTNTEEKKIL................................................................................................................................ 29
263 6.000e-05gi|686735870|ref|XP_009244492.1| PREDICTED: putative thymosin beta-4-like protein 6 [Pongo abelii]  clstr ali  47  1......................................................................................................MAEVQQRDKSKLKKTEAQEKNPLPSKEMIEQEKQASES................................................................................................................. 38
264 7.000e-05gi|431906607|gb|ELK10728.1| Thymosin beta-4 [Pteropus alecto]  clstr ali  24  1................................................................................................MSDKLKMAEIENFNKLKSKKTKMQEKKPLPSKEMIEQRSKQNEELSANMHSHVSSPALLCRLSSSVVALQRAPR................................................................................... 77
265 7.000e-05gi|817357173|ref|XP_012303033.1| PREDICTED: thymosin beta-4-like [Aotus nancymaae]  clstr ali  43  1................................................................................................MADKLGKAEIEKFEKSKRKKTETQEKNPLPSKEAIEQEKQAGES................................................................................................................. 44
266 8.000e-05gi|521019656|gb|EPQ01444.1| Thymosin beta-10 [Myotis brandtii]  clstr ali  43  30..................................................................................................DKPDMGEVASFDKAKLKKTETQE-NTLPTKETIEQKKQSEMS................................................................................................................. 70
267 8.000e-05gi|761908378|ref|XP_011403686.1| PREDICTED: uncharacterized protein LOC105312607 [Amphimedon queenslandica]  clstr ali  12  562.......................TLPTKDRKRFVLSEVRRGHKADLKHVQPVEKSPNVDEGPKTVWTLQKEIASFSTSWLNKIKFREPKPTVPVRKMVNRKVFDEIESFSTDALTHVVPKVKTILPTKEDIQAEKLSSXXXXXXXXXXXXDNIPMKSKAPKQVTRVIGPAASNKTKMKPTKKSIVPPMPSQETT........................................................... 758
268 8.000e-05gi|658923607|ref|XP_008401519.1| PREDICTED: uncharacterized protein LOC103460981 [Poecilia reticulata]  clstr ali  44  75.............................................................................................SSKMGDNPVNQEVEQFNKQKLKKTNTEEKNRLPT.............................................................................................................................. 109
269 1.000e-04gi|938047620|gb|KPP57736.1| Thymosin beta-a-like [Scleropages formosus]  clstr ali  41  22...............................................................................................KMSDNPVKQEVQNFDKKCLKKTTTAEKNTLPTKEDIEQEKRAEASK................................................................................................................ 68
270 1.000e-04gi|585151038|ref|XP_006727959.1| PREDICTED: thymosin beta-10-like [Leptonychotes weddellii]  clstr ali  32  1................................................................................................MADKPDMGEIASFDKAKLKKMERQE-NTLPTKETTEQEKQNEISQEPRGFP.......................................................................................................... 50
271 1.000e-04gi|585149867|ref|XP_006727423.1| PREDICTED: thymosin beta-10-like [Leptonychotes weddellii]  clstr ali  38  1................................................................................................MAGKPDMGGVASFNKAKLKKMETQEKNTLPTKETVEQEKQSEIS................................................................................................................. 44
272 1.000e-04gi|987393003|ref|XP_015394091.1| PREDICTED: zonadhesin [Panthera tigris altaica]  clstr ali  13  820................TEKSTLPTEKPTPPTEKTPIPTEKSTLPTEKPTPPTEKTPIPTEKEKPTPPTEKTPIPTEKSTLKPTPPTEKTPIPTEKSTTEKPEKTPIPT-EKSTLKPTPPTEKTPIPTKSTLPTEKPTPTEKTPIPTEKSTLPT--EKPTPPTEKTPIPTEKSTLPTEKPTPPTEKTPIPT............................................................... 1009
273 1.000e-04gi|675860308|ref|XP_009015714.1| hypothetical protein HELRODRAFT_64710 [Helobdella robusta]  clstr ali  19.....FDSSKLKHTETQEKNVLPSTEV-ITQEKTIQHIEAFDKKNLKHAETEVKTTLPDKSVINQEKTIQNIEGFDKSNLKRASTEVKNPLPDKNSK............................................................................................................................................................ 109
274 1.000e-04gi|501299706|dbj|BAN21523.1| actin binding protein, putative, partial [Riptortus pedestris]  clstr ali  21  20.....................................................................................................LKSELETFKQDNMKKAATTEKNILPTAEDVQQEKQHNE-------------------------LILGVENFRADRLKRTNTKEKIVLPNAQDVEKTQKALLEGVEAFDPGRLKHTETNEKNPLP............................ 120
275 1.000e-04gi|754351531|ref|XP_004343713.2| hypothetical protein CAOG_06989, partial [Capsaspora owczarzaki ATCC 30864]  clstr ali  40  1................................................................................................MSDKDVIAGLGSFDKSKLKKADTNEKNALPSKDDLAAAKADPSQK................................................................................................................ 47
276 1.000e-04gi|972981322|ref|XP_015206983.1| PREDICTED: thymosin beta-a-like [Lepisosteus oculatus]  clstr ali  42  1................................................................................................MSDKPVKEEVKTFDKKCLKKTNTAEKNTLPTKEGETPERP..................................................................................................................... 41
277 2.000e-04gi|1012106673|ref|XP_015996008.1| PREDICTED: LOW QUALITY PROTEIN: thymosin beta-15A-like [Rousettus aegyptiacus]  clstr ali  48  1................................................................................................MSDKPELSEVEKYARSKLKKTNTEEKNALPSKETFQQEKECVQTSENED............................................................................................................ 49
278 2.000e-04gi|913514198|ref|XP_013209294.1| PREDICTED: thymosin beta-15B [Microtus ochrogaster]  clstr ali  64  1................................................................................................MADKLDMSEIEKFDRSKLKKTITEEKNTLPSKETIQQEK...................................................................................................................... 39
279 2.000e-04gi|281346811|gb|EFB22395.1| hypothetical protein PANDA_000271, partial [Ailuropoda melanoleuca]  clstr ali  38  1................................................................................................MSDNPYMAEIKKLGKLILRKTETQEKNPLPSKETTGQEKQADAS................................................................................................................. 44
280 2.000e-04gi|926633869|ref|XP_013782758.1| PREDICTED: uncharacterized protein LOC106466992 [Limulus polyphemus]  clstr ali  29  2......................................................................................................IEGVENFNRSALKQTNTEEKSVLPTKEEIILEK-------------------------GQQELLKNIQSYNPSNLRPTETVEKNPLPTKDVIELEKSAA.................................................... 75
281 2.000e-04gi|671412823|emb|CDP94224.1| BMA-TTH-1, isoform a [Brugia malayi]  clstr ali  13  24..................................................................................................................................AKEVTKGRLLKHVEISEKSVLPTALDMYEKVDENLKGEIKTHDTSKLRHAEVVEKNVLPTSVDIAREKVPT--LIVNFDTEKLKHVDPVVKIALPS........................... 118
282 2.000e-04gi|685826238|emb|CEF61282.1| Ciboulot [Strongyloides ratti]  clstr ali  11  2....................................................................................................................TSTFKNSPKLPTDITKDLLHGRELKHVATEEKNVLPTADVKTEKQHEEFVNGIETFPKNQLHKVETTDKTVLPSAGDIAIEKVPT--EVVNFNLDKLNHVEPQVKNVLPS........................... 110
283 2.000e-04gi|884917737|ref|XP_013009095.1| PREDICTED: thymosin beta-15B [Cavia porcellus]  clstr ali  53  1................................................................................................MSDKPDLSEVEKFDRLKLKKTNTEGK................................................................................................................................... 26
284 3.000e-04gi|1007788595|ref|XP_015830741.1| PREDICTED: thymosin beta-like [Nothobranchius furzeri]  clstr ali  34  42............................................................................................KAAIMSDKPDMTEISRFDXXXXXXXXXXXXNPLPTKETIEQERKGDA.................................................................................................................. 88
285 3.000e-04gi|930766880|ref|XP_014184726.1| PREDICTED: titin-like [Haplochromis burtoni]  clstr ali  14 8531......................PKDAWTQQKPGPKDEKPK-DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPE-KDTSPFQKGERRQVETSEKEPVEVKEPAKVPKPGDQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLFDRLAKQATEP-EKKPAEEKERRPTDDLPKRHTSPAETPEERKQQAKPKKPEIPEAPEKKP..................... 8751
286 3.000e-04gi|1005431935|ref|XP_015753615.1| PREDICTED: uncharacterized protein LOC107333324 isoform X1 [Acropora digitifera]  clstr ali  428....SFDKSKLKHVETEEKNPTPTLREELLPDELPDEITGFDPTKLKHVETQDKTHLPTKEEIKEEETRAEVKTFDHSKLKHVETEEKNALPSKSDLREEKAVA..................................................................................................................................................... 539
287 3.000e-04gi|281342918|gb|EFB18502.1| hypothetical protein PANDA_019403, partial [Ailuropoda melanoleuca]  clstr ali  39  9...................................................................................................KANMAEIEEFDKLKLKEREIQEKNPLPSTETIE......................................................................................................................... 41
288 3.000e-04gi|640781437|ref|XP_008046332.1| PREDICTED: thymosin beta-4-like [Tarsius syrichta]  clstr ali  41  1................................................................................................MPDTPNIAETEKF-KSNLKKTEMREKNPLPSKEMIGREKQAGES................................................................................................................. 43
289 3.000e-04gi|426367981|ref|XP_004050997.1| PREDICTED: thymosin beta-4-like [Gorilla gorilla gorilla]  clstr ali  39  1................................................................................................MSNTPNRAEIEKFDRSKLK-TEMQEKNPLLTAKAGKEERSGESEKE............................................................................................................... 49
290 4.000e-04gi|555957216|ref|XP_005890742.1| PREDICTED: thymosin beta-4 [Bos mutus]  clstr ali  47  1................................................................................................MSDKLGMAEFEKFDTSKLKKTETQEKNPLPSKETAEQEKHAGES................................................................................................................. 44
291 4.000e-04gi|402578878|gb|EJW72831.1| hypothetical protein WUBG_16263 [Wuchereria bancrofti]  clstr ali  4...........................EKVDENLKGEIKTHDTNKLRHAELVEKNVLPTSVDIAREKVPALIVNFDTEKLKHVEPVAKITLPSAND............................................................................................................................................................. 72
292 4.000e-04gi|227150233|gb|ACP19741.1| thymosin-repeated protein 2 [Eriocheir sinensis]  clstr ali  11  2.............SSEAPLKDLPKVDS-----VLKEQLEGFSPDKLKKTDTAEKTALPTDAEKGQQALCQGIEGFDPSALKKTETQEKNVLPTKEVIEQEK........................................................................................................................................................ 88
293 4.000e-04gi|759113839|ref|XP_011356311.1| PREDICTED: putative thymosin beta-4-like protein 6 [Pteropus vampyrus]  clstr ali  45  1................................................................................................MSDKLDMVEIEKFDKSKLKKTETQKKNPPPSKETIEQEKQRGKL................................................................................................................. 55
294 5.000e-04gi|470602793|ref|XP_004312853.1| PREDICTED: thymosin beta-10-like [Tursiops truncatus]  clstr ali  40  1................................................................................................MADKPDMAEIAGFNKAKLKTMETQEKNTLPTKETIEQEKQAK................................................................................................................... 42
295 5.000e-04gi|928026420|ref|XP_013861490.1| PREDICTED: thymosin beta-15B [Austrofundulus limnaeus]  clstr ali  35  37..........................................................................................LQKSANMSDNPVNEEVEHFNKKQLKKTNTQEKNHLPT.............................................................................................................................. 74
296 5.000e-04gi|808876634|gb|KKF25251.1| Titin [Larimichthys crocea]  clstr ali  10 11123.......................KIPSKAARVPIEEAVET------KKVEMREKIPVPKAEKTPEEKPRPAVKEPSPPKVPEAPVEEKVPVVSVPEKKEAPAPKEPEKVKKPAAVPSPPAETTEVPKKDERKPQVPAEPKKVARTAEPEPKAKPKAEPEPKAKPKAEPEPKAKPKKAKPKAEPEPKAKPKAEPEPK-AKPTPVPKAEPEAKPAVTVELEPEAKPAAVKKPVTPPSKVPEEAAKPEPAKIKPE. 11353
297 5.000e-04gi|301608958|ref|XP_002934042.1| PREDICTED: thymosin beta-10 [Xenopus tropicalis]  clstr ali  50  1................................................................................................MGDRPDLGEIDRFDKTKLKKTETQEKNTLPTKETIEQEKK..................................................................................................................... 40
298 5.000e-04gi|182636872|gb|ACB97647.1| thymosin beta [Paralichthys olivaceus]  clstr ali  53  1................................................................................................MSDKPDISEVTNFDRTKLKKTETDEKNTLPTKEVIEQEKSG.................................................................................................................... 41
299 5.000e-04gi|671412825|emb|CDP94226.1| BMA-TTH-1, isoform b [Brugia malayi]  clstr ali  25  9...............................................................................................EKVDENLKGEIKTHDTSKLRHAEVVEKNVLPT.............................................................................................................................. 40
300 5.000e-04gi|926609128|ref|XP_013781703.1| PREDICTED: thymosin beta-4-like [Limulus polyphemus]  clstr ali  1.............MSSPKKEDLPAVPSA-----MKDELANFDSGKMKHAHTVEKKVLPSTEEKEQQELLKGIKSYDPSKLRPTETQEKNELPTKETIA........................................................................................................................................................... 84
301 5.000e-04gi|671030186|ref|XP_008705882.1| PREDICTED: thymosin beta-4-like [Ursus maritimus]  clstr ali  40  1................................................................................................MSHKPDMAEIEKFSKSKLKKIETQEKNYYPQK............................................................................................................................. 32
302 5.000e-04gi|759141831|ref|XP_011365953.1| PREDICTED: putative thymosin beta-4-like protein 2 [Pteropus vampyrus]  clstr ali  43  1................................................................................................MSDTPDMAEIEKFDKS-------QEKNPRPSKEMTEQEK...................................................................................................................... 32
303 6.000e-04gi|152143913|gb|ABS29642.1| thymosin beta-4 [Holothuria glaberrima]  clstr ali  45  1................................................................................................MSDKPDVSEVTKFDKGKLKTVETQEKNTLPTKDTIDQEKAAS................................................................................................................... 42
304 6.000e-04gi|301622252|ref|XP_002940447.1| PREDICTED: thymosin beta-15B [Xenopus tropicalis]  clstr ali  48  1................................................................................................MSDKPDLSEVEKFDHRKLRKTNTEEKNTLPSKEVIEQEKAAGKDK................................................................................................................ 45
305 6.000e-04gi|672186394|ref|XP_008814298.1| hypothetical protein C922_00460 [Plasmodium inui San Antonio 1]  clstr ali  11 4590.........................EGKKEEAPFETPVKSADKRKTNEHKTDES----KTEESKTEESKTDESKTDESKTDEPKTEEKTDEPKTEEKTDEP-KTEESKTDESKTDESKTDEKTDEPTEESKTDEPKTEESKTDEPKTEESKTDEPKTEESKTDEPKTEESKTDEPKTEESKTDGRNTKETEENVNECKSSLNKENANDKERPILND..................................... 4785
306 6.000e-04gi|908506787|ref|XP_013064286.1| PREDICTED: uncharacterized protein LOC106053297 isoform X3 [Biomphalaria glabrata]  clstr ali  16  6..............................................................................................AKTAPTELLAEINKSGSTNLHHVNPQEKNPLPSAEVIAEEKHHQEHIEN-------------------------ISKFKRTSLKRAESMEKGCLPSQDVINQERTEARDRIGSFNKDQLKHTTTEEKTVLPS........................... 114
307 7.000e-04gi|961884344|ref|XP_014898716.1| PREDICTED: titin isoform X2 [Poecilia latipinna]  clstr ali  14 8038..............................................KKVPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8211
308 7.000e-04gi|657792649|ref|XP_008323197.1| PREDICTED: thymosin beta-4 [Cynoglossus semilaevis]  clstr ali  50  1................................................................................................MSDKPDVSEVEKFDKSKLKKTETQEKNPLPTKEIIEQEKADTKS................................................................................................................. 44
309 7.000e-04gi|341897127|gb|EGT53062.1| hypothetical protein CAEBREN_28154, partial [Caenorhabditis brenneri]  clstr ali  1269...................EEKPKSPTSKKDKSPEKSLTEEVKSPTKKEKSPEKPSSPT------KKTEDEVKSPAKKEKSPEKTEEKPTSPIKKEKSEKPVEEKPLSPVKKSSDESETP-KSPVKTTGDKTPSSPTSKKSPPGSPKKAKSPEKVEEAVKSPTKKEKSPEKAATEEVKSPVKKEKSPEKTSEEVKKKDKSPEKSSTGEVKSPTKKEKSPEKPSSPIKKEKSPEKA.................. 1481
310 7.000e-04gi|20140817|sp|Q9I980.3|TYB10_TORMA RecName: Full=Thymosin beta-10; Short=Thymb10  clstr ali  50  1................................................................................................MADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS................................................................................................................. 44
311 7.000e-04gi|675672630|ref|XP_009000458.1| PREDICTED: putative thymosin beta-4-like protein 2 [Callithrix jacchus]  clstr ali  40  1................................................................................................MPDKPAMVEIKKFNKLKLKNTETQEKNLLPSKETTEQKQAGKSQRGMHTN........................................................................................................... 50
312 7.000e-04gi|831274676|ref|XP_012686589.1| PREDICTED: thymosin beta-a-like [Clupea harengus]  clstr ali  40  1................................................................................................MSDNPVKQEVQTFDKKCLKKTSTAEKNNLPTKEDIEAEKKAVAES................................................................................................................ 46
313 7.000e-04gi|585169979|ref|XP_006737021.1| PREDICTED: putative thymosin beta-4-like protein 2-like [Leptonychotes weddellii]  clstr ali  40  1................................................................................................MSDKPQKAEVEKFDKLKLKKIEKQEKNPLSSKEMTEEEKQTGKS................................................................................................................. 44
314 8.000e-04gi|675240321|emb|CDZ14420.1| cyclin-related protein, putative [Plasmodium yoelii]  clstr ali  3372........EKTEITEHTEKTEITEHTEKAEHTEIIQMIKSENTEHTEKAEHTEKAEHTEIIQMIKSENTEHTEKAEHTEIIQMIKSEKAENTEHTEKAEKTEHTEIIQMIKSEHEHTEKAEK-TEHTEKAEHTEKAEKTEHTEHTEKAEKTEHTEHTEKAEKTEHTEIIQMIKSENTEHTEKAEKTHTEKAEKTETEKAEHTEKAEKTEIIQMIKSEKTEK................................ 3586
315 8.000e-04gi|576695538|gb|EUB59106.1| hypothetical protein EGR_06098 [Echinococcus granulosus]  clstr ali  25  8.....................................................................................................VLAEVGDFQKDKLKHVDPTVKNVLPTADDVKHEKQGTHLKKVTTVEKNPLPTKEATSDSE............................................................................................ 77
316 8.000e-04gi|229365818|gb|ACQ57889.1| Thymosin beta-4 [Anoplopoma fimbria]  clstr ali  48  1................................................................................................MSDKPDVSEVSSFGKSKLKKTETQEKN.................................................................................................................................. 28
317 1.000e-03gi|158518390|sp|P33248.2|TYB12_LATJA RecName: Full=Thymosin beta-12  clstr ali  50  1................................................................................................MSDKPDISEVTSFDKTKLKKTETQEKNPLPSKETIEQEKAAATS................................................................................................................. 44
318 1.000e-03gi|586470921|ref|XP_006866051.1| PREDICTED: putative thymosin beta-4-like protein 1-like [Chrysochloris asiatica]  clstr ali  40  1................................................................................................MSYKPDMAKTEKFEKSKLKKTEMQEKNLLPLKEMIEQEKQAGKSCLT.............................................................................................................. 47
319 1.000e-03gi|198431357|ref|XP_002125878.1| PREDICTED: thymosin beta-12 [Ciona intestinalis]  clstr ali  21  3................................................................DRPDLAEVSEFDKTNLKKAKTCEKSVEGYAQEKA----LKEIGQFQKDKLKHTDTEVKNKLPTQQEIDQEK...................................................................................................................... 71
320 1.000e-03gi|586453926|ref|XP_006835872.1| PREDICTED: thymosin beta-4-like [Chrysochloris asiatica]  clstr ali  45  1................................................................................................MSDKPNKTGIEKFNKLKLKKTETQEKNPLPSKETIEWEKHTGES................................................................................................................. 44
321 1.000e-03gi|755856214|ref|XP_005177080.2| PREDICTED: titin [Musca domestica]  clstr ali  13 4140.................EEKNLETEPKKPEEKDVKSTAAKADVSEVKPEKVEEKKVEAEAKKPEEKDVKSAAAKAEVSEVKPEKAEEKKVEVETKKPEEKDVKSDAAKLEKVEEKKMEAEAKKPE-EKDIKSPTAKAEEVKSEKVEEKKVEAEAKKPEEKDVKSAAAKAEVSEVKPEKAEEKKVDTELKKPEENDVKSTAAKAEVSEVKAEKAEEKKVEAEAKKPEEKDVKSAAAKAEVSEVKPEKA...... 4377
322 1.000e-03gi|961884375|ref|XP_014898723.1| PREDICTED: titin isoform X9 [Poecilia latipinna]  clstr ali  13 8037.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8246
323 1.000e-03gi|586494572|ref|XP_006877730.1| PREDICTED: thymosin beta-15A-like [Chrysochloris asiatica]  clstr ali  46  1................................................................................................MSDKLDLAEVEKFGKLKLKKTNTEEKNTLLCKDTIQQEKECVQ.................................................................................................................. 43
324 1.000e-03gi|1012183499|ref|XP_016008048.1| PREDICTED: titin isoform X1 [Rousettus aegyptiacus]  clstr ali  15 8857...............................................HTEEEVSVTVPEVQKKTVTEEKIHV-----AVSKKIEPPPKVSEPPKKEMIPVPIPKKVEP-PPAKVKKPVPEEKKPVPKKEPAAPPKVPEVPKKPVPEEKMPVPIAKKKEVPPAEVPEVQKRVFTEEKITIITQREESPPPAVPEIPKKKVPEEKRPIPRKKEEIPPPQVPAKKPVPEEKVSVPVP................... 9049
325 1.000e-03gi|908515714|ref|XP_013120145.1| PREDICTED: titin-like [Oreochromis niloticus]  clstr ali  15 8361.........................................DTISLKKTKEEESAPPSTALKKVKKLPLDEVEP-EVVKLKPFEKPLKPAEDPEKDKKERPEKDQVETTEPPKQSEKEPVEVKELPAKQKKSPEKEPEEDKRPKKVKKIPTVEPEIETVKLKPFDRLAKQATEPEK-KPAEEKERSPAETPEERKQKAKPKKPEIPE--APEEKPVKPEKVDVAPLEKTSVPAPA.................. 8584
326 1.000e-03gi|409711842|gb|AFV39707.1| beta-thymosin 1 [Pacifastacus leniusculus]  clstr ali  2.............STEAAIKDLPKV-----DTALKGQLEGFSPDKLKKTDTAEKSTLPTDAEKGQQALREGIEGFNPSALKKTETLEKCKLPTKEE............................................................................................................................................................. 83
327 1.000e-03gi|844846538|ref|XP_012794623.1| hypothetical protein MS3_03084 [Schistosoma haematobium]  clstr ali  29  6....................................................................................................KVLEDIDGFDKQKLRHVETEEKVVLPNKEVIEKEKTEKQLKRTSTKEKNPLPTKEGMYYPSKILLKK...................................................................................... 82
328 1.000e-03gi|918298052|gb|KOF73313.1| hypothetical protein OCBIM_22038101mg [Octopus bimaculoides]  clstr ali  17  11...............................................................................................TTSPRPFLDEIKTTKKDDLQHIDVQEKTALPTKTEIDQEKTEQELRSNITE-------------------------FDKNQLKHANVEEKNPLPDKDTIKQEKQELKASINKFDKADLKCTKTCEKGVLP............................ 117
329 1.000e-03gi|999983717|gb|KXJ22858.1| Thymosin beta-12 [Exaiptasia pallida]  clstr ali  15  56................................................................................................................................................................SDKPDISEVTKFDKSKLKKTETQEKNPLPTKETIEQEKQA..................................................... 95
330 1.000e-03gi|931611056|ref|XP_014198870.1| PREDICTED: thymosin beta-4 [Pan paniscus]  clstr ali  15  135................................................................................................................................................................SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA..................................................... 174
331 1.000e-03gi|565318421|gb|ETE69694.1| hypothetical protein L345_04500, partial [Ophiophagus hannah]  clstr ali  57  1................................................................................................MCDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETL.......................................................................................................................... 35
332 0.002gi|285443|pir||S22426 thymosin beta-12 - rainbow trout  clstr ali  47  3.................................................................................................SDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA.................................................................................................................. 44
333 0.002gi|589994679|ref|XP_006997974.1| PREDICTED: thymosin beta-15A [Peromyscus maniculatus bairdii]  clstr ali  51  1................................................................................................MSDNLDLSEVERFDRTRLKKTNTEEKNTLPPKETIQQEKEFVK.................................................................................................................. 43
334 0.002gi|260064041|ref|NP_001159390.1| beta thymosin-like protein 2 [Danio rerio]  clstr ali  46  1................................................................................................MSDNPVKAEVQNFDKKCLKKTNTEEKNVLPTKEDIEQEKKAGE.................................................................................................................. 43
335 0.002gi|444514108|gb|ELV10537.1| Thymosin beta-10 [Tupaia chinensis]  clstr ali  31  46..........................................................................................EPGFEGTTDQPDLGEMASFDKAKLKKTESQE-NTLSTRETTERDALPTG--ETTERDALPTGETTER................................................................................................ 109
336 0.002gi|209731244|gb|ACI66491.1| Thymosin beta-11 [Salmo salar]  clstr ali  40  1................................................................................................MSDKPNMREISSFDKTRLKKTETRVKNPLPTKETIDQERKRESS................................................................................................................. 44
337 0.002gi|657533820|ref|XP_008273871.1| PREDICTED: thymosin beta-4 [Stegastes partitus]  clstr ali  53  1................................................................................................MADKPDVTEVENFDKSKLKKTETQEKNTLPTKETIEQEK...................................................................................................................... 39
338 0.002gi|1005938870|ref|XP_015795144.1| PREDICTED: uncharacterized protein LOC107371538 [Tetranychus urticae]  clstr ali  20  3............................................................LPTITITDELKSEITAKHQLKHVETMEKTSLPIEKEKSQLDLLKSIVNFDKSKLKPTITLNKVVLPTKDIMKEEKQANK.................................................................................................................. 86
339 0.002gi|847006520|ref|XP_012803480.1| PREDICTED: leucine-rich repeat-containing protein 37A3-like [Jaculus jaculus]  clstr ali  39  286..............................................................................................KKAADQPDVGEIAKFHKAELKKTEPQEKNTLLTKQTTQQEKWSAIS................................................................................................................. 331
340 0.002gi|961884367|ref|XP_014898721.1| PREDICTED: titin isoform X7 [Poecilia latipinna]  clstr ali  13 7748.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 7957
341 0.002gi|961884341|ref|XP_014898715.1| PREDICTED: titin isoform X1 [Poecilia latipinna]  clstr ali  13 8037.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8246
342 0.002gi|961884348|ref|XP_014898717.1| PREDICTED: titin isoform X3 [Poecilia latipinna]  clstr ali  13 7866.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8075
343 0.002gi|961884354|ref|XP_014898718.1| PREDICTED: titin isoform X4 [Poecilia latipinna]  clstr ali  13 7844.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8053
344 0.002gi|961884363|ref|XP_014898720.1| PREDICTED: titin isoform X6 [Poecilia latipinna]  clstr ali  13 7788.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 7997
345 0.002gi|961884386|ref|XP_014898726.1| PREDICTED: titin isoform X12 [Poecilia latipinna]  clstr ali  13 8037.........QKKVPEEPVKKEVAAPPPPSVPQKVQKEAEEPQKKTVK-VPVEEKVPLPKAAKKEPKAAPPKEEPAQKDKLKPQQKSDQKMPDEEAVLGKKP-----EKISETAARKAEVKEKTPMPESKQEVVQKVVAERIPEKIQEKIPLPEKISEKRPEKISEKLPEKEKHPEKI-----SEKLPEKIPEKIQEKISEKRPEKVSEKLPEKIPEKLPEK................................ 8246
346 0.002gi|934146868|gb|KPL97739.1| hypothetical protein QR98_0003000 [Sarcoptes scabiei]  clstr ali  19  2.......................................................SSPTKEELPKIAECLKSELVGEHKLKHAETQEKVVLPIEQEKGQQELLKSIEEFQPEQLHHTSTEIKNPLPTKEEIEAEKKA.................................................................................................................... 87
347 0.002gi|301598532|pdb|3M3N|W Chain W, Structure Of A Longitudinal Actin Dimer Assembled By Tandem W Domains  clstr ali model  21  18............................................QLKKVEQNSRPVSASGRDALLDQIRQGI------QLKKVEQNSRPVSASGRDALLDQIRQGI------QLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 101
348 0.002gi|1005947130|ref|XP_015781873.1| PREDICTED: uncharacterized protein LOC107359814 [Tetranychus urticae]  clstr ali  18  2.......................................................SSPTKDDLKTIADELKSEITSEHHLKHAETKEKNKEAIETEKAQQELLQGIANFDKAQLKPTETQEKVVLPTKDVIEEEKQAAKE................................................................................................................. 91
349 0.002gi|1012183531|ref|XP_016008057.1| PREDICTED: titin isoform X9 [Rousettus aegyptiacus]  clstr ali  15 10069...............................................HTEEEVSVTVPEVQKKTVTEEKIHV-----AVSKKIEPPPKVSEPPKKEMIPVPIPKKVEP-PPAKVKKPVPEEKKPVPKKEPAAPPKVPEVPKKPVPEEKMPVPIAKKKEVPPAEVPEVQKRVFTEEKITIITQREESPPPAVPEIPKKKVPEEKRPIPRKKEEIPPPQVPAKKPVPEEKVSVPVP................... 10261
350 0.002gi|990034442|ref|XP_015455731.1| PREDICTED: thymosin beta-4-like [Pteropus alecto]  clstr ali  43  1................................................................................................MSNKPYMAETERFDKLKLMKIETQEKNLLPSKEIIEQEKEVSKL................................................................................................................. 44
351 0.002gi|148691934|gb|EDL23881.1| RIKEN cDNA 4930488E11, partial [Mus musculus]  clstr ali  30.........................ADKMSDKPDLSEVETFDKSKLKKTNTEVKNTLPSNENKSDKPDLSEVETFDKAKLKKTNTEVKNTLPSKETIQQEKEHNE.................................................................................................................................................... 110
352 0.002gi|826331252|ref|XP_012513023.1| PREDICTED: thymosin beta-4 [Propithecus coquereli]  clstr ali  15  37.....................................................................................................................................................PRPSLRFSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA..................................................... 87
353 0.002gi|755819999|ref|XP_011277731.1| PREDICTED: thymosin beta-15B [Felis catus]  clstr ali  18  169................................................................................................................................................................GDKPDLSEVEKFDRSKLKKTNTKEKNTLPSKETIQQEK....................................................... 206
354 0.002gi|1009529734|ref|XP_015926434.1| PREDICTED: uncharacterized protein LOC107453875 isoform X6 [Parasteatoda tepidariorum]  clstr ali  12  12..................................................................................................................................................SSLKMSSPSKENLPKVPPLKDELAQFDSSKMKHTETQEKCSLPSKDDVQQEKAHNSTGVEGFERSRLNSVETQEKVILP............................ 93
355 0.002gi|556956099|ref|XP_005989389.1| PREDICTED: thymosin beta-12-like [Latimeria chalumnae]  clstr ali  45  1................................................................................................MADKVELAEIQSFDHTKLKKTETKEKNPLPTKETIEQEKQNQ................................................................................................................... 42
356 0.002gi|594671611|ref|XP_007183746.1| PREDICTED: thymosin beta-4-like [Balaenoptera acutorostrata scammoni]  clstr ali  56  14..............................................................................................................KSKLKKTETQEQNPLPSKETIEREKQAGES................................................................................................................. 43
357 0.003gi|972967519|ref|XP_015200933.1| PREDICTED: thymosin beta-b-like [Lepisosteus oculatus]  clstr ali  50  1................................................................................................MADKPSLDEISQFDKSKLKKTETHEKNTLPTKETIAQEKQGENS................................................................................................................. 44
358 0.003gi|443725639|gb|ELU13150.1| hypothetical protein CAPTEDRAFT_202591 [Capitella teleta]  clstr ali  13  130.............................................LQHEQTEPKNQTPTQRDRSQEPA-----------LQHEQTEPKNQTPTQRDRSQEP-----------ALQHEQTEPKNQTPTQRDRSQESL---LQHMQTEPNNQTLTQLDRSQEPALQHMQTEPNIDRSQMQHMQTEPNNKTPTQRDRSR......................................................... 264
359 0.003gi|156144966|gb|ABU53029.1| beta-thymosin [Haliotis diversicolor]  clstr ali  50  1................................................................................................MGDKPDVSAVATFDKSKLKKTDTEIKNPLPTKETIEQEKAEQ................................................................................................................... 42
360 0.003gi|831552515|ref|XP_012728725.1| PREDICTED: thymosin beta-10-like [Fundulus heteroclitus]  clstr ali  45  1................................................................................................MSDKPDITEVTTFDKAKLKKTETQEKNTLPTKETIEQEKEKTES................................................................................................................. 44
361 0.003gi|20140815|sp|Q9I954.3|TYBB_CYPCA RecName: Full=Thymosin beta-b  clstr ali  48  1................................................................................................MADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA.................................................................................................................. 43
362 0.003gi|321467016|gb|EFX78008.1| hypothetical protein DAPPUDRAFT_105663 [Daphnia pulex]  clstr ali  15 2348..............ESEEKDRLQKEAEEKDRL-LKEEEEKQRIQK----ESEEKDRLQKEAEEKDRLLKEEEEKQRIQK----ESEEKDRLQKEAEEKDRLLKEEEEKQEKDRLQK-ETEEKDRLL-KE--KEEKQRMQKESEEKDRLQKEAEEKDRLLKEEEEKRRIQKESEEKDRLQKETEEKDRLLKEEEEKQRMQKESEEKDRLQKEAEEKDRLLKE................................ 2548
363 0.003gi|82704545|ref|XP_726599.1| hypothetical protein, partial [Plasmodium yoelii yoelii 17XNL]  clstr ali  13 1576.........................................KTEHTEHTEKAEKTEHTEIIQMIKSENTEHTEKAEKTE--HTEKAEKTEHTEKAEHTEKAEKTEIEKTEKAEHEHTEKAEK----TEHTEKAEHTEKAEKTEHTEKAEHTEKAETEKAEKTEHTEKTEKAEHTEKTEKAEKTEKTEMPAKSEHTEMPTKSEHTEKAENTEHTAHTK.................................... 1767
364 0.003gi|724862166|ref|XP_010369263.1| PREDICTED: uncharacterized protein LOC104668304 [Rhinopithecus roxellana]  clstr ali  15  86................................................................................................................................................................SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA..................................................... 125
365 0.003gi|1005431938|ref|XP_015753616.1| PREDICTED: uncharacterized protein LOC107333324 isoform X2 [Acropora digitifera]  clstr ali  395....SFDKSKLKHVETEEKNPTPTLREELLPDELPDEITGFDPTKLKHVETQDKTHLPTKEEIKEEETRAEVKTFDHSKLKHVETEEKNALPSKSDLREEKAVA..................................................................................................................................................... 506
366 0.003gi|281350991|gb|EFB26575.1| hypothetical protein PANDA_014770, partial [Ailuropoda melanoleuca]  clstr ali  35  1................................................................................................MFHKPDMAKIEKIVKSKLK-TEAQEKNPVPSKEALEQMKQARE.................................................................................................................. 42
367 0.003gi|281338127|gb|EFB13711.1| hypothetical protein PANDA_007172, partial [Ailuropoda melanoleuca]  clstr ali  37  5..............................................................................................ATMSDKPGLPETEKFGKSKRKKTETQERNSLPSRD............................................................................................................................ 39
368 0.003gi|670988903|ref|XP_008685459.1| PREDICTED: putative thymosin beta-4-like protein 6 [Ursus maritimus]  clstr ali  34  1................................................................................................MSDVHNMAEIEKFNKSKSKKIET------PSKDTIEPEKQAGES................................................................................................................. 38
369 0.004gi|640823885|ref|XP_008068987.1| PREDICTED: thymosin beta-4-like [Tarsius syrichta]  clstr ali  39  1................................................................................................MSDTPDTGEIEKFNTSKLKKPETQEKNLLPSKEMVKQEKQAGESKAKE............................................................................................................. 48
370 0.004gi|256017089|dbj|BAH97323.1| thymosin beta-11 [Danio rerio]  clstr ali  47  1................................................................................................MSDKPNLEEVTSFDKTKLKRTETQEKNPLPSKETIEQEKQAGSS................................................................................................................. 44
371 0.004gi|675235006|emb|CDU20792.1| cyclin-related protein, putative [Plasmodium yoelii]  clstr ali  3372........EKTEITEHTEKTEITEHTEKAEHTEIIQMIKSENTEHTEKAEHTEKAEHTEIIQMIKSENTEHTEKAEHTEIIQMIKSEKAENTEHTEKAEKTEHTEIIQMIKSEHEHTEKAEK----TEHTEKAEEKAEKTEHTEKTEKAEHTEKTEKAEKTEHTEKTEM----PAKSEHTE------MPTKSEHTEKAENT.................................................... 3553
372 0.004gi|17551492|ref|NP_509430.1| Tetra THymosin (four thymosin repeat protein) [Caenorhabditis elegans]  clstr ali  54..IEHFDSTKLHSTPVKEKIVLPDIKQEKQHLELTDKINNFPSENLKKTETIEKNVLPSPTDVAREKTLQMAASFDKSALHHVET........................................................................................................................................................................ 139
373 0.004gi|154426286|ref|NP_001093905.1| thymosin beta homologue [Ciona intestinalis]  clstr ali  15  28......................................ASGENAKEEPAQDQQKVEEKTEEPKQEEDKPAEQEEQKVXXXXXXXXXXXXXS-TTPEMADKPKMTEVTEFDKNKLKGTQTQEKQALPTKEQLMDEKS-----------------------------RAEAASYDHSQMKHVEPAEKNTL--KDDYLREKLPG--QVASVNKESLKHVETQEKNPLPS........................... 181
374 0.004gi|692110355|ref|NP_001289027.1| uncharacterized protein LOC101896981 [Musca domestica]  clstr ali  14  3.......................................................................................................................................................APALKDLPKVAENLKSQLESFDTEKLKNANTQEKIILPTAEDVEKTQKSLFAGIESFNPSNLKHTETQEKNPLP............................ 78
375 0.004gi|684372641|ref|XP_009164167.1| hypothetical protein T265_01793 [Opisthorchis viverrini]  clstr ali  16  14.......................................................................ISKFDKSGLGHVVPEEKVAEEIQHEKTEKQLLEEITH--HPKLRRASNLEKNPLPTPEVFAQEKKEKQ.................................................................................................................. 83
376 0.004gi|507707315|ref|XP_004716667.1| PREDICTED: thymosin beta-15A-like [Echinops telfairi]  clstr ali  53  1................................................................................................MSNKPALSEVEKFNKSKLKETNTKEK................................................................................................................................... 26
377 0.005gi|586528720|ref|XP_006919279.1| PREDICTED: thymosin beta-4-like [Pteropus alecto]  clstr ali  50  8.................................................................................................SDKPDKTEIEKFAKSKLKKTEMQEKNPLPSKETIEQEKQAGE.................................................................................................................. 49
378 0.005gi|507953720|ref|XP_004684676.1| PREDICTED: thymosin beta-4-like [Condylura cristata]  clstr ali  40  1................................................................................................MSDKPDVTEIEKFSKLKSKKTEMQEKNPLPSKETTEQEKQASES................................................................................................................. 44
379 0.005gi|268561066|ref|XP_002646356.1| Hypothetical protein CBG12070 [Caenorhabditis briggsae]  clstr ali  11 1538.......KSPTKKEKSPEKPTSPTKKTEDSPFPPKSPT----KIEEKPSSPTQKKSPPASPKKAKSP--EKFEEAVKSPTKKEKSPEKMADPTSPTQKDKP-PEQVEKKPTSQTKKEKSPEKST--TEEVKTPIKKEKSPEKSATEEVKSPTKKEKSPEKPTSPTKKTAEEAVKSPTKKEKSEEKPKSPTKEEKSPEKSTGAEDVKSPIKKERSPDTVVEK................................ 1751
380 0.005gi|1000777201|gb|KXN68504.1| hypothetical protein CONCODRAFT_166505 [Conidiobolus coronatus NRRL 28638]  clstr ali  302.......................KSPYPPSLPMSMDDIVDLESSKLKELDLNEKSLNESDMSEIKEELLKAIKLFNKSNLNHVELNESGKSDLNNFMLNEELLKAIKLFNKSSLNHIELKE----PSNSFNFNDELLKAIRLFSKSSLNHVEPEESSNSFKNKQLLEAIKLFSKSSLNHVEPEE..................................................................... 463
381 0.005gi|821035588|ref|XP_012356370.1| PREDICTED: thymosin beta-4 isoform X1 [Nomascus leucogenys]  clstr ali  10  48........................LSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGE...................................................................................................................................................................................... 94

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.