current user: public




KOG4794
Query: [N] KOG4794 Thymosin beta, from COG0312

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst MCLWSLEQDQCSGSNFYNDERLPQLKACFLIIPCPNPAVRFPDCSVPTSFSREHCRPIHIFRENKGRGKVGNEDGERTKFDLCNSRGQISEDRKNVRENQPVFSVEVKFDRSKLKKTNTGEKNRLSSKETIQQEKYGPSFRSQKAEEKLPQGGASGRADPGDLTLRRLERRIHTTQLFAAGTRRPAGDPALEKRQRRGLASWRGARTTRARLAAPASLPRKQGAPRCARGFPGPAFQSLSGFRPTPAPLRAEMLast
1 4.000e-30NEWGM DROPS Contig7912_Contig3737|GENSCAN_predicted_peptide_28|484_aa|Drosophila pseudoobscura|Baylor  ali  20  359...........................................................TAPALKDPKVAENLKSQLEGFNTEKLKNASTQEKAAEKTQQSIFEGITAFDQNNLKHTETNEKNPLPDKEAIEQEKEKNQFI----------------AGIENFDAKKL-KHTETNEKNVLPTKEVIEAEKKA............................................................. 484
2 1.000e-19gi|1170517|sp|P45386.1|IGA4_HAEIN RecName: Full=Immunoglobulin A1 protease autotransporter; Contains: RecName: Full=Immunoglobulin A1 protease; Short  clstr ali  14 1073.........................................STETAPKSDTAQTENPSESVPSETTEKVAENPPQENETVAKNEQEATEPTPQNGEKEDQPTVEANTQTNEAKTEETQTAETKSEPTESVTVSENQPEKTVSQSTEDKVVVEKE----EKAKVETEETQKAPQVTSKEPAPEEVPTDTNAEEAQALQQTQ---PTTVAAAETTSPNSKPTQQPSEKTNAEPVTPVVSENTATQPTETEETAKV 1295
3 2.000e-19gi|338724284|ref|XP_003364906.1| PREDICTED: hypothetical protein LOC100629306 [Equus caballus]  clstr ali  29  1................................................................................................MSDTPDQAEIEKSDKLKLKKADTQEKNLLPSKEMIELVKQTDRRILMRHAANMPHCLRKSRGERVTWVSRLVELRINTERNCTAAATESAERPACAQRNPAGLSAAVSAYAGPGGLSAPRIAPR................................. 143
4 5.000e-19gi|91077296|ref|XP_976221.1| PREDICTED: similar to thymosin beta isoform 2 [Tribolium castaneum]  clstr ali  14  20.................................LKSELEGFKPTNLKNADTQEKI-VLPSAEDVAAEKTEKALIAGIEHFDPSKLKHTETQEKNPEKNHLNLLNGVEHFDKATMKHTTTAEKIVLPDNEVIEQEK----------------GQRQLISGIENFDSSKL-KHAETCEKNPLPTKEIIDQEKSA............................................................. 169
5 1.000e-17gi|149689076|gb|ABR27867.1| thymosin beta [Triatoma infestans]  clstr ali  16  20.................................LKSQLEGFNHDNMKKASTTEK-NILPSAEDVATEKTQKALLEGVEAFDTGKLKHTETQEKNPEKVHQNLISGVEGFDKASMKHTQTQEKNILPDPEAIEAEK----------------GQQKLIAGIENFDHKKL-KHTETQEKNPLPTKEAIDQEKSA............................................................. 169
6 5.000e-17gi|346467337|gb|AEO33513.1| hypothetical protein [Amblyomma maculatum]  clstr ali  20  75....................................................................................PSQTCTMDKHPKVADE-IQQELASFNAASLKHTETQEKVTLPSKEDIESEKEHKQMIE----------------GIESFDPSKL-KHAETSVKNPLPTKEVIEQEKAA............................................................. 164
7 6.000e-17gi|42784018|ref|NP_981265.1| S-layer-like domain-containing protein [Bacillus cereus ATCC 10987]  clstr ali  12  51....................................................QKQLEAAKEREMKLEKREEILKQQEELFIKDDLKQKKEELLEQAGEHNVQIEEVQELNELKKQQEELEEKNPLQVKSN-DQEKKTNELKSQEELKEKDGVEVKENNGQEEKVHDELRKQQEELKKQQLELEQRIKQELERKQQEEQAKQ--ELELKQKEEQAKRELELKQKEEQVKQELELKQKEE............... 251
8 5.000e-16gi|332258180|ref|XP_003278176.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin-like [Nomascus leucogenys]  clstr ali  14  524......................PSVATEKPTVPKEKPTILTEKPTIPTEKPTEK--PTITSEKLTIPTEKPTIPSEKPTIPSEKPKPTIPSEKPTIPSEKPTIPSEKPTIPS-EKPTIPTEKPTIPSKPSIPTEKPSISTEKPTISPEKPTISPEKPTIPTEKPTISTEKPTVSTEELAIPTEKPTLPPTEKPTIPS--EKPTIPTEKPTIPSEKPTIPTEKLTIPTEKPTIPMEKPTISTEKPTISTEK... 796
9 1.000e-15gi|346466849|gb|AEO33269.1| hypothetical protein [Amblyomma maculatum]  clstr ali  13  41...............................................RGQNPSGYLPSQTCTMDKHPKVADEIQQELASFNAASLKHTETQEKQQEKIHNSLLEGVEQFEKTSMKHAQTQEKVCLPKKEDIESEKEHKQMIE----------------GIESFDPSKL-KHAETSVKNPLPTKEVIEQEKAA............................................................. 177
10 3.000e-15gi|332865736|ref|XP_003318570.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin [Pan troglodytes]  clstr ali  15  809......................PTIPIEKPTISTEKPTISTENPPSPRKETTEKPTISPEKPTISIEKEKPTIPIEETTI--STEKPTIPTEKSTISPEKPTIS-MEKPTTPTEKPTIPIEETTISTKLTIPTEKPTISPEKPTISTEKPTIPTEKPTIPTEKPTIPTEETTISTEKLTIPTEKPTISPISPEKLTIPTEKPTISMEKPTIPTEKPTIPT-EKLTALRPPHPSPTATGLAALVMSPHAPSAPM 1048
11 5.000e-15gi|91077294|ref|XP_968496.1| PREDICTED: similar to thymosin beta isoform 1 [Tribolium castaneum]  clstr ali  20  4........................................................PVPAPALKDLPRVAGDLKSELEGFKPTNLKNADTQEKAAEKTEKALIAGIEHFDPSKLKHTETQEKNPLPDKDVIEQEK----------------GQRQLISGIENFDSSKL-KHAETCEKNPLPTKEIIDQEKSA............................................................. 131
12 6.000e-15gi|354480991|ref|XP_003502686.1| PREDICTED: hypothetical protein LOC100763771 [Cricetulus griseus]  clstr ali  37  111..................................PGAAVRGKEEEFPRGKPRERS--SPTWRDLKGPKA---FPWQRQASGAAHSRGPGPWARLATVSDKPDMAEIKKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 211
13 8.000e-15gi|242009701|ref|XP_002425621.1| conserved hypothetical protein [Pediculus humanus corporis]  clstr ali  16  5......................................................................................PVSPSLKDLPKVNTDLKSQLECFNQRNLKDVNTLEKNILPSAQDVAAEK----------------TQKALLEGVEAFDTSKL-KHTETNEKNPLPDKEVVYQEKVHQKLFDGVEHFDKKTMKHAETQEKNPLPDREVIELEK--DKMKFISGIESFDPTK....... 145
14 3.000e-14NEWGM AMPQU Aqu1.221611|PACid:15720139 |Amphimedon queenslandica|JGI  ali  15  423.......................................KGHKADLKHVQPVEKRIESESPNVDEGPKTVWTLQKEIASFSTSWLNKIKFREPKPTRINSKVFDEIESFSTDALTHVVPKVKTILPTKEDIQAEKSSXXXXXXXXXXXXDNIPMKSKAPKQVIKTRVIGPAASNKTKMKSPTKKSIVPPMPSQET.......................................................... 601
15 3.000e-14gi|297288028|ref|XP_002803270.1| PREDICTED: zonadhesin [Macaca mulatta]  clstr ali  14  495......................PTIPAEKPTIPTEEP--SFATEK-PTILTEEPTIP---TEKPTTPSEKPTIPTEEPSFPTE--KPTIPTEEPTIPTEKPTISEKPTISTEKEKPTVPMEKPTIPEKPTIPTEKPTIPTEKPTIPTEKPTISIEETTISTEKPTISTEKPTIPTEKSTIPTEKATIP----------TEKPTISTEKPTIPTEKPTIPIEETIISTEKPPIPTEKSTISTEKPTI....... 755
16 3.000e-14gi|307189411|gb|EFN73821.1| Thymosin beta-4 [Camponotus floridanus]  clstr ali  23  59......................................ETFKADQLKHADTKEKI-ILPNAKDVAAEKTQQTLIAGIEKFDTASLKHTETQEKNPEKGKQQLISGIENFDPAKLKHAETLEKNPLPTKETIDAEKIA.................................................................................................................... 165
17 5.000e-14gi|357627504|gb|EHJ77183.1| thymosin isoform 1 [Danaus plexippus]  clstr ali  16  8........................................................................................TPALKDLPKVATDLKSQLEAFNPSCLRDVDTNEKIVLPSAEDVAQEKQH----------------TALLQDLEHFQSSSL-KKTETVEKNILPNAIDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDVVAAEKQHQNL--LDGVEHFDKT........ 145
18 2.000e-13gi|301016779|dbj|BAJ11759.1| HsjCib isoform1 [Hodotermopsis sjoestedti]  clstr ali  12  2...........................................................STSLKDLPKVNVDLKSELEGFKTGSMKKAETQEKNVLPTAEDVKQEVESFKTERLKRTNTQEKIVLPNAQDVATEK----------------TQKALLQGVEAFDTGKL-KHTETQEKNPLPDKDVVKQEKVHQNLLEGVEHFDKATMKPTQTQEKNPLPDPEAIEQEKEKQNL.................... 167
19 9.000e-13gi|160333326|ref|NP_001103818.1| thymosin isoform 2 [Bombyx mori]  clstr ali  18  3......................................................CSVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNEKATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKF----------------LNGIENFDPTKL-KHTETCEKNPLPTKDVIEQEKSA............................................................. 132
20 2.000e-12gi|15721996|gb|AAL04411.1| zonadhesin splice variant 3 [Homo sapiens]  clstr ali  14  766......................PTISPEKLTIPTEKPTIPTEKPTIPTEKPTSTEKPSIPMEKPTLPXXXXXXXXXXXXISTEKLKPTISTEKPTIPTEKPTIS-PEKLTIPTEKLTIPTEKPTIPEKPTISPEKPTISTEKPTIPTEKPTIPTEETTISTEKLTIPTEKPTISPEKLTIPTEKPISTEKPTIPT----EKLTIPTEKPTIPTEKPTIPT-EKLTALRPPHPSPTATGLAALVMSP....... 1019
21 7.000e-12gi|229163818|ref|ZP_04291761.1| S-layer y domain protein [Bacillus cereus R309803]  clstr ali  12  38...........................................EALPHIQSNEKQLEAVKERQIELEKREEILKQQEELFVKDELKQEKDELLKQDGEHKVQLEEVQQLDELKKQQAELEGKNPLQVKDNNEEKKAAELKKQEELEEKNALEIKENNNQEEKKQQDELRKQQEELKKQQLEMEQQIKQELEVKQKEEQAKQKQKLELKQKEEQAKQELELKQKEEQTKREFELKQKEEQEKREA......... 271
22 7.000e-12gi|193652608|ref|XP_001951088.1| PREDICTED: hypothetical protein LOC100160577 isoform 2 [Acyrthosiphon pisum]  clstr ali  12  3........................................................................................SPSLKDLPKVAFDLKNQLEGFNPDNMKKADTNEKIILPTAEDVKRERQHNDLIH----------------GVNNFSADKL-KRTDTLEKVILPNAQDVAAEKTQEALIEGVGGFDTNKLKHTETQEKNPLPDKTVIEAEKEQQQL.................... 134
23 1.000e-11gi|348568814|ref|XP_003470193.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin-like [Cavia porcellus]  clstr ali  14  504..............................VLPTTSPMEKSEKPTVLTEEPTVPAKEIISTKESTVPTGKPAIRTEWTTILTEKLKPTIPTEGATVPTEKPAISAVET--PTPTEKTILTEKSTIPTKPTISTEGSTIPTEKPTIPTEGSTIPTEKPAIPTEGTTVPTEKPAIPTEGTTIPTEKPIIPTEGSTVSTEETEGITTTTEKPTIPTEGSPIPTEGTTVPTEKPTIPTEGTTVPTEKPTI-PTE... 760
24 1.000e-11gi|297304338|ref|XP_002806375.1| PREDICTED: hypothetical protein LOC100425653 [Macaca mulatta]  clstr ali  11  124..............................................................................................................PSRSSKTQTHKQDILKVKTMVKKNRKNEQEEECPNSILLLLLLTVQKGELYTFSDNSVVATAQTRRSFLCASLRFSSATIFDKPDMTEIEKFDKSKLKKTEMQEKNPLPSKETIEQEKQA....................... 245
25 2.000e-11gi|156538032|ref|XP_001603735.1| PREDICTED: hypothetical protein LOC100113623 [Nasonia vitripennis]  clstr ali  19  13..................................................................PKVAVDLKSELEGFKTSCMKKAETAEKNVEKTQQTLIAGIEHFDTSRLKHTETQEKNPLPDKDAILQEK----------------GKQQLISGIENFDPAKL-KHAETLEKNPLPTKEAIAAEKTS............................................................. 130
26 3.000e-11gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens]  clstr ali  19  753.............................LTIPMEKPTISTEKPTIPT----EK--PTISPEKLTIPTEKLTIPTEKPTIP--IEETTISTEKLTIPTEKPTIS-PEKPTISTEKPTIPTEKPTIPTEETIPTEKPTISPEKLTIPTEKPTISTEKPTIPTEKLTIPTEKPTIPTEKPTIPTEKLTA.................................................................. 909
27 6.000e-11gi|156405936|ref|XP_001640987.1| predicted protein [Nematostella vectensis]  clstr ali  17  200................................PDRSEVASFDHTKLKHVTTQEKS-IMPSQEDIKEE--AVDSRAEVKSFDHSKLKHVETVEKNPLPSAAPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTE------------------STETRAEVKTFDHSKL-KHVQTEEKNPLPDAKTIAQEKAS............................................................. 348
28 9.000e-11gi|344291585|ref|XP_003417515.1| PREDICTED: hypothetical protein LOC100656896 [Loxodonta africana]  clstr ali  23  1................................................................................................MSDKPGVAEIEKFGKSKLKNTETQEKNPLPSKETKRRAKQANLNEATPPICTSPLNARCLLLVPRRASTKPFPGRADPASPRSTPGQQ..................................................................... 88
29 2.000e-10gi|296209334|ref|XP_002751510.1| PREDICTED: hypothetical protein LOC100406360 [Callithrix jacchus]  clstr ali  22  1................................................................................................MPDKPAMVEIKKFNKLKLKNTETQEKNLLPSKETTEQKQAGKSQRGMHTNAQYAFHRGWDEAGQGSVFSLKLQEPVESRVKVSANG-DVSEKGKSSEAVPR-IHTTDPENLPATEMKA....................................... 121
30 3.000e-10gi|301016775|dbj|BAJ11761.1| HsjCib isoform3 [Hodotermopsis sjoestedti]  clstr ali  16  2........................................................................................STSLKDLPKVNVDLKSELEGFKTGSMKKAETQEKNVLPTAEDVKQERQHSE----------------LIQGVESFKTERL-KRTNTQEKIVLPNAQVVKQEKVHQNLLEGVEHFDKATMKPTQTQEKNPLPDPEAIEQEKEKQNL.................... 129
31 1.000e-09gi|332815828|ref|XP_003309598.1| PREDICTED: thymosin beta-10-like [Pan troglodytes]  clstr ali  30  3.............................................................................QSWRDADLVPADGTDCFKKMADKPDMGGIASFNRAKLKKTETQEKNTLPTKETTGQKRSEIS.................................................................................................................. 64
32 1.000e-09gi|312383254|gb|EFR28413.1| hypothetical protein AND_24729 [Anopheles darlingi]  clstr ali  20  15..................................................................PRVGADFKSELESFRPETLTKADTQEKNPLPTAEDVQSEIESFDASQLKHAETCEKNPLPDQEAIKAEKGVQHFIE----------------CIESFDTSRL-KHAETLEKNPLPTREIIEEEK............................................................... 130
33 2.000e-09gi|345802985|ref|XP_003434987.1| PREDICTED: uncharacterized protein LOC100687170 [Canis lupus familiaris]  clstr ali  42  45..........................................................................................SDRFKKMADKPDMGEIASFDKAKLKKMETQE-NTLPTKETIEQEKQSE................................................................................................................... 91
34 2.000e-09gi|119115116|ref|XP_310894.3| AGAP000235-PA [Anopheles gambiae str. PEST]  clstr ali  19  14..................................................................PRVKPDFKSELESFRTETLAKADTQEKNSEKAQRSVIEGIEGFDASRLKHAETKEKNPLPDVEAIQAEKGVQQFI----------------AGIESFDTKSL-KHADTVEKNLLPTAETIEAEK............................................................... 129
35 4.000e-09gi|358341075|dbj|GAA48842.1| hypothetical protein CLF_102101 [Clonorchis sinensis]  clstr ali  14  12...................................KDISKFDKSGLEHVVPEEKI-VLPSAEEIKQEKSEKALLDEIEK--GTQLKHTCTVEKNPEKTEKQLLEEITHH--PKLRRASTLEKNPLPTPEVIAQEKKEKQLLDEIEHHPK-------------------LKPAQTMEKNPLPTQE..................................................................... 145
36 6.000e-09gi|348541329|ref|XP_003458139.1| PREDICTED: thymosin beta-4-like [Oreochromis niloticus]  clstr ali  44  25................................................................................EHNLSRHQPTHRLTATMSDKPDLAEVEKFDKSKLKKTETQEKNPLPTKETIEQEKQATS.................................................................................................................. 83
37 9.000e-09gi|338712618|ref|XP_003362740.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin [Equus caballus]  clstr ali  15  556..........................................TCRGKHMATTEK--PTVPSEISTIPTEKATVPTE---------KPTVATEKPIVPTEKPTV--------PTEKPTVPTEKPTVPTKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKHLXPTERPIVPTERPTV---PSERPTAPLTPQPSPTLVPTEPTVAPSMPTAVTLASTEGPRPTPACPPNAHYESCACP..... 749
38 1.000e-08gi|325111404|gb|ADY80039.1| thymosin [Procambarus clarkii]  clstr ali  19  17.................................LKGQLEGFSPDKLKKTDTAEKST-LPTKEDVEQEKQHTELLENISHFRSDKLKRTSTSEKDAEKGHQALREGIEGFNPSALKKTETLEKCKLPTKEEIEQEKKA.................................................................................................................... 128
39 3.000e-08gi|297292896|ref|XP_002804150.1| PREDICTED: thymosin beta-4-like [Macaca mulatta]  clstr ali  44  31.............................................................................................SATMSDKPDMAEIEKFGNSKLKKTETQEKNPLPSKETMEQEKQAGES................................................................................................................. 77
40 3.000e-08gi|345790958|ref|XP_003433437.1| PREDICTED: putative thymosin beta-4-like protein 2-like [Canis lupus familiaris]  clstr ali  45  1................................................................................................MSNKPDMAEIEKFSKSKLKKIETQEKN-LPSKETTEHRKQADK.................................................................................................................. 42
41 4.000e-08gi|326928622|ref|XP_003210475.1| PREDICTED: hypothetical protein LOC100539160 [Meleagris gallopavo]  clstr ali  1.............................................................................................................................................................................................MSDKPDFAEIETFDKTKLKKTETREKNPLPTKETIEQEKQTPAA.................... 44
42 5.000e-08gi|293344411|ref|XP_002725736.1| PREDICTED: thymosin, beta 4-like [Rattus norvegicus]  clstr ali  31  1................................................................................................MSDKLDMAEIEKFDKSKLKKTGTQEKSPLPSKETIEQEKQAGNEVIMVPGSSEYGEKSDIKPNSKSF.......................................................................................... 67
43 5.000e-08gi|358418996|ref|XP_003584096.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin [Bos taurus]  clstr ali  11  564......................PQAPERGPRPPTPSETPVTPEET---STTSSEISPVPTEKPVAA-----------------TEKPTVPSETPTVPTEKPVVTA-EKLTVPTKRPTVPTEKPTLPEEPTFLPEGPTIPTEKPTVPTEKTTIPSXXXXXXXXXXXXXXEKPTVPTEKTTIPAKKTILTEKEEPTFLPEWPLFPSETEKPIVSTERTTIPTEKTTIPTEKPMVPTEKTTIPTEKATV-PTEK.. 783
44 6.000e-08gi|322790210|gb|EFZ15209.1| hypothetical protein SINV_04407 [Solenopsis invicta]  clstr ali  15  280......................................ARIEERKAIESFKKQLDVPREKPEKDKDEENDDKVKEEKTASAPKKLEKVRFADKDKPRTAKPSKSEVEKPKQEDKRTADVAKPTVESVKKTIESTKKIESIESTKKSVESPKKLTEGTKKVESVKTTPKPKQTSTKVDEKSKTRVKSETSTPAPKIKEQAKQPEKADVKKV-TTKPTSKPSKEVSQAEKQETKPKTKK................ 485
45 8.000e-08gi|332870817|ref|XP_003319053.1| PREDICTED: hypothetical protein LOC100608527 [Pan troglodytes]  clstr ali  157...................................................................................................................................................................................LPT--ASSAAMSDKPGMAEIEKFDKSKLKKTETQDKNPLSSKETIEQEKQA....................... 205
46 9.000e-08gi|293340154|ref|XP_002724661.1| PREDICTED: thymosin, beta 4-like [Rattus norvegicus]  clstr ali  43  17.........................................................................................AQLLPATMSDKPDMVEIEKFNKSKLKKTETQEKNPLPSKETIGQEKQAGES................................................................................................................. 67
47 1.000e-07gi|148691934|gb|EDL23881.1| RIKEN cDNA 4930488E11 [Mus musculus]  clstr ali  33  23.........................................................LKGALEPADKMSDKPDLSEVETFDKSKLKKTNTEVKNTKMSDKPDLSEVETFDKAKLKKTNTEVKNTLPSKETIQQEKEHNER................................................................................................................. 111
48 1.000e-07gi|149064540|gb|EDM14743.1| rCG46902 [Rattus norvegicus]  clstr ali  10  9......................................................................................................................................................................................ESTSCKKMADEPDMGEITSFDKAKLKKTETQEKNTLWTKETIEQEKR........................ 55
49 2.000e-07gi|268581059|ref|XP_002645512.1| C. briggsae CBR-TTH-1 protein [Caenorhabditis briggsae]  clstr ali  18  12.............................................................QELAGAVREGLELKKVETNEKNIL--PTKEDVEVEKQHVERIHEIESFDSTKLHSTPVKEKVVLPSAEDIKQEKQHQELTDGIQNF-----------------PSENLKKTETTEKNVLPSPTDIAREK----TLQMAASFDKSALHHVETVVSN..................................... 143
50 2.000e-07gi|119619953|gb|EAW99547.1| thymosin, beta 10, isoform CRA_a [Homo sapiens]  clstr ali  18  126.............................................................................................................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS.................... 169
51 2.000e-07gi|359322843|ref|XP_003433408.2| PREDICTED: uncharacterized protein LOC100688498 [Canis lupus familiaris]  clstr ali  14  1.............................................................................................................................................................................................MSDKPDMAGIEKFHKSKLKKTETQEKNSLPSKETIEQEKQA....................... 41
52 2.000e-07gi|270001643|gb|EEZ98090.1| hypothetical protein TcasGA2_TC000503 [Tribolium castaneum]  clstr ali  19  566...............................LNLLNGVEHFDKATMKHTTTAEKI-VLPDNEVIEQEKGQRQLISGIENFDSSKLKHAETC-----------------------------EKNPLPTKEIIDQEKSA.................................................................................................................... 641
53 2.000e-07gi|109122115|ref|XP_001086739.1| PREDICTED: thymosin beta-10-like [Macaca mulatta]  clstr ali  46  1................................................................................................MADKPDMGEIASFDKAKLKKTETQE-NTLPTKETIEQEKRSE................................................................................................................... 41
54 2.000e-07gi|348516834|ref|XP_003445942.1| PREDICTED: thymosin beta-a-like [Oreochromis niloticus]  clstr ali  46  1................................................................................................MSDNPVNQEVEQFNKQKLKKTNTQEKNHLPTKEEIEAEKKA.................................................................................................................... 42
55 3.000e-07gi|311271661|ref|XP_003133199.1| PREDICTED: putative thymosin beta-4-like protein 6-like [Sus scrofa]  clstr ali  44  1................................................................................................MFDKVNMAEIEKFHKSKLMKTERQEKNPLPSKETIEQEKQAGK.................................................................................................................. 43
56 5.000e-07gi|332241062|ref|XP_003269706.1| PREDICTED: LOW QUALITY PROTEIN: putative thymosin beta-4-like protein 6-like [Nomascus leucogenys]  clstr ali  43  1................................................................................................MSDKSNMDEIEKFNKSKLKKTEMQEKNPLPSKXWIKQEKQAG................................................................................................................... 42
57 5.000e-07gi|281350991|gb|EFB26575.1| hypothetical protein PANDA_014770 [Ailuropoda melanoleuca]  clstr ali  37  1................................................................................................MFHKPDMAKIEKIVKSKLK-TEAQEKNPVPSKEALEQMKQA.................................................................................................................... 40
58 6.000e-07gi|196006231|ref|XP_002112982.1| hypothetical protein TRIADDRAFT_25752 [Trichoplax adhaerens]  clstr ali  33  4......................................................................KPDRSEVKSFDVSKLKHIETTEKNPLPSDKPNISEVTKFDKSKLKHTETSEKNPLPTKE............................................................................................................................ 62
59 6.000e-07gi|260833060|ref|XP_002611475.1| hypothetical protein BRAFLDRAFT_117203 [Branchiostoma floridae]  clstr ali  18  5................................PDVSEVKQFDTGKLKHVETEEK-NPLPTEQTINQEKASERSSKILEGLDPSKLKHAETNVKEMKPDAEALAAAVSGFDKSKLKHAETTEKSHLPTKEEIEAEKAAK................................................................................................................... 117
60 6.000e-07gi|239736194|gb|ACS12897.1| thypedin [Chironex fleckeri]  clstr ali  16  517...............................LPDVSEVKDFNTGKLKHVQTEEKT-VLPTKEVINQE--ALDSRAEVKTFDHTKLKHVETQEKNVLPTPQADVSEVKDFDQGKLKHVETKEKVTVPSKEVIDEE------------------AKNTMAEVTKFDKGKL-KHADTKEKDKLPTAEDIKNEKSA............................................................. 666
61 6.000e-07gi|114052645|ref|NP_001040486.1| thymosin isoform 1 [Bombyx mori]  clstr ali  12  4..........................................................................................................................................SVSDTPSLKDLPKVATDLKSQLEGFNTSCL-RDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDVVAAEKAHQNL--LDGVEHFDKT........ 107
62 7.000e-07gi|301783855|ref|XP_002927357.1| PREDICTED: LOW QUALITY PROTEIN: zonadhesin-like [Ailuropoda melanoleuca]  clstr ali  11  545.......................................................PELPSKYPVSLPGPSETPVSTGKPMTPIE-KPMAPTGKPMAPTGKPTVSEIATLPTKKEKSTVSPERSTPPEKSTFPTEKLTIPTQKPTIPTEKPTIPTERPTVPAEKPTMPTERTTISTEKPTIPAEKPVHTERTTIHTTISIEKPTIPIEKPTVHTEKPLVPTGRTTITTERPTVKPTIPTEKTTIPTEKPT.... 769
63 7.000e-07gi|340721416|ref|XP_003399116.1| PREDICTED: hypothetical protein LOC100649938 isoform 1 [Bombus terrestris]  clstr ali  2.............................................................................................................................................SNPSLKDLPKVALDLKSELEGFNHGCMKKAA-TAEKNVLPSAEDVAAEKTQQTLMSGIETFDPSSLKHTETQEKIFLPDMDVIQQEK--EKQELISDIENFNPAK....... 103
64 8.000e-07gi|281346811|gb|EFB22395.1| hypothetical protein PANDA_000271 [Ailuropoda melanoleuca]  clstr ali  39  1................................................................................................MSDNPYMAEIKKLGKLILRKTETQEKNPLPSKETTGQEKQADA.................................................................................................................. 43
65 9.000e-07gi|301764703|ref|XP_002917767.1| PREDICTED: LOW QUALITY PROTEIN: putative thymosin beta-4-like protein 2-like [Ailuropoda melanoleuca]  clstr ali  38  1................................................................................................MSDKHNMAKIEKFNKSKLKXTEMQDKNPLPSKETTEWEKQAGE.................................................................................................................. 43
66 1.000e-06gi|319775076|ref|YP_004137564.1| Iga1 protease type 2 [Haemophilus influenzae F3047]  clstr ali  13  976...WSYTLKETDGRDLYNPEKRNLTTVDTPSIATPNPSVPSNNEEIARVEAPVP-LPAPATPSETTETVSENSPQESKTIAKNEQDATETTAQNGEVAQKPSVEANTQTNEVAQSGSETEETQTTETAEINSTEETAVENGLTSSEPRTEETATVEKDEIQEAP--QMASQASPKQAEPAP-EKVSTDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKAEPVTPVVSENQAEKKVSQPTETE. 1236
67 1.000e-06gi|296221969|ref|XP_002756989.1| PREDICTED: thymosin beta-4-like [Callithrix jacchus]  clstr ali  45  1................................................................................................MSDKPDVDEIGKLSKSKLKKTEIQEKNPLPSKELIKQEKQAG................................................................................................................... 42
68 1.000e-06gi|344297554|ref|XP_003420462.1| PREDICTED: hypothetical protein LOC100676552 [Loxodonta africana]  clstr ali  18  215.............................................................................................................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS.................... 258
69 1.000e-06gi|156144966|gb|ABU53029.1| beta-thymosin [Haliotis diversicolor]  clstr ali  50  1................................................................................................MGDKPDVSAVATFDKSKLKKTDTEIKNPLPTKETIEQEKAEQ................................................................................................................... 42
70 2.000e-06gi|297682661|ref|XP_002819034.1| PREDICTED: 60S ribosomal protein L10-2-like [Pongo abelii]  clstr ali  8.............................................................................................................................................................................................ISDKSNMDEIEKFNKSKLEKTEMQEKNPLPSKEWIEQEKQA....................... 48
71 2.000e-06gi|312084628|ref|XP_003144352.1| hypothetical protein LOAG_08774 [Loa loa]  clstr ali  2.........................................................................................................................................EKINDERLEVKKVRAPRLPLDIAAEVTKGQQLKHVEVSEKSVLPTASDIRQEKIDLQLKEEIRKHDRDKLRHADIIEKNVLPKPEDMYREKVNENLK................... 98
72 2.000e-06gi|209731244|gb|ACI66491.1| Thymosin beta-11 [Salmo salar]  clstr ali  41  1................................................................................................MSDKPNMREISSFDKTRLKKTETRVKNPLPTKETIDQERKRES.................................................................................................................. 43
73 2.000e-06gi|297709529|ref|XP_002831481.1| PREDICTED: thymosin beta-10-like [Pongo abelii]  clstr ali  42  1................................................................................................MADKPDIGEIASFNKAKLKKTEMQE-NTLLTKEAIEQEK...................................................................................................................... 38
74 2.000e-06gi|260064041|ref|NP_001159390.1| beta thymosin-like protein 2 [Danio rerio]  clstr ali  46  1................................................................................................MSDNPVKAEVQNFDKKCLKKTNTEEKNVLPTKEDIEQEKKAGE.................................................................................................................. 43
75 3.000e-06gi|293349778|ref|XP_002727241.1| PREDICTED: thymosin, beta 10-like [Rattus norvegicus]  clstr ali  44  28..............................................................................................KKMANKPDVGEIASFNKAKLKKTETQE-NTLPTKETIEQEKRSE................................................................................................................... 70
76 3.000e-06gi|157136879|ref|XP_001663844.1| actin binding protein, putative [Aedes aegypti]  clstr ali  20  13..................................................................KKVGADLKTQLESFKTENLSKADTQEKQAEKTQKSLFAGIESFDATKLKHAETCEKNPLPDKEAIQQEK----------------GQKNLINCIESFDTSKL-KHTETHEKNPLPTKETIEEEKKA............................................................. 130
77 3.000e-06gi|297684395|ref|XP_002819826.1| PREDICTED: thymosin beta-10-like [Pongo abelii]  clstr ali  29  1................................................................................................MAHKLDLEEIASLDKAKLKAAEMQE-NTLPTKNTTEQEKRSE................................................................................................................... 41
78 4.000e-06NEWGM LOTGI jgi|Lotgi1|209434|estExt_Genewise1Plus.C_sca_30434|Lottia gigantea |JGI  ali  50  12.........................................................................................PEHTISIMSDKPDVSEVAKFDKSKLKKAETNEKNTLPTKETIEQEKTG.................................................................................................................... 59
79 4.000e-06gi|326918844|ref|XP_003205696.1| PREDICTED: hypothetical protein LOC100541859 [Meleagris gallopavo]  clstr ali  53  1................................................................................................MCDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSXP............................................................................................................... 46
80 4.000e-06gi|217962306|ref|YP_002340876.1| S-layer domain-containing protein [Bacillus cereus AH187]  clstr ali  12  52....................................................QQQLEAVKERQIELEKREEILKQQKELFVKDELKRKKDELLKQDGEQKVQLEEVQQLDELKKMQAEIEEQNQLQVRDNSEEKKTTELKKQEEIEEKNALEIKENNSXXXXXXXXXXXXXXXXXXXXXXXXXRKQQEQLKKQQLELEQKTKQELELTKKEEQAKQELELKQKEEQAKQELELKQKEE............... 239
81 4.000e-06gi|55741862|ref|NP_999548.1| zonadhesin precursor [Sus scrofa]  clstr ali  358......................PTVPTEKPTIPTEKSTVPTKKPTVFKEPTLPPEGPTVPAERPTTPPEGPAVPSHTEKSTVHTEKPILPTGKSTIPTEKP-MVXXXXXXXXXXXXXIPAEKPTVPEKPMVPTERTTIPTERTTIPTEKPTVPTEKLTVPTEKPIVPTEKPIVPTEKHTIPTEKLTVXXXXXXXXXXXXXKPTVPTEKPSVPTEKPTVPTEEPTIPTEKLTV..................... 583
82 4.000e-06NEWGM CAP jgi|Capca1|135645|e_gw1.372.47.1|Capitella sp.1|JGI  ali  21  12....................................................................................................................................................................................................KNVEGFDQSKLKHAETAEKNPLPSKEAVTLEKREVEL--RSSIEHF--SKAELRK.. 62
83 4.000e-06gi|293351991|ref|XP_002727891.1| PREDICTED: thymosin, beta 10-like [Rattus norvegicus]  clstr ali  37  3.....................................................................................................DMAEIASLDKAELKKTETQETNALQTEGTIEQEKRSE................................................................................................................... 39
84 5.000e-06gi|281342918|gb|EFB18502.1| hypothetical protein PANDA_019403 [Ailuropoda melanoleuca]  clstr ali  39  9...................................................................................................KANMAEIEEFDKLKLKEREIQEKNPLPSTETIE......................................................................................................................... 41
85 6.000e-06gi|297459587|ref|XP_002700637.1| PREDICTED: thymosin beta-4 [Bos taurus]  clstr ali  41  1................................................................................................MSDKPHKAEVEKFDKLKLKKTQTQEKNALPSKETIEQEKQAGSQKSNYAESNENNGDILKRSLAPTATPS....................................................................................... 70
86 6.000e-06gi|332831579|ref|XP_003339213.1| PREDICTED: thymosin beta-10-like [Pan troglodytes]  clstr ali  34  1................................................................................................MAQKLDLEEIASLDKAKLKATEMQ-KDTLMTKETTEQEK...................................................................................................................... 38
87 9.000e-06gi|150387455|gb|ABR68248.1| thymosin beta 4 X chromosome [Cervus elaphus]  clstr ali  46  16.............................................................................................SATMSDKPDMAEIEKFDKSKLKRTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 62
88 1.000e-05NEWGM PHYSO jgi|Physo1_1|135245|estExt_fgenesh1_pg.C_370014|Phytophthora sojae|JGI  ali  13 1147.......................................KTDKSTAPTTTEKEKSSPAPTTAET---KXXXXXXXXXXXXDKATPAPTKKEELTPAPTAT-DKATPAPTTKESTPAPTTKESTPAPT--TPCPEKTPEATKTSTPAPTTAGPSTEAPTPCPTTEVPTTEVP-STEAPTPCPTTEVPSTEVPSTEAP-----TPCPTTEVPSTEAPTPCPTTEVPSTEVPSTEVPSTEVPSTEAPTPCPT.... 1345
89 1.000e-05gi|355671024|ref|ZP_09057671.1| hypothetical protein HMPREF9469_00708 [Clostridium citroniae WAL-17108]  clstr ali  13  164.........................EECEPVQPTPSQAEEKDQPDQKESDPSAKEELDQTTPDQEEPDQTAADKPDQEEPDQTAADKPDQEEPDRIAADKPDQEETDQTTKGETKKEES--KKAETRKEEPDQEKTGQEE---------PDQTERDQTEPDQTEPEKLFSVTARIENYQVP........................................................................ 312
90 1.000e-05gi|296221967|ref|XP_002756988.1| PREDICTED: thymosin beta-4-like [Callithrix jacchus]  clstr ali  42  1................................................................................................MSDKPDVDEIGKLSKSKLRKTEIQEKNPLPSKELIKQEKQAG................................................................................................................... 42
91 1.000e-05gi|326432165|gb|EGD77735.1| thymosin beta-15A [Salpingoeca sp. ATCC 50818]  clstr ali  27  19.......................................................................TKQQQRQPRDKQVQRQRNIQAPLEAMSDQRDVKEVESFDRSKLKKVDVVEKNVLPTAEDIAADKLSDNQ................................................................................................................. 88
92 1.000e-05NEWGM OIKDI SNAPOd2T00008212001|Oikopleura dioica|Genoscope/Sars centre/MPIMG  ali  15  100.........................................KKSTSEQDDASDDDDSPPETLPEADMRLSSELLSEVENFEKNELKHQEVVEKNVLPNAEEDVSDINNFDKSQLKKMETVEKVVLPKTEEIAREKISSEIESFKQETLNHVEIMEKEIPAETLTMRNVLNHVETEEKVVLPSVEDIAKEK----TLEQITEFDMSKLKVSEAA........................................ 280
93 1.000e-05NEWGM AMPQU Aqu1.209493|PACid:15708021 |Amphimedon queenslandica|JGI  ali  17  102......................................................................................PVESVEKPVEVAEKPV--------KAAEKPAE-ATKN--PAKP---AEKSAEVAEKSVKAVEKPVKAVEKPAKPAEKSAEATEKPVETAEKPVEATEKPAAAEKPAEATKKPAKPAKKSARKPAKSAAKS..................................... 218
94 1.000e-05NEWGM BRAFL jgi|Brafl1|125574|estExt_fgenesh2_pg.C_1880063|Branchiostoma floridae|JGI  ali  21  3.....................................................................DKPDLSEVSKFDKSKLKKTETSVKNTLMSDKPDVSEVKQFDTGKLKHVETEEKNPLPTEQTLHQDRAA-----------------LTAAAVSGFDKSKL-KHAETTEKTHLPTKEDTMLQK............................................................... 111
95 1.000e-05gi|154426286|ref|NP_001093905.1| thymosin beta homologue [Ciona intestinalis]  clstr ali  20  147........................LKDDYLREKLPGQVASVNKESLKHVETQEK-NPLPSGADIAIERA----PSDAANFPHEKLKHVETKEAQVLPSKEDVAQEIGLFKRDSLNKIETQEKNTLPTKETIEEEKRESA.................................................................................................................. 261
96 1.000e-05gi|374074231|pdb|3SJH|B Chain B, Crystal Structure Of A Chimera Containing The N-Terminal Domain (Residues 8-29) Of Drosophila Ciboulot And The C-Ter  clstr ali model  42  7............................................................................................KDLPKVAENLKSQLEGFNQDKLKKTETQEKNPLPSKETIEQEKQAGE.................................................................................................................. 53
97 1.000e-05gi|297459143|ref|XP_002684531.1| PREDICTED: thymosin beta-4-like [Bos taurus]  clstr ali  37  1................................................................................................MSYKPDTAEIEKFGKSTLKKAEMQEKNPLPSKEMIEEERQTGE.................................................................................................................. 43
98 1.000e-05NEWGM STRPU GLEAN3_26031|Strongylocentrotus purpuratus|Baylor  ali  53  1................................................................................................MADKPDVSAVSSFDXTKLKKTETXEKNTLPTKETIEQEKTA.................................................................................................................... 41
99 1.000e-05gi|229365818|gb|ACQ57889.1| Thymosin beta-4 [Anoplopoma fimbria]  clstr ali  48  1................................................................................................MSDKPDVSEVSSFGKSKLKKTETQEKN.................................................................................................................................. 28
100 2.000e-05gi|62901868|gb|AAY18885.1| thymosin [synthetic construct]  clstr ali  48  26.................................................................................................ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSE................................................................................................................... 66
101 2.000e-05gi|47222942|emb|CAF99098.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  13  251..........................................................................................................................................................KDRQRKHYTDTSHLLRR--PTLHTPAPDQSQKSARMSDNPVKQEVENFNRRSLKKTETKMNTSLPTKEDIEQEKQAQK..................... 326
102 2.000e-05gi|71980588|ref|NP_001020985.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]  clstr ali  14 1457......................EVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSXXXXXXXXXXXXXXESEESRTSVKKEKTPEKVDEKPKS-PTKKDKSPEKSITEEIKS--PVKKEKSPEKVEEKPASPTKKEKSPEKPASPT------------KKSENEVKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPT-SPTKKE. 1673
103 2.000e-05gi|354483836|ref|XP_003504098.1| PREDICTED: thymosin beta-4-like protein 3-like [Cricetulus griseus]  clstr ali  46  1................................................................................................MSNNLNKAEMEKFDKPKLKKTETQEKNPLPSKRTIEREKQVGD.................................................................................................................. 43
104 2.000e-05gi|345777852|ref|XP_003431651.1| PREDICTED: thymosin beta-4-like [Canis lupus familiaris]  clstr ali  35  1................................................................................................MSEKCDMAEVEKFDRS-LRRQKLKRKNPLPSKETIEQEKQTVN-KAVTQQGKKPQRSRAAAAAP............................................................................................. 62
105 2.000e-05gi|41763910|gb|AAS10353.1| thymosin beta a [Cyprinus carpio]  clstr ali  46  1................................................................................................MSDNPVKEEVQKFDKRCLKKTNTAEKNTLPTKEDIEEEKKAGD.................................................................................................................. 43
106 2.000e-05gi|301754499|ref|XP_002913098.1| PREDICTED: hypothetical protein LOC100482221 [Ailuropoda melanoleuca]  clstr ali  39  1................................................................................................MANKLDMGEITSFDKVKLKKTETPEKNTLQTKETTEEEKQSPTVGDEDRPE.......................................................................................................... 51
107 3.000e-05gi|229825865|ref|ZP_04451934.1| hypothetical protein GCWU000182_01229 [Abiotrophia defectiva ATCC 49176]  clstr ali  14  11.........................................KDSKVKADAKKEENKIVEEAEKVKVVKNE--IKVDLVTKPMVLPKKIEVKEPEAVKAVVTPVKEEEPKEKATENKEETKEKTVAAKKEVTDEKKKAETKTSEKAEAKKPAKEKEVXXXXXXXXXXXXVNKSAKTEKAEKPTKTATVAKKTEKPAKKETVKKDTTKTGRSKKEVK---ETENSIEQVAAMINKEITKEADKSDK-PAPEKKKI 223
108 3.000e-05gi|341897127|gb|EGT53062.1| hypothetical protein CAEBREN_28154, partial [Caenorhabditis brenneri]  clstr ali  1225..............................................KKEKSPEAKNVVEVSSETTIEKTETTFEEDVKSVEKTEEKPKSPTSKKDKSPEKSLTEEV----KSPTKKEKSPEKPSSPTKKTEDEVKSAKKEKSPEKTEEKPTSPIKKEKSPEKPVEEKPLSPVKKSSDESETPKSPVKTTGDKTPSSPTSKKSPPGSPKKAKSPEK-------VEEAVKSPTKKEKSPEKAATEEVKSPVKKE. 1427
109 3.000e-05NEWGM AMPQU Aqu1.222721|PACid:15721249 |Amphimedon queenslandica|JGI  ali  12  38.............................................................................................................................................................................................MSDKPDVSEVTSFDKSKLKKTETQEKNPLPTKETIEQEKS........................ 77
110 3.000e-05gi|207094303|ref|ZP_03242090.1| hypothetical protein HpylHP_16297 [Helicobacter pylori HPKX_438_AG0C1]  clstr ali  60  2.........................................................................................................IETFDKSKLKKAETTEKNTLPTKETIDQEKSQP................................................................................................................... 34
111 4.000e-05gi|354471194|ref|XP_003497828.1| PREDICTED: thymosin beta-4-like [Cricetulus griseus]  clstr ali  46  28.............................................................................................PATISDKPDMTEIEKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 74
112 4.000e-05gi|291394636|ref|XP_002713716.1| PREDICTED: thymosin, beta 4-like [Oryctolagus cuniculus]  clstr ali  180.......................................................................................................................................................................................SASTATTSDKPDMAEIEKFDKSKLRKTETQEKNPPPSEETMEQEKRA....................... 226
113 4.000e-05NEWGM CAP jgi|Capca1|135657|e_gw1.372.13.1|Capitella sp.1|JGI  ali  13  4.....................................................................................................................................................HKLPTDIAKNVEGFDQSKL-KHAETAEKNPLPSKEAVTLEKREVELRSSIEHFSKAELRKSQTQEKNPLPDAQSLKAEKNHRNF--VQSISSFDK......... 95
114 4.000e-05gi|354465714|ref|XP_003495322.1| PREDICTED: thymosin beta-10-like [Cricetulus griseus]  clstr ali  45  30.................................................................................................ANKLDLEEIASFDKAKLKKTETQE-NTLLTKETIEQKKRSE................................................................................................................... 69
115 4.000e-05gi|20140816|sp|Q9I955.3|TYBA_CYPCA RecName: Full=Thymosin beta-a  clstr ali  46  1................................................................................................MSDNPVKEEVQQFDKKCLKKTNTAEKNTLPTKEDIDQEKKAAE.................................................................................................................. 43
116 5.000e-05NEWGM LOTGI jgi|Lotgi1|203463|estExt_fgenesh2_kg.C_sca_130008|Lottia gigantea |JGI  ali  1....................................................................................................................................................MATTAKVNPDLLGDISKGSDLKHVQLKEKNPLPSKEDVQQEKNHQQLVDGVEKFDASKLKQVETQEKVVLPDPSVIAKEKTETEL.................... 85
117 6.000e-05gi|308178994|ref|YP_003918400.1| hypothetical protein AARI_32290 [Arthrobacter arilaitensis Re117]  clstr ali  12 1235...................DRDPTLDFGFVVKPVPTEPVEPTEPTVPTVDPTEPVEPTEPTVDPTEPTVDPTEP----TVDPTEPTPTEPTVDPTEPTVDPTEPTVDPTEPT----VDPTEPTVDPTEPTVDP---TEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPVEPTEPTVDPTEPTVDPTE-PTVDPTEPTVDPTEPTVDPTE... 1459
118 6.000e-05gi|344288719|ref|XP_003416094.1| PREDICTED: hypothetical protein LOC100668370 [Loxodonta africana]  clstr ali  255...................................................................................................................................ADEKRPGRNLGEGPASSATMSDKPDMAEIEKFDKSKL-KKTETQEKNPLPSKETIEQEKQA............................................................. 315
119 7.000e-05gi|348541917|ref|XP_003458433.1| PREDICTED: titin [Oreochromis niloticus]  clstr ali  11 7959......................PEVEPVKPVVPKPEVAQIKPELQEPKAVPTKKTPPKPIEPRIHEPPRKPYLLADKPQQEVTEPRDLEAPEKIKAPEEPKKVPEAPKVPEAAKKATEEPKKLPEPKKLPEDPKKLPEEPKKVPEEPKKLPEEPKKLPEEPKKLPEEPKKLPEEPKKLPEEPKKAPEAAKEATEEPKKLPEEPKKAPEAAKTEEPKKLPEKEATEEPKKLPEEPKKLPEEPKKLPEAPKK... 8200
120 7.000e-05gi|344237102|gb|EGV93205.1| Thymosin beta-10 [Cricetulus griseus]  clstr ali  18  1.............................................................................................................................................................................................MADKPDMGEIASFDKAKLKKTETQEKNTLPTKENEKKREKGNIL.................... 44
121 7.000e-05gi|301016771|dbj|BAJ11763.1| Hsjcib isoform5 [Hodotermopsis sjoestedti]  clstr ali  10  2..............................................................................................................................................STSLKDLPKVNVDLKSELEGFKTGSM-KKAETQEKNVLPTAEDVATEKTQKALLQGVEAFDTGKLKHTETQEKNPLPDKDAIEQEKEKQNL.................... 91
122 7.000e-05gi|345793566|ref|XP_003433774.1| PREDICTED: putative thymosin beta-4-like protein 2-like [Canis lupus familiaris]  clstr ali  46  1................................................................................................MSDKPGMSEIKKFNKSKLKETETQEKNSLLSRETTEQEKQAGK.................................................................................................................. 43
123 8.000e-05gi|227150233|gb|ACP19741.1| thymosin-repeated protein 2 [Eriocheir sinensis]  clstr ali  25  2.........................................................SSEAPLKDLPKVDSVLKEQLEGFSPDKLKKTDTAEKDAEKGQQALCQGIEGFDPSALKKTETQEKNVLPTKEVIEQEKKA.................................................................................................................... 90
124 8.000e-05gi|296190499|ref|XP_002743274.1| PREDICTED: hypothetical protein LOC100399497 [Callithrix jacchus]  clstr ali  59..........................................................................................................................................................................................SATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA....................... 102
125 8.000e-05gi|58760333|gb|AAW82079.1| thypedin [Hydra vulgaris]  clstr ali  14  921...................................AEVKTFDQSNLKHVETEEK-NPLPTAATLREEPEVLPDVSEVEKFDASKLKNVTPEIKCHLPTKDATRAEVKTFDQSNLKHVETEEKNTLPTAATLAKEEHKVEVINEEKSETHAESNLKTDDASEKPTSENTPSTQTEASSTDTPNDNSTQPKKKD............................................................. 1085
126 8.000e-05gi|321471002|gb|EFX81976.1| hypothetical protein DAPPUDRAFT_230815 [Daphnia pulex]  clstr ali  4.........................................................................................................................................QQDVQTPKLEDLPKVAENLKSQLEHFNTGAL-KDVETQEKVVLPTAEEMATEKAVETVLKGIEDFDPSVLKHTETQEKVVLPDAEAVQQEKTQQNL--LHGVESFDKS........ 108
127 9.000e-05gi|293340821|ref|XP_001067018.2| PREDICTED: cell surface glycoprotein CD200 receptor 1-like [Rattus norvegicus]  clstr ali  16  291.............................................................................................................................................................................................MADKLDMGQISSFDKAKLKKTEKQE-NTLPTKEAIEQEKRSKIS.................... 333
128 1.000e-04gi|1170515|sp|P45384.1|IGA2_HAEIN RecName: Full=Immunoglobulin A1 protease autotransporter; Contains: RecName: Full=Immunoglobulin A1 protease; Short  clstr ali  14 1039..............................................................SETTETVAENSKQESKTVEKNEQDATETTAQNGEVAEEA--------KPSVKANTQTNEVAQSGSETEETQTTEIKETXXXXXXXXXXXXXXXXXXXXXDEIQEAPQMASETSPKQAKPPKEVSTDTKVEETQVQAQPQTQSTTVAAAEATSPNSKPAEETQPSEKAEPVTPVVSKNQTENTTDQPTERE. 1223
129 1.000e-04gi|254725720|ref|ZP_05187502.1| LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. A1055]  clstr ali  11  783..............................................................DKEIEFTISNQKFEVVKLQITNKKETSKGPENPGEETEKPGEETEKPGEETEKPGEETEKPGEETKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEK---PGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGGETEKPGKETEKPGEGMENPDKEKENPT........ 963
130 1.000e-04gi|338729420|ref|XP_003365891.1| PREDICTED: thymosin beta-15A-like [Equus caballus]  clstr ali  45  4........................................................................................TTYQKWVKISAKPDLSEVEKFDRSKLKKANTEGKNALPLKETIQQEKKCVQTS................................................................................................................ 56
131 1.000e-04NEWGM PRIPA PPA04462 | PP11795 | WBGene00094016 | locus:Ppa-tth-1 | status:Partially_confirmed|Pristionchus pacificus|Wormbase  ali  11  31.........................................................................................................................................................................KHVEPTEKNVLPTKEDIAQEKTHQELTEGIEGFAAEKLRSVSTDEKNVLPSAEDIAREK------TLDAVEGFDATK....... 112
132 1.000e-04NEWGM PHYRM jgi|Phyra1_1|75750|fgenesh1_pg.C_scaffold_14000112|Phytophthora ramorum |JGI  ali  13 1272.....................................................KSTPAPTTTETKTPKTETEKPTPAPTTKDSTPAPTTTETKTPAPT-----------------KTETEKPTPAPTTKD-STPAPTTPCPEKTPEATTQSTPAPTTAGPSTEAPTPCPTTASTESPTPCPTTEVPATGAPTPTDVPVTEAPTPCPTTDVVTEAPTPYPT-TDVPETEAPTPCPTTDVPVTEAPTPCPT.... 1457
133 1.000e-04NEWGM CIOSA ENSCSAVP00000007076 pep:novel reftig:CSAV2.0:reftig_96:34544:45507:1 gene:ENSCSAVG00000004229 transcript:ENSCSAVT00000007167|Ci  ali  18  137.........................KEQFMDEKSRNEAAHFDQSKMKHVETVEK-------TSVKDDYLREKMAGQVASVSKESLKHVETKEKNPLPSGTDIAIEAANFPHDQLKHVETKESNILPSKEDVAQEKSIKS--------------------IPLFKRDSLNK-IDTQEKNTLPTQDVIDEEKRE............................................................. 280
134 1.000e-04NEWGM CAP jgi|Capca1|21748|estExt_fgenesh1_kg.C_3720001|Capitella sp.1|JGI  ali  4.....................................................................................................................................................HKLPTDIAKNVEGFDQSKL-KHAETAEKNPLPSKEDIKGEKTHLSLITGVKSFDRGVLSPTSTQEKNTLPDPSTVTLEKRE....................... 83
135 1.000e-04gi|213510968|ref|NP_001134055.1| Thymosin beta-a [Salmo salar]  clstr ali  51  4..................................................................................................NNPVKQGVETFDKKCLKKTNTAEKNTLPTKEDIEQEKKAEE.................................................................................................................. 44
136 1.000e-04gi|297294902|ref|XP_002804546.1| PREDICTED: hypothetical protein LOC100423728 [Macaca mulatta]  clstr ali  52  1................................................................................................MSDKPNMSKVGNFDREKLKKIKNKEKNTLLSKETIQQENQ..................................................................................................................... 40
137 2.000e-04gi|89114256|gb|ABD61716.1| thymosin beta 4 [Scophthalmus maximus]  clstr ali  52  1................................................................................................MSDKNDMSEVTNFDKSKLKKTETQEKNPLPSKETIEQEKAAE................................................................................................................... 42
138 2.000e-04gi|221210759|ref|ZP_03583739.1| filamentous hemagglutinin family outer membrane protein [Burkholderia multivorans CGD1]  clstr ali  13  457.....................LPQLSTPIVEKPAAAPIIAENKPGLPGVSTPVTEKPVPTAPVIAENK---PTQPNVPTPITEKPVPPTAPVIAESKPTQPDV------------PTPVTEKPVAPTAPVIAENKPAQPNVPTPIIDKPVPPTASVIAESKPTQPDV---PTPVTEKPVGPTAPVIAENKPTQPNVPTAESKPTQPDVPTPITEKPVAPTAPVIAENKPPQPKPLPPTIAAFAPTIAPIR... 699
139 2.000e-04gi|20140815|sp|Q9I954.3|TYBB_CYPCA RecName: Full=Thymosin beta-b  clstr ali  48  1................................................................................................MADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA.................................................................................................................. 43
140 2.000e-04gi|194733725|ref|NP_001124169.1| beta thymosin-like [Danio rerio]  clstr ali  50  1................................................................................................MSDKPNLEEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQAGSS................................................................................................................. 44
141 2.000e-04gi|170586360|ref|XP_001897947.1| Conserved hypothetical protein [Brugia malayi]  clstr ali  18  5.........................................DAQRLEVKKERAPKLPVHIAKEV----TKGRLLKHVEISEKSVL--PTALDMYREKVDENLKGEIKTHDTSKLRHAEVVEKNVLPT.............................................................................................................................. 84
142 2.000e-04gi|296210868|ref|XP_002752215.1| PREDICTED: hypothetical protein LOC100403451 [Callithrix jacchus]  clstr ali  1.............................................................................................................................................................................................MADKPGMAEMEKFEKSKQKRTETQEKNPPPSKEAIEQEKQAGKSSRV................. 47
143 2.000e-04gi|227150231|gb|ACP19740.1| thymosin-repeated protein 1 [Eriocheir sinensis]  clstr ali  13  2.........................................................SSEAPLKDLPKVDSVLKEQLEGFSPDKLKKTDTAEKEQEKQHNELIHDITEFRSDKLKRTSTSEKIVLPTPADIDAEK----------------GQQALCQGIEGFDPSAL-KKTETQEKNVLPTKEVIEQEKKA............................................................. 128
144 3.000e-04NEWGM BRAFL jgi|Brafl1|124862|estExt_fgenesh2_pg.C_1590080|Branchiostoma floridae|JGI  ali  16  701..............................................................................................................................SASTLEPEEKCAPF--FVPATVLTKCYGEQPVGKTCVLTCAAGVHVQTTQKPTVPTEKPTEKPAVKPTQKPTVKPTQKPTVKPTETVKPTPKPTKPTPKPTVKPTVKPIVRPIGTPKPTPQPTQKPL 833
145 3.000e-04gi|195450769|ref|XP_002072625.1| GK13703 [Drosophila willistoni]  clstr ali  912......................................EQKSSIKLEKSEKIEXXXXXXXXKRRVSMAKQESHRSEMSTSTSQAMQATEEEEKQNLLEEQKQKKEVEAANQKISKEDVQQESSEEPQEIVVDQEEEPQQKPDKTKPQQQKQADEKPQEEATQKQDEEPNK---VSKKKALEDESKPKDDKPQEATKKQKEEPEKVSKKKSLEDEPKPKPQESTQKQEEEPKKVSKKNAVEEEIKQKDNPQEE. 1130
146 3.000e-04gi|307204650|gb|EFN83272.1| Titin [Harpegnathos saltator]  clstr ali  12 10070......................PVKRKEKPEVPKPEEVILKPVKRLPKEEPVERKKPEEKPEAVQLKPVKRKEKPEVPKPEEVILKPPKKEESKEEISLKPVKKPEEKPEAVQLKPVKRKEKPEVPKPEEVEETKEEISLKPVERKKPEEKPEAVQLKPVKRKEKPEVPKPEEVILKPVLPKEEETKEEISLKPVERKIEKPEAVQLKPVKRKEKPEVPKPEEVEETKEEISLKTVERKKPEEKPEA...... 10335
147 3.000e-04gi|123122539|emb|CAM18682.1| novel protein similar to thymosin, beta (Tmsb) [Mus musculus]  clstr ali  35.............................................................................................................................................................................................MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEK......................... 73
148 3.000e-04gi|20140392|sp|Q9DFJ9.3|TYB_GILMI RecName: Full=Thymosin beta  clstr ali  46  1................................................................................................MSDKPDVKEVESFDKTTLKKTTTNEKNTLPTKEVIEQEKSGGS.................................................................................................................. 43
149 3.000e-04gi|309265694|ref|XP_003086578.1| PREDICTED: thymosin beta-10-like [Mus musculus]  clstr ali  35  1................................................................................................MAGKLALGEIAGFSQAKLKKTKTHEPDNLPTKENIKQEKRTE................................................................................................................... 42
150 4.000e-04gi|9954122|gb|AAG08964.1|AF156177_1 beta-thymosin [Sycon raphanus]  clstr ali  50  1................................................................................................MGDKPDVSEVASFDKTKLKKTETAEKNPLPTKETIEQEKRAS................................................................................................................... 42
151 4.000e-04gi|45387591|ref|NP_991144.1| thymosin beta [Danio rerio]  clstr ali  44  1................................................................................................MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP................................................................................................................ 45
152 4.000e-04gi|11496273|ref|NP_068832.1| thymosin beta-15A [Homo sapiens]  clstr ali  60  1................................................................................................MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS................................................................................................................ 45
153 4.000e-04gi|363894952|gb|AEW42985.1| putative thymosin beta-12 [Haliotis diversicolor]  clstr ali  52  1................................................................................................MSDKPDISEVATFDKGKLKKTETQEKNPLPSKETIEQEKAEQ................................................................................................................... 42
154 4.000e-04gi|268561066|ref|XP_002646356.1| Hypothetical protein CBG12070 [Caenorhabditis briggsae]  clstr ali  12 1631..................................PEQVEKKPTSQTKKEKSPEKSTTEEVKTPIKKEKSPEKSATEEVKSPTKKEKSPEKPTSPTKKTAEEAVKSPTKKEKSPEK---IEEKPKSPTKEEKSPEKSTGAEDVKSPIKKERSPDTVVEKEIXXXXXXXXXXXXXXXXXVTSPIKKS.................................................................... 1778
155 4.000e-04gi|145638188|ref|ZP_01793798.1| immunoglobin A1 protease [Haemophilus influenzae PittII]  clstr ali  12 1173.........................................EKEEKAKVETEETQK-APQVTSKEPPKQAEPAPEEVPTTQPTTVTAAETTSPNSKPAEETQSSEVVSENKVS-QPTETEKTAKVESKEAQETPKVASQASPKQEQSETVQPQAELESEPTVKNAEEVQAQPQTQPSAIVSTEQPAKETSSNVEQPEQESSTNTSATAMTETAEKSDKPQMETVTENDRQPEANTVADNS............. 1393
156 4.000e-04gi|47216797|emb|CAG10119.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  38  1................................................................................................MSDKPDMAEIARFDXXXXXXXXXXXXNPLPTKETIEQERKGDA.................................................................................................................. 43
157 5.000e-04gi|325197228|ref|NP_001191437.1| thymosin beta [Aplysia californica]  clstr ali  58  4................................................................................................KHDKPDISEVTKFDKSKLKKTETHEKNPLPTKETIDQEKQG.................................................................................................................... 44
158 5.000e-04gi|348536076|ref|XP_003455523.1| PREDICTED: thymosin beta-12-like [Oreochromis niloticus]  clstr ali  46  1................................................................................................MSDKPDVTEVTTFDKTKLKKTETQEKNPLPTKEVIEQEKAESS.................................................................................................................. 43
159 5.000e-04gi|301108545|ref|XP_002903354.1| mucin-like protein [Phytophthora infestans T30-4]  clstr ali  21 1176.............................................................................................................................................................................TDESTPAPTTAETGAPTPAPKTETENKAPTPAPTKQTEMDKPTPAPTK-PETTTDKPTPAPTKPETETGKPTPAPTKE.. 1254
160 5.000e-04NEWGM HYDMA Hma2.223358 |Hydra magnipapillata (freshwater polyp)|JGI  ali  45  1................................................................................................MEDKPSVAEVETFDKSKLKKTETVEKNPLPTKDEITAEKTAE................................................................................................................... 42
161 6.000e-04gi|14906089|gb|AAK72482.1| thymosin beta-4 [Branchiostoma belcheri]  clstr ali  48  1................................................................................................MSDKPDLSEVEKFDKSKLKKTETSVKNTLPSKEAIEQEKQTVQQQ................................................................................................................ 45
162 6.000e-04NEWGM CIOSA ENSCSAVP00000019786 pep:novel reftig:CSAV2.0:reftig_19:5110135:5111530:1 gene:ENSCSAVG00000011612 transcript:ENSCSAVT0000001999  ali  11  5................................PDLGQIEVFNKGDLKSTETREKSG---AVEGFAQEKT----MQEIGQFQKDKLKHAETDVKQKLPTQQEL....................................................................................................................................................... 67
163 6.000e-04gi|297274061|ref|XP_001117222.2| PREDICTED: thymosin beta-4-like [Macaca mulatta]  clstr ali  15  40........................................................................................................................................................................................FSSATMSDKPNMAEIEKFDKSRLKKTRLQEKNPPPSKEAIEQEKQG....................... 85
164 7.000e-04gi|145628068|ref|ZP_01783869.1| IgA-specific serine endopeptidase [Haemophilus influenzae 22.1-21]  clstr ali  1062.........................................STETAPKSDTATPTENLESVSSETIEKVAENSPQESETVAKNEQKATETTAQNDEKEAKPTVEANTQTNEAHQSEINSTEETVVEDAPTISEPKSRPRRSISSSSNNINLAGTEDTAKVETEKTQEAPKKQQEQPKTVQSQAEPETTTQQAESARENVSTVNNVKEAQPQTQAKETTASNSEQKETAQPVANPKTAENKAENPQSTETTDE. 1312
165 7.000e-04gi|110005909|gb|ABG48500.1| titin a [Danio rerio]  clstr ali  11 8182...................KKVPAKPVEAITVPTEEPPKKLVEEKKPKPPVQEPPKTLPTKPDEAIAVPIAVPP-----------KKVLVEEKKP----KPPIQEPAKKLPAKPDETI-AVPIEEPPKKVLVDEKKPKPPIQEPLKKLATKPDEPIAVPIEE------PPKKDVDEKKPKPPVQ--EPPKKLPAKPAEIAVPIEEPSKKVLVEEKRPQPKIQ--EPTKKLSTKPDE---THAVPTEEPPKKEL 8388
166 7.000e-04NEWGM CAP jgi|Capca1|963|fgenesh1_kg.C_scaffold_372000002|Capitella sp.1|JGI  ali  10  4.....................................................................................................................................................HKLPTDIAKNVEGFDQSKL-KHAETAEKNPLPSKEAVTLEKREVELRSSIEHFSKAELRKSQTQEKNPLPDAQNLSEVKK........................ 82
167 7.000e-04NEWGM CAP jgi|Capca1|211834|fgenesh1_pg.C_scaffold_372000008|Capitella sp.1|JGI  ali  4.....................................................................................................................................................HKLPTDIAKNVEGFDQSKL-KHAETAEKNPLPSKEDIKGEKTHLSLITGVKSFDRGVLSPTSTQEKNTLPDPSTVTLEKRE....................... 83
168 8.000e-04gi|76161984|gb|AAX30141.2| SJCHGC00690 protein [Schistosoma japonicum]  clstr ali  22  19.....................................................................................................VLEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTE-------------------KQLLQEIETPPSLKHTSTKEKNPLPTKDDIVAEKA.............................................................. 89
169 9.000e-04gi|182683590|ref|YP_001835337.1| zinc metalloprotease ZmpB [Streptococcus pneumoniae CGSP14]  clstr ali  12  204................................KEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKSEEKVAVKPESQPSDKPA-------EESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKAVEETPKQEDTQPEVVETKDEAANEPKVETVEKQTEPTEEPKVEQVGEPVEPREDEKAPVSPEKQPEAPE----EEKTAEETPKQEDKIKGIGTKEPVDKS........ 411
170 1.000e-03gi|297264432|ref|XP_002808058.1| PREDICTED: LOW QUALITY PROTEIN: titin-like [Macaca mulatta]  clstr ali  14 9214.....................VPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKETVEKIHVAVSKRVEPPPKVPELPKKPVPEEPAPKVPEVPKKPVPEEKKPVPKKEPAAPPKVPEVPKKPVPEEKIPVPVAKKKEAPPAKVPE-VQKRVVTEEKITIVTQREESPPPAVPEIP-----------KKKVPEERKPVPRKEEEVPPPKVPALPKKPVPEEKVAVPVPVAKK. 9448
171 1.000e-03gi|320164958|gb|EFW41857.1| hypothetical protein CAOG_06989 [Capsaspora owczarzaki ATCC 30864]  clstr ali  38  1....................................................................................MRGQSEFFNKFTMSDKDVIAGLGSFDKSKLKKADTNEKNALPSKDDLAAAKADPSQK................................................................................................................ 59
172 1.000e-03gi|300123208|emb|CBK24481.2| unnamed protein product [Blastocystis hominis]  clstr ali  14  121......................PSTEVPSTEVPTEAPSTEAPSTEAPSTETPSTEAPSTEAPSTEAPTEAPTEAPSTEAPSTEVPEAPTTEVPTEAPTDEVPTTEVPTEAPSTEVPTTTTEAPTEAPTEAPSTE-VPTEAPSTEAPTEAPTTEVPTEAPTDEVPTTEVPTEAPSTE---VPTASPTTEVPTEEVPTTEAPSTEVPTEAPTEEVPTTELPTTQSPTTEAPTTQSPTTEAPTTLPPTEAPT.... 356
173 1.000e-03gi|82619124|gb|ABB85285.1| thymosin beta-4 [Lymnaea stagnalis]  clstr ali  51  1................................................................................................MSDKPDLSEVSKFDKNKLKKVETTEKNPLPTKETIAQEKEA.................................................................................................................... 41
174 1.000e-03gi|256017087|dbj|BAH97322.1| thymosin beta-b [Danio rerio]  clstr ali  50  1................................................................................................MSDKPDVSEVSHFDKNKLKKTVTHEKNTLPTKETIEQEKKCE................................................................................................................... 42
175 1.000e-03gi|14210081|gb|AAK56925.1|AF369907_1 Iga1 protease type 2 [Haemophilus influenzae biotype aegyptius]  clstr ali  10 1152.........................KVSQPTETDKIATVETETARVEKEETQVASQTFPKQEEPEMTKQAEPETRNVPIVNNLEEAQPQTKPITVATAETP-----TSNSKSAEKTQPSGETNAEPVTPVVVSENQPENTISQPTEDTVVKVETEETPKVETGGTKEAPQASQTSPKQEEPETVQPQAEPAQENSPNNVEEAQPQTVAAKEITAPNSA-QKETAQSVANPKTAEQPVTVSTENP......... 1373
176 1.000e-03gi|68249575|ref|YP_248687.1| IgA-specific serine endopeptidase [Haemophilus influenzae 86-028NP]  clstr ali  10 1106..............................................PQADTTQADDPSESVPSETIEKVAENSPQESETVAKNEQKATETTAQNDEKEAKPTVEANTQTNEARQSEINSTEETVVEDDPTISEPKSRPRRSISSSSNNINLAGTEDTAKVETEKTQEAPAKQQEQPKTVQSQAQPETTTQQAEPARENVSTVNNVKAKPTTVAAKETTASNSEQKETAQPVANPKTAENKAENPQSTETTDE. 1350
177 1.000e-03gi|297270913|ref|XP_002800169.1| PREDICTED: thymosin beta-10-like [Macaca mulatta]  clstr ali  34  1................................................................................................MAHKLDLGEIAGLDKVKLKATEMQ-KNTLPTKETTEQEKRSE................................................................................................................... 41
178 1.000e-03gi|195331699|ref|XP_002032537.1| GM23472 [Drosophila sechellia]  clstr ali  2260.............................................................................................................................PTPSPTVEEKSEAEEPTKMETSSSEIKADVDVEVEDEDKDKEKPAQTDTESKET-PAKEEIADDKSKQDEPEEIEKQSRECEKKSETDEKPTEITTVSTEEEKQPTANCDNQQTSNNSHSKA...... 2382
179 1.000e-03NEWGM HELRO jgi|Helro1|175630|Helobdella robusta|JGI  ali  20  1...................................................................................................................................................................................................MSEVEKFDKSKLKKAETAEKNPLPTKEGVA............................ 30
180 0.002gi|301622252|ref|XP_002940447.1| PREDICTED: thymosin beta-15A-like [Xenopus (Silurana) tropicalis]  clstr ali  48  1................................................................................................MSDKPDLSEVEKFDHRKLRKTNTEEKNTLPSKEVIEQEKAAGKDK................................................................................................................ 45
181 0.002gi|345801071|ref|XP_003434769.1| PREDICTED: putative thymosin beta-4-like protein 2-like [Canis lupus familiaris]  clstr ali  40  1................................................................................................MSDKPDMPKIEKFNKSKLKKTEMQDTNPLPSKETTEQEKQASES................................................................................................................. 44
182 0.002gi|229843951|ref|ZP_04464092.1| recombination protein F [Haemophilus influenzae 6P18H1]  clstr ali  1041..............................................................SETTETVAENSKQESKTVEKNEQDATETTAQNGEVAQKPSVEANTQTNEAKVEKDEIQEAPQMTSETSPKQAEPAPEKVSTDTKVEETQVQAQPQTQSTTVVASKLAAETQPSEKANAEPVTSVSQNQPENKVSQPTETEKTAKVEKEKTQEAPKVTSQVSPKQEQSETVQP................... 1240
183 0.002gi|195435518|ref|XP_002065727.1| GK19858 [Drosophila willistoni]  clstr ali  629..............................................KTTGNQAKIRPSSKEKSPVKEKELKEIENDSKTTSHQSTIRPGSKEKSPVKAKELSKIEKDSKTTGNQAKIRPSSKEKSPVKE--KELNKIENDSKTTSHQSTIRPSSKEKSPVKEKELSKIEKDSKTTSNQPSSKEKSPVKENKLNKIQKDSKTADNQSTIRPRSKEKSPVKEKEFNEYQKDSKTTSHQSKIRSRSKEKSPSEEEL 837
184 0.002gi|325118201|emb|CBZ53752.1| conserved hypothetical protein [Neospora caninum Liverpool]  clstr ali  11  594.................SDEKEKVASDEKEKVASDEEEKARNDEKEKVASDEKEKVASDEKEKVASDEKESAASDEKESAASDEEEKVASDEKEKVASDEKESAEEEKVASDEKEKVASDEKEKVASKEKVASDEEEKVASDEKEKVASDEEEKARNDEKEKVASDEKEKVASDEKEKAGSDEKESAASDEKEKVASDVKEKVASDEKEKAASDEKGEPRREEEEKDEKGEPRREEEEKAGNDAKGTPRREE. 836
185 0.002gi|182636872|gb|ACB97647.1| thymosin beta [Paralichthys olivaceus]  clstr ali  53  1................................................................................................MSDKPDISEVTNFDRTKLKKTETDEKNTLPTKEVIEQEKSG.................................................................................................................... 41
186 0.002gi|77164126|ref|YP_342651.1| MscS mechanosensitive ion channel [Nitrosococcus oceani ATCC 19707]  clstr ali  14  64................FNAKSKVMLRLRERIFPIPPERTRFISSKIAQVSNSEGQKTKPFSFEVKPPAAIASQPQEVE--ERGRKAEVEALEKKAEETDKKIEQVKETAEAAKLEAAQTALK-----KATVQQQVEKTAQAARAAQQQLEAAKAKAQATGDAADQKEVEKLAEEAEKR----KQATAAEESRLAAIEAKEQAAKEKTTATETE........................................ 264
187 0.002gi|301608958|ref|XP_002934042.1| PREDICTED: hypothetical protein LOC100497578 [Xenopus (Silurana) tropicalis]  clstr ali  50  1................................................................................................MGDRPDLGEIDRFDKTKLKKTETQEKNTLPTKETIEQEKK..................................................................................................................... 40
188 0.002gi|20140817|sp|Q9I980.3|TYB10_TORMA RecName: Full=Thymosin beta-10; Short=Thymb10  clstr ali  50  1................................................................................................MADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS................................................................................................................. 44
189 0.002gi|82704545|ref|XP_726599.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]  clstr ali  11 1537.........................................KSEHTEHTEKAEKTEHTEKAETEKAEKTEHTEHTE----KAEKTEHTEHTEKAEKTEHTEIIQMIKSENTEKTEHTEKAEKTTEKAEHTEKAEKTEQMIKSEKTEKAEHTEIIQMIKSENTEHTEKAEKTEHTEKAEHTEKAEKTEHTEKAEHTEKAEHTEKAEKTEHTEKTEKAEHTEKTEKAEKTEHTEKTEMPAKS--EHTEMPTKSE. 1752
190 0.002gi|328711567|ref|XP_003244574.1| PREDICTED: titin-like [Acyrthosiphon pisum]  clstr ali  12 5459..................................PSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEE----------TAVTEESPETDTTEIVETIVEKGGKRRVRKTKTDVKGEVQSDEIIEEQKPTTKEVEDTPVEEIPTEPETDTTEIVETVVEKVGKRRVRKTKTVVKGEVQENDEIIEETTIEEVEDTPVETLKKTKTQ-KQPLPKESVEEVTLKPFKRPVVEETAVTEESPETDTTEI 5690
191 0.002NEWGM HELRO jgi|Helro1|64710|Helobdella robusta|JGI  ali  18  9.....................................................................QGIEKKDITEFDSSKLKHTETQEKNVLPSQEKTIQHIEAFDKKNLKHAETEVKTTLPDKSVINQEKTIQNIEGFDKSNLKRASTEVKNPLPDKNSK........................................................................................ 109
192 0.002gi|24639628|ref|NP_726909.1| ciboulot, isoform C [Drosophila melanogaster]  clstr ali  18.................................LKSQLEGFNQDKLKNASTQEKI-ILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLP............................................................................................................................................................ 80
193 0.002NEWGM CAP jgi|Capca1|135620|e_gw1.372.14.1|Capitella sp.1|JGI  ali  10  4.....................................................................................................................................................HKLPTDIAKNVEGFDQSKL-KHAETAEKNPLPSKEAVTLEKREVELRSSIEHFSKAELRKSQTQEKNPLPDAQMITQEKTLQGIEHFDKNQ............. 93
194 0.002gi|313235627|emb|CBY11081.1| unnamed protein product [Oikopleura dioica]  clstr ali  16  1................................................................................................MSAENVLSAINSFQKEDLKKTSVDEKQVLPSSEDLSRERKKCSLKKTDTAESAFLAQETSKMQAASFDHSKLKKVEVKNENSFLTKEKTILSAAAETKTIMSVEKFDKNTLKKAETTEKSVLPSASDITREK......................... 158
195 0.002gi|350582919|ref|XP_001924079.3| PREDICTED: hypothetical protein LOC100154646 [Sus scrofa]  clstr ali  1.............................................................................................................................................................................................MSDQPNKAEIEKFNRSKLKKTERQEKNPLPSKETIEPEKQA....................... 41
196 0.002gi|31745565|gb|AAN08022.1| beta-thymosin domain repeat protein CSP29KDa_v1 [Hermissenda crassicornis]  clstr ali  14  48.....................................ISNFRRASLKKSESVEKSN-LPSLAAISQERSQ-DVRERIGSFNKDELKKTDTSEKTQEKKEVALKESISGFDKSNLKHSEVVEKNSLPPQEAVETEKKENEFRKSIEAFPKEG-----------------LKKTECAEKNTLPTKETIQAEKAS............................................................. 192
197 0.002gi|297675821|ref|XP_002815856.1| PREDICTED: thymosin beta-15A-like [Pongo abelii]  clstr ali  52  1................................................................................................MSDKPDISK-GKYDREKLKKISNKEKNTLLSKETIQQEKECIQ.................................................................................................................. 42
198 0.003gi|354491586|ref|XP_003507936.1| PREDICTED: thymosin beta-15A-like [Cricetulus griseus]  clstr ali  65  1................................................................................................MSDRPDLSEVQRFDRSKLKKTNTEEKNTLPSKETIQQEKE..................................................................................................................... 40
199 0.003gi|157136400|ref|XP_001663738.1| uncoordinated protein [Aedes aegypti]  clstr ali  15  682.......................................RIPIASVAKATEQKKEEKHFTAQKVEAVKLPELPKKQFE----SKPDEQKTELTKPVETPKP---KVDKKDRPKLQ-------IPVPEKR-IEGTKTPESPKDKKRPG-SPKSPKGKKSPVKLPESPKLPKPTEPKKAEKVPEQPKVVEKKAPEKTPTKVESPKPAEKKAAESPKVIETPVKPVEKKTLESPKVPAIESPKAFESPKTPTK... 883
200 0.003NEWGM DROPS Contig3479_Contig7346|GENSCAN_predicted_peptide_152|5746_aa|Drosophila pseudoobscura|Baylor  ali  10 4980.................................DPEEGEKREEKPEQHAQSQDKSSKEENVQSVETEKSSSADQVQQPQDQDVKQEQQETEEKDGVGQAENDVREAE---KNKLKQLKTIDQMKESKETEESEQQQPDQTDPAEAEEYQH-VKDPKNSDKTTLDTEEQSKKIQHQEEDEVPNEETEAENATEEPAPDQEEDAQLEQLGAEKTEQKSDKPSKT--EQSKDRLETPEGMEIEGE........... 5195
201 0.003NEWGM APIME gnl|Amel|GB11358-PA GLEAN3_09530|Apis mellifera (honeybee)|Baylor  ali  11 1457.........................................KPEEAKKEEPALKPKPT-LAKPEEAKKEESALKSKTTLAKPEETKKEESALKPKTTLAKP---EEAKKEEPALKP-----KTTLAKPE--EAKKEEPALKPKTTLAK---TEEAKKEELAPKPKTTLTKPVEAKKEEPAPKPKVTLT-KPEEAKKEEPAQKPKTTLGKPEEEEPAPKPKKPERKEEEQTRKLSLKPGAKIEEEAKTLNKVEL 1660
202 0.003gi|262401483|gb|ACY66642.1| thymosin beta [Scylla paramamosain]  clstr ali  11  1...........................................................................................................................................MSAETTLKDLPKVDSVLKEQLEGFSQDKL-KKTDTAEKTSLPTKEDVESEKQHDKLMHNIEDFRSDKLKRTSTSEKIVLPTPEDVAAEKQSQAL--FNAVEGFDAS........ 103
203 0.003gi|225547769|gb|ACN93679.1| thypedin [Carukia barnesi]  clstr ali  22  151..............................VLPDISEVKSFDPTKLKHVETEDKS-VLPTQEVIKEE--AADSRAEVKSFDHGKTETAQTLKEEMRPETLPDVSEVKGFDAHKLKHVETEEKVVLPTQEVIQQE....................................................................................................................... 262
204 0.003gi|291230738|ref|XP_002735323.1| PREDICTED: thypedin-like [Saccoglossus kowalevskii]  clstr ali  1.....................................................................................................................................................MTEVKPEVGELKSFDASKL-KHVDTVEKNPLPSVDTINQEKVDART--EIKGFNPDSLKHVKTEEKNALPTAQDLRAELIPDSLPDRSEVASFDKSK....... 94
205 0.004gi|297304213|ref|XP_002806339.1| PREDICTED: thymosin beta-10-like [Macaca mulatta]  clstr ali  43  15..............................................................................................SKRADNPDMGEIPSFDKAKLKKRETQEKNPLPPKETIEREKGSE................................................................................................................... 58
206 0.004METAHIT MH0041 GL0024669 [Complete] locus=scaffold15067_2:1555:5010:-  ali  10 1014....................RAEMREAEAARQKADEEARAQQEAELKAL--REK----QEAEDKALLEAKREREKQLERDRKERLKQAEAERKAKLKAQKQLLKEKERARKEKLKQAEAERK................................................................................................................................... 1109
207 0.004gi|307172721|gb|EFN64027.1| Myosin light chain kinase, smooth muscle [Camponotus floridanus]  clstr ali  4114..................DERIKKDEKEHKITQETESLKKHEDGKVKQIEKQEKVNATESTEKIKSEKNEQQNKENYEEINKMAEKQEQETVQKRKESDKSKKIEKDLNVKEETGKIKLEEAKDIERKKV--QAKEKEKADEIKKEQELKDIKEKVKEATEQYDKKNEIEKLQKKETDEIDKTQQKEQEHVRIEKTEIVEKDHKIEVKEIKKQEEDKTIKKDGKEQEKEDEKAKRIKT............... 4344
208 0.004gi|152143913|gb|ABS29642.1| thymosin beta-4 [Holothuria glaberrima]  clstr ali  45  1................................................................................................MSDKPDVSEVTKFDKGKLKTVETQEKNTLPTKDTIDQEKAAS................................................................................................................... 42
209 0.004gi|89114258|gb|ABD61717.1| thymosin beta [Scophthalmus maximus]  clstr ali  56  1................................................................................................MSDKPDVSAVKDFDQSKLKKTETAEKNTLPTKETIEQEKSG.................................................................................................................... 41
210 0.004gi|198431357|ref|XP_002125878.1| PREDICTED: similar to RIKEN cDNA 4930488E11 [Ciona intestinalis]  clstr ali  24  3.....................................................................DRPDLAEVSEFDKTNLKKAKTCEKSGAVAQEKALKEIGQFQKDKLKHTDTEVKNKLPTQQEIDQEKSNE................................................................................................................... 74
211 0.004NEWGM CAP jgi|Capca1|185810|fgenesh1_pg.C_scaffold_261000019|Capitella sp.1|JGI  ali  351......................PETKDNAPEIKDNASETKDNAPETKDNAPETKDNAPET--KDNAPETKYNAPETKYNAPETKYNAPETKDNAPETKDNAPETKETKYNAPETKYNAPETKDNAPTKDNVPETKDNAPEAKDNAPETKYNAPETKDNAPETKDNAPETKDNTPETKDNAPETKD-NTPETKDNAPETKDNAPETKDNAPETKDNAPAPETKDIIPEKKIDNTPKTKNNTPESKYKTPEKTK. 587
212 0.004gi|193652610|ref|XP_001951058.1| PREDICTED: hypothetical protein LOC100160577 isoform 1 [Acyrthosiphon pisum]  clstr ali  2.............................................................................................................................................SSPSLKDLPKVAFDLKNQLEGFNPDNM-KKADTNEKIILPTAEDVAAEKTQEALIEGVGGFDTNKLKHTETQEKNPLPDKTVIEAEKEQQQL.................... 96
213 0.005gi|301598532|pdb|3M3N|W Chain W, Structure Of A Longitudinal Actin Dimer Assembled By Tandem W Domains  clstr ali model  60  74................................................................................................................QLKKTETQEKNPLPSKETIEQEKQAGES................................................................................................................. 101
214 0.005gi|291277005|ref|YP_003516777.1| hypothetical protein HMU07910 [Helicobacter mustelae 12198]  clstr ali  14  148.......EDATSASRFLNFRQDPTSKDVKPTQTIEEEVEQTPKTPPPPPDEQKKELKDQIKEQVK-EQLKEQLKEIIPEVDK-KAQPPNPSTPSTTPASTPNTQEEKTKAQNLEQNTQAATPTTPASTPNTQEEKKSEENPASTTEEKSPEVEKKEKIEETTSSSRFLDFR-------KAPTSKEINKEPEKEPENTEIKEQVKEQLKHIKEQVKEQL--KEIIPEAIQKAADAPAPKTKGRKKAPSP..... 391
215 0.005gi|42779687|ref|NP_976934.1| internalin [Bacillus cereus ATCC 10987]  clstr ali  11  849..........................................QNVVNKTESKEET-PKPVVEEKPKEETTKPVVEEKPKEETSK---PVVEEKPKEETSKPVVEEKP---KEETTKPVMEEKPKEETTKPVVEEKPKEETTKPVVEEKP--KEETSKPVVEEKPKEETTKPA-VEEKPKEETSKPVVEEKPKEETTKAVEEKSKEETPKLVMEEKSKEGTSKPVVEERRKEGNKLAKENES............ 1038
216 0.005gi|344272858|ref|XP_003408246.1| PREDICTED: hypothetical protein LOC100670032 [Loxodonta africana]  clstr ali  1.............................................................................................................................................................................................MVDKPDLAEVEKFGKSKLKKIETREKNPLPSKKAMQQEKKA....................... 41
217 0.005gi|334310807|ref|XP_003339543.1| PREDICTED: thymosin beta-4-like [Monodelphis domestica]  clstr ali  13  1.............................................................................................................................................................................................MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGAGPS.................. 46

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.