current user: public




Query: [O] KOG2231 Predicted E3 ubiquitin ligase, from COG0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .
# E-value Template Links and tools%idFirst MQNGKPRSSARPSFHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKNVEIFSIGDCDHPVCYECSTRMRVLCQQNECPICRHVLSKVLFTLDKLPYRELEANNRSDLYSKKYRIGFCTAEIRQQFFKLLDHPCPKCDAPPYRTFEGLRNHVRSEHKLLYCDLCVETLNIFTFERRCYTQAELQLHNTKGDPDNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADGCNEFYNDYADLAEHFRAEHFLCEEGKCATEQFVGAFRNEIEYKAHVANVHGKSLNKQQAKQTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARAAQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKKAATPQVDFPALPGKGNKKNLRNLEEDMLPSGSPVPMANISAKHRSLADDYVSVASPSTFQKLQMVQKEEDEAKARQEALKKSAPKLTAAEFPSLGPSASASSSRTTAPKPSSGSPSLNWSKPANEKKQRELENRKAKVAPAPVLPSPTSKPAPKASNNNVQEQQANKKDKKQKDKKSNQENQPKTAKPKERNNNNEQKTNGAPSTPIRAPPGLKPGGPLKPPPGFVSNVTVNSVAKLPNNLTFTNSLGESYDIVPSPYTYTDPPDTEVRNQKLVDEVMSLLKTPEALNEFRLLSSKFRDGSCSGQAYYEHCQCAMLSSFYNLFPELLAMLPDISKQQELYLVHKQHLNSLPPAERKSVPALEVCKVCKQILITADLKSHQQAHELTKNFPVLGSSASNTHRNLast
1 0.000e+00gi|975125033|ref|XP_015278238.1| PREDICTED: zinc finger protein 658B-like [Gekko japonicus]  clstr ali  12  27.....................QCGKYIRNRSHLFVHQTIHRGEKPFECSECGKRFSRSGYLQ--------VHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGK-RFSRSGYLQVHRRTHEKPFECSECGKRFSCSECGKRFSRSGYLQVHRRTHTGEKPF-----ECSECGKRFSRSGYLQVHRREKPFECSECGKRFSRSGYLQVHR-RTHTGEKPFECSEC-------GKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPFECSECGKRFSRSGYLQVHRRTHTGEKPF---------ECSECGKRFSRSGYLQVHRRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 468
2 0.000e+00gi|640793741|ref|XP_008052860.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 658B-like [Tarsius syrichta]  clstr ali  13  298....NKTLRVHQRTHTGYECDECGKTFSRKTHLRGHQRTHTGEKPYECNVCGKTLSEKSYANAHQRVCNICHQKIHTGVKPYGCNECGKTFSRKSHLSAHQRTHTGEKPYECNECGKTFAHNSHLSEHQRTHTGEKPYECNECGK-TFSHKSHLKAHQRTHEKLYECNECGKTLSCNICRKPFAYNSSLSVHQRIHTGVKSYG-----CDECGKTFSRKSHLSSHQRTKPYECNECGKTFSEKSYANAHQ-RVHTEEKPYECNIC-------GKPFALNSSLRVHQRIHTGVKPYGCNECGKTFSQKSHLNAHQRTHTGKKPYECNECGKGFSYLSTLRVHQRIHTGEKPYECGECRKIFVHKAALIVHHRMHTREKTLKLHEFEKS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 715
3 0.000e+00gi|944360110|ref|XP_014381609.1| PREDICTED: zinc finger protein 11-like [Alligator sinensis]  clstr ali  12  431.......HKIRPAREKPYICFRSGKSFTCPSPLAAHRKIHSKEKRYCCVKCGKTYTRFSSLRTHHCTCTKCHMQMHTKEKPYQCFECGKSFTCASYLAQHQLIHTVQRPHQCSVCGKSFTQSPNLVRHQCIHTGEKPHQCPDCGK-RFTRPSNLAQHKRIHEKPYQCSQCGKSFQCSVCGKSFTQSPNLVRHQRIHTGEKPYLAQHHQCTVCGKSFTKSCHLRIHMREKSHQCSECGKSFTCSSQLAQHQV-VHTGERPHQCSEC---GKSFTQSSSLARHQHIHMGEKPHQCSECGKSFTNPYNLAQHQRIHTGEKPHHCSVCGKSFTQSSHLARHQRIHTGEKPHQCFVCGKSFTCSSQLTQHQVVHTGERPHQCSECGKSFTQSSSLS----QHQRIHTGEKPHHCYECGKSFTNSSSLSQHQRIHTGEKP---------HHCSECGKSFTQSSHLAQHQRMHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 1022
4 0.000e+00gi|440900411|gb|ELR51556.1| Zinc finger protein 135 [Bos mutus]  clstr ali  12  201..............................................................................EKPYGCQECGKAFSHSLALTEHHRTHTGERPYECLECGKGFRNSSALTKHQRIHTGEKPYKCAQCGR-TFNQIAPLIQHQRTHEKPYECSECGK---------SFSFRSSFSQHERTHTGEKPY-----TCSQCGKAFRQSIHLTQHLREKPYQCGECGKAFSHSSSLTKHQ-RIHTGEKPYECQAC-------GKAFTQITPLIQHQRIHTGERPYECSECGRAFSQSTLLTEHRRIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHLTQHQRTHTGEKPYECSDCGKAFSHSSSLTKHQRIHTGEKPYECNECGKAFSQLAPLIQHQRIHTGEKPYECNQ---------CGRAFSQSSLLIEHQRIHTKE.............................................................................................................................................................................................................................................................................................................................................................................................................. 565
5 0.000e+00gi|918303720|gb|KOF76468.1| hypothetical protein OCBIM_22033317mg [Octopus bimaculoides]  clstr ali  12  15.............................................................................................................YECDICKKSLSSKRNLTLHKRIHAGGKQYHCDICGK-SFLHKSNLTSHKYTHEKPYSCDICGKSFS---------QKSTLIYHKSIHTGEKPYQ-----CDICGKSFSQKNTLTYHKSEKPYSCDICGESFSQRKTLACHKS-IHTGDKPYHCDVC-------GKSFSQKCNLTSHKRTHTGEKPYSCDICGKSFSQRKTLACHKTIHTQEKPYHCDICGKSFSHKNSLTSHKSIHTQEKPYHCHICGKSYTQKSNLTSHKSIHTGDKPYHCNICDKSFVVKSYLTVHGRTHTNERPYQCDICGKSFSQRSGLTHHKYTHTGEKPYQ---------CDFCDKSFVVRNNLTAHELTHTKERSH........................................................................................................................................................................................................................................................................................................................................................................................................... 351
6 0.000e+00gi|918313832|gb|KOF83724.1| hypothetical protein OCBIM_22023379mg [Octopus bimaculoides]  clstr ali  12  205VSSTLAAHKRIHTGEKPYHCDICSRSFTESSSLTAHKRLHSGEKPYHCDICGKSFTVSSRLTE--------HKRTHTGVKPYHCDICGKSFSKSSNLTPHKRIHTGEKPYHCDTCGRLFSESSALTTHKRLHSGEKPYHCDICGK-SFSDSSNLTTHKLIHEMPYHCDICGKSFHCDICGKSFHKRHQLTKHKRIHTGEKLYH-----CGTCGKSFMENSALTTHKRERPYYCDICGKSFSQNGNLTIHK-RIHTGETPYHCDIC---GKSFTVSCSLTRHKRIHMRE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 499
7 0.000e+00gi|471416838|ref|XP_004389940.1| PREDICTED: zinc finger protein 33B [Trichechus manatus latirostris]  clstr ali  10  168......QHEKNQTSEQNFEYNVCQELFHEKVVFNTHKRENPEGNDYEYDECGRTFCDNSSLLFYQIGPSRNH---------YEFSDCGKSLCMKSALLKHHGIHM--KPYECNESGNNFRRKLYLSQLQKTHKGEKHFECNECGKA-FWEKLHLTRHQRIHTG-------EKHFECNECGKTFWEKSNLTKHQRSHTGEKP-----HKCSECEKAFSHKSALTLHQREKPYQCNVCGKTFYQKSDLTKHQ-RTHTGLKPYECYEC-------GKSFCMNSHLIVHQRIHTGEKPFECPKCGKSFYQKSHLSQHQRTHIGEKPYECNACGKTFYHKSVLTRHQIIHTGLKPYECYQCGKTFCLKSDLMVHQRIHTGEKPFACPECGKFFSHKSTLSQHYRMHTGDKPYECNECGKIFYNKSYLTKHNRTHTGEKPYECN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 572
8 0.000e+00gi|961108060|ref|XP_014777880.1| PREDICTED: zinc finger protein 208-like [Octopus bimaculoides]  clstr ali  10  13..........................................................................................................ETSYHCDICKKSFSLKGNLATHKCIDKEEKRYHCDICGK-SFTVKMNLTEHKHIHEKPHNCDVCGKSF---------ARICTLITHKHLHTGEKP-----HSCDICGKSFTVKINLTEHKGEKPHNCDICGKSFARIRTLITHK-HLHTGEKPHSCDIC-------GKSFSLRGHLACHKRTHTGEKPYHCDICGKSFSQTNSLTNHIRIHTGEKPYQCNICGESFSERGNLTKHKYIHTGEKSYHCDICGKSFFQRVHLNTHRRIHTGEKPYHCDICGKSFYDGSAVTSHKRIHTGEKPYPCDICDKSFTDASKLTKHKRTHTGEKPYPCHTGEKPYHCDICGKSFSRTSQLTIHKRRVHTGEKPYP......................................................................................................................................................................................................................................................................................................................................................................................................... 385
9 0.000e+00gi|821463414|ref|XP_012396222.1| PREDICTED: zinc finger protein 260-like, partial [Sarcophilus harrisii]  clstr ali  12  175.......LNEIQQIHKAETPSECGKPFNHNPSLPSHQKIHPEKKSYE-FL--KSFLQNSQLPR--------HQKIHNGEKHYECNECGKTFSQRGYLPGHQRIHTGEKPYDCKECGKAFRLREHLTRHQRIHTGEKPHKCNECRKA-FHLSTDLTRHVHTGEKPHKCHECGKAFS---------QRGHLTVHQTIHTGEKPY-----ECNDCGKVFRLRGLLTKHQGEKPYECHECGKAFHLREQLTRHQG-IHTGEKPYECKEC-------GKAFYLSTELTRHQRIHTGEKPYECKECGKSFHLNTDLIGHQRIHTGEKPYDCKECGKAFHLRAHLSRHQRSHTGERPYECNECGKAFHLSSDLTRHQRIHTGEKPYECKECGKAFLLSTDLTRHQRIHTGEKPYECNECGKAFHQREYLTRHQRIHTGEKPYECN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 580
10 0.000e+00gi|260794583|ref|XP_002592288.1| hypothetical protein BRAFLDRAFT_71028 [Branchiostoma floridae]  clstr ali  12  713LQGNLKTHMRTHTGEKPHRCEECSKQFSSHGNLKTHMRTHTGEKPYKCEECSRRFSQMSRLK--------VHMRIHGGEKPYRCEECSRQFSELAHLTKHMRIHTGEKPYKCEECSRQFSEAGSLKTHMRTHTGEKPYRCEECSKQ-FSQLSNLKKHMRTHEKPYSCEECSRQFSEL---------GALKTHMRTHTGEKPY-----RCEECSRQFSELAHLTKHMREKPYKCEECSRQFSEAGSLKTH-MRTHTGEKPYRCEEC-------SKQFSQLSNLKKHMRTHTGEKPYSCEECSRQFSELGALKTHMRTHTGEKPYRCEECSKQFRHLNALKKHKKTH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1032
11 0.000e+00gi|918312925|gb|KOF83015.1| hypothetical protein OCBIM_22024555mg [Octopus bimaculoides]  clstr ali  11  138VKSKLSTHEFTHTNERPYQCDICGKSFSHRSNLTSHISIHTGEKPYRCDICGKSFSLNGHLTSHIS--------IHTGDKPYHCDICGKSFSHKHRLTYHKYIHTGDKPYHCNICDKSFVVKSELTVHEFTYTNERPYQCDICGK-SFSQKSTLIYHKYTHEKPYQCDICGKSFS---------QKNGLTSHKYIHTGEKPY-----RCDICGKSFSQKSTLTSHKSEKPYHCDICGKSFSHKSRLTYHKS-IHTGDKPYQCDIC-------GKSFSQKGNLTSHKSIHRVQKPYQYDICGKSFSQKSGLTSHKYIHTGEKPYQCDICGKSFSQKGNLTSHKSIQTGEKPYPCNI................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 467
12 0.000e+00gi|686724933|ref|XP_009241043.1| PREDICTED: zinc finger protein 479-like [Pongo abelii]  clstr ali  12  276LSSTLTDHKRIHTGEKPYTCEECGQAFRRSSTLTNHKRIHTGERPYKCEECGKAYSLPSTLAD--------HKRIHTGEKPCRCEECGQAFTWSSNLTRHKRIHTGERPYTCEECGKAYSLLSTLTDHKRIHTGEKPCRCEECGKA-FTWSSNLTRHKRIHEKPYTCEECG---------QAFSLSSNLTRHKRMHTAGKPY-----TCEECGQDFRRSSALTIHRRERPYKCEECGKAFSLSSTLTDHK-RIHTGEKPYICEEC-------GKAFNYSSTLMQHKRIHTGEKPYKCEECDQAFKLAKHKTIHTGEKPYKCEECGKAFKWHSSLAKHKTIHTAEKPYKCE..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 604
13 0.000e+00gi|688549955|ref|XP_005157337.2| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  13  178..SRSSYLNQHMRIHTGEKCTQCGKSFSQSSHFNYHMMIHTGEKPFKCTQCGKSFSQSSHLKHHTRTCTQCHMRIHTGEKPFTCTQCGKSFSQSSHLNHHMRIHTGEKPFTCTQCGKSFSQSSHFNYHMRIHTGDKLFTCTQCGK-SFSCSSSFNQHMRIHTKPFTCLQCGKSFKCTQCGKSFSQSSHLKHHTRIHSGEKPF-----TCTQCGKSFSRSSYLNQHMREKPFTCTQCGKSFSQSSHLN-HHMRIHTGEKPFTCTQC-------GKSFSRSSYLNQHMRIHTGK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 501
14 0.000e+00gi|1004699155|ref|XP_015746807.1| PREDICTED: zinc finger protein 883-like [Python bivittatus]  clstr ali  12  65..............................................................................EKQRECREHGKNNVLNLCLALHQRI-EIEKPYKCPKSEKSFNESSTFNTHKTIHRVEKSYKCTECRKKRFNTSIDLNSHQRIHTKPYKCMDCGKSFT---------TSGSLISHKRIHTGEKPY-----KCMDCGKSFTMSSNLTSHQREKPYKCTECGKSFSQSTSLTYHE-RIHTGMKPYQCMEC-------GKRFSTSSHLISHKRIHTGEKPFKCMECGKSFTMRRGLTSHERIHTGEKPYQCRECGKSFRIRSDLMSHKRIHTGEKPYKCMECGKSFSRSGNLTSHKRIHTGEKPYKCMECGKSFSQSTSLTSHERIHTGEKPYKCMECGKSFTNSSQLTTHNRIHTGEKPYQ---------CTECGRSFTTSGSLTSHKRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 456
15 0.000e+00gi|918625980|ref|XP_013377769.1| PREDICTED: zinc finger protein 420 isoform X5 [Chinchilla lanigera]  clstr ali  13  683.SSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSYSSYLSQ--------HQRIHTGKKPYECKECGKAFGYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQHVRIHTGEKPYECKDCGKA-FTQSSKLVQHQRIHEKPYECKECGKAFS---------NGSALINHQRIHTGEKPYD-----CKECGKAFTQSSQLRQHQREKPFECLECGKAFTQNSQLFQHQ-RIHTDEKPYECSEC-------GKAFNKCSNLTRHLRIHTGEKPHNCQECGKAFSSGSDLIRHQGTHTNE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 976
16 0.000e+00gi|674038929|ref|XP_008825163.1| PREDICTED: zinc finger protein 726-like [Nannospalax galili]  clstr ali  12  4..NQNSTLRRHQRVQKPCKWEECDKSNTHVSNLRKHKYVHTGKKSYRFEECGKSFSHMSDLRAHQQT--------HTGEKPYRCEECDKSFRLISHLRAHQRTHTGEKPYRCEQCGKSFRCMSEFTVHQRIHTGEKPYRCEECDK-SFRLISHLRAHQRTHEKPYRCEQCGKSFS---------QMSHLSAHQRIHTGEKPY-----RCEECGKSLRIMSDRTAHQREKPYRCEECGKSLRIMSDRTAHQ-RIHTGEKPYRCEEC-------GKYFSQMSYLRVHKRIHTGEKPYRCEECGKSFSQMSYLRSHQRIHAVEKPYRCEKCGKSFNQMSDFTIHQRTHTGEKPYRCEECGKSFNQMSHLSAHQRIHTGEKPYKCEECGKSFTRMSDLRAHQRIHTGEKPYRCEECGKSFRIMSDLTAHQRIHTGEKPYRC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 417
17 0.000e+00gi|929249194|ref|XP_014000767.1| PREDICTED: zinc finger protein 271-like [Salmo salar]  clstr ali  10  59.SGNLTSHQRTHTGEKPYSCDQCEKSFTESGGLTKHQRTHTGEKPYSCDECGKSFITSNILTQHKITCDQCHQRIHTGEKPYSCDQCGKSFAASTNLNLHQRIHTGEKPYGCGQCGKSFVQSGHLTLHQRTHTGDKPYSCDQCGK-SFAASSTLTLHQRTHEKPYSCGQCGKSFSCDQCGKSFTESGGIKIHQRTHTGEKPY-----SCDQCGKSFVQSGNLTSHQREKPYSCDQCEKSFTESGGLTKHQ-RTHTGDKPYSCDQC-------GKSFAASSTLTLHQRTHTGEKPYSCGQCGKSFVQSGHLTVHQRTHTGEKPYSCDQCGKSFTESGGLTKHQRTHIGEKPNSCDQYGKSFLLTKHQRTHTGENPHSCDQR....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 468
18 0.000e+00gi|1004692617|ref|XP_015745916.1| PREDICTED: zinc finger protein 721-like isoform X1 [Python bivittatus]  clstr ali  10  357...............................................................HQSFILSLHNRVKMGEKPYICLVCGKSFSQSSALISHKRIHRGEKLHKCMECGKKFRWKSDLISHKRVHTGEKPYKCMECGKK-FRWKSDLISHKRVHEKPYKCMECGK---------KFRWKSDLISHKRVHTGEKPY-----KCMECGKSFSQSSNLISHKREKPYKCTECGKCFRWSSQFTSHK-RIHTGEKPYKCVECPYQCLECGKNFSMSSHLTSHKRIHTGEKPYKCLECGKSFRENGSLSSHKMIHTGEKPYKCRECGKKFRKISSLTSHTRIHTGEKPYKCMECGKIFQKSTSLTSHKRIHTGEKPYECMECGKSFRENGSLTSHKRIHSGEKPYKCMECGKSFIRSSSLTSHKRIHTGEKPYT---------CTECGKSFRENGTLTSHKRIHRGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 764
19 0.000e+00gi|612063442|ref|XP_007506085.1| PREDICTED: neurotrophin receptor-interacting factor 1-like isoform X1 [Monodelphis domestica]  clstr ali  12  121...QNSSHIEHQGIHSGDKSSQCGKTLMHRAIRVGHQRRQSLKKPYECKQCGKTFTYYSSLAR--------HQRIHSGEKPYECNQCGKTVSRSSYLAQHQRIHSGEKPYECNQCGKTFSQSCNLFIHQRIHSGVKPYECNQCGRA-FRLSSSLAVHQRIHEKLYECKQCGKTFH---------WNSSLAKHQRIHTGEKP-----CECKQCGKTFHWNSSLAKHQREKSYECKQCGKTFHWNSSLAKHQ-RIHTGEKPYECKQC-------GKTFNQSYHLAIHQRIHTGEKPFECKQCGKRFSENSILAVHQRIHTGEKPYDCKKCGKTFSQSCNLALHQRIHTGEKPYECNQCGKTFSRSSSLAVHQKIHSGEKPYECNQCGKTFSRSSHLAVHQRIHTGETPYECNQCGKTFSQSSSLAVHQRIHTGEKPYECKK............................................................................................................................................................................................................................................................................................................................................................................................................................................ 534
20 0.000e+00gi|260788063|ref|XP_002589070.1| hypothetical protein BRAFLDRAFT_120891 [Branchiostoma floridae]  clstr ali  12  116..SQLVRLKTHMRTHTGEKPYRCEECFNELGTLKSHMRTHTGEKPYRCEECSKQFSQPGDVKTHMRTCEECHMRTHTGEKPYRCGECSRQFSQLGHLKTHMRTHTGEKPYKCEECSRKFSQMSGLKSHMQAHTGEKPYQCEECSRQ-FSQLVRLKTHMRTHEKPYRCEECSRKFRCEECSKQFSQPGDLKTHMRTHTGEKPY-----RCEECSRQFSLLGDLKSHMREKPYRFEECSRQFSQLDDLKRH-MRTHTREKPYMCEEC-------SRQFSQLSTLKKHMRTHTGEKPYRCEECSRQFSQLSTLKKHMRTHTGEKPYRCEECSRQFNELDNLEKHMRTHTGEKPYKCEECSRQFSRLSNLKRHMRTHTGRNPTGLRSFRRQFCQQVVLQRHSADSCRRKPFKCEDCSKQFGMWCDLKRHMQT....................................................................................................................................................................................................................................................................................................................................................................................................................................................... 576
21 0.000e+00gi|688550711|ref|XP_009299041.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  13  226.KNTLNHHMRTHTGEKPFACTQCGKSLANKSKLTIHMRIHTGEKPFTCTQCGKSFNRSSHLNI--------HMRIHTGEKPFTCTQCGKSFSQSSYLNLHMRIHTGEKPFTCTQCGKSFNCLAHLNKHMRIHTGEKPWTCTQCGK-SFSQSSSLKHHMRIHEKPFTCTQCGKSFSC---------SSDINRHMRIHTGEKPF-----TCTQCGKSFSQSSSLNHHMREKPFTCTQCGKSFSQSSSLNLH-MRIHTGEKPITCTQ---YGKSFSQSSSLNHHMRIHTGE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 491
22 0.000e+00gi|1004693620|ref|XP_015746158.1| PREDICTED: zinc finger protein 493-like isoform X1 [Python bivittatus]  clstr ali  13  653MNSSLTHHKRSHTGEKPYKCLECGKSFSSSSYLSSHKRIHTGEKPYKCMDCGKSFSLNSSLTSHKKIHLTCHKRIHTGEKPYKCTDCGKTFNWHGHLMSHKWIHTGEKPYKCVHCGKSFSKNSSLTSHERIHTGEKPYQCIECGK-SFTTSSELNSHKRVHEKPYKCTECGKSYKCMECGKSFSMNSSLTSHKRIHTGEKPY-----KCTECGKSFTQRGQLTSHKREKPYKCLECGKSFSMNSSLTSHK-RIHTGEKPFKCMEC---GKSFSKSRSLTSHNRIHTEEKPFKCLECGKSFNKSSSLTGHKRIHSGLK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1004
23 0.000e+00gi|641783189|ref|XP_008174001.1| PREDICTED: zinc finger protein 850-like, partial [Chrysemys picta bellii]  clstr ali  12  140....................................................ENFSTHSDLLIHDRINLE--------ETCYTCPEYGKIFNGNSALITHQTIYTGEKPYGCSECGKRFINSSTLISHQRIHTGEAPHTCSEGGK-TFNQSSAPSTHSRIHEKPYRCSECGKCFN---------RSSNLITHQRIHTGETPY-----TCSECGKNFSRRSNLITHQREMLYTCSECRKSFSRSSTLIRHQ-RIHTGETPYTCSEC-------GKSFSRSSALIAHRRIHMGEKPYGCSECGKRFIDSSTFISHQRIHTGEKPYGCSECGKSFSHSSSLITHQRIHTGERPYTCSECGKSFNHSSALSKHWRIHTGEKPYGCSECGKSFSHSSALSTHRRIHTGERPYTCSECGKSFSKSSTLITHQRIHTGEKPYTCY............................................................................................................................................................................................................................................................................................................................................................................................................................................. 500
24 0.000e+00gi|918285955|gb|KOF66576.1| hypothetical protein OCBIM_22011920mg, partial [Octopus bimaculoides]  clstr ali  11  518.SSSLNTHKHIHTGETPYHCDTCGKSFSTSSSLNTHIRIHTRETPYHCDTCGKSFSTSSSLNTHIRICDTCHKHIHTGEKPYHCDICGKSFSGNSNLNTHRLVHTGEKPFHCGICGKSFSRNSTLYKHKFIHTGEKPYHCDICGK-FFSTASSLITHKHIHEKSYHCDICGKSFSCDICGKSFSENSALYKHKFIHTGEKPYH-----CDICGKSFSGNSNLNTHKRERPYHCHICGKSFSASSSLNAHRL-IHTGEKPYRCDIC-------GKSFSGNSTLYKHKFIHTGRKPFHCDVCGKSFSENCILNTHKRIHTGERPYHCDICGKSFSKSSNLNSHKRIHTGEKPYHCGICGKSFSKSNNLNSHTRIHTGEKPYRCEICGKSFPVPCKLRAHKYIHTREK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 953
25 0.000e+00gi|918334959|gb|KOF97100.1| hypothetical protein OCBIM_22031470mg, partial [Octopus bimaculoides]  clstr ali  16  256MNSNLTIHKRIHTGEQPYRCEICGKSFINNSHLVIHIRSHTGEKPYHCDVCGKSFSNNSHL--------VVHKRIHSGERPYHCDTCGKTFSQNSHLLIHVRFHTGEKPYHCDICGKAFSISGHLTKHIRIHTGEKPYHCDICEK-TFSDSSSFTKHKRIHEKPYCCDVCGKSFS---------ANDYLSKHIRIHTGEKPY-----RCDICGNAFSVGSSLSKHKRERPYHCDICDSIFSTSLSLSRHQ-RIHRGEKPYQCDIC-------GKAFSQNSNLSSHK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 521
26 0.000e+00gi|918319288|gb|KOF87941.1| hypothetical protein OCBIM_22015816mg, partial [Octopus bimaculoides]  clstr ali  12  1..............................................................................................INLARHKRRHTGEKSSHCKICGKSFFQNSNLVIHVRSHTGEKPFHCEICGKKSFSNNSNLITHIRSHEKPYHCQVCGKSFSCKTCGKFFVSNSVLTKHNRIHTGEKPY-----RCETCGKSFVKNDDLSRHKGVKQFHCEICGKSFTQNSSLVIHIRR-HTGERPYHCEICEYLDIICQSSFSFNSEQTIHKCIHTGEKPHCCDICGKSFSQSHHLTTHKRIHTGEKPYNCDICGRSFPQNHHLIIHKRIHTGEKPYHCGVCGKSFAQNHILINHKRIHTGEKPFHCDICGKFFTQNDGLIKHIRIHTGEKPYHCDICGKSFSQSDVLTKHKRIHTGEKPY---------HCDICGKSFSQNHHLTKHKPTHT................................................................................................................................................................................................................................................................................................................................................................................................................ 449
27 0.000e+00gi|961130217|ref|XP_014785691.1| PREDICTED: zinc finger protein 208-like, partial [Octopus bimaculoides]  clstr ali  11  670VNSSLTSHKRIHTGEKPYDCDVCDKSFSSNSNLIYHKRTHTGEKPYQCNICGKSFSLNSNLTRHKHICDICHKRIHTGEKPYHCDICDKSFSSNSNMIQHKRIHTEGKPYRCDICGKSFSKNSTLSCHKHIHKGEKPYHCDICG-NSFPCNSHLICHKRIHEKPYQCEICGKSFHCDVCGKSFSGNSSLTTHKHIHTGEKSYD-----CDICDKSFSRHDSLTRHKREKPYQCDICGESFSEYGTLTSHK-RIHTGEKPYHCNIC-------GKSFSQNNHLTRHKRIHTGEKPYQCDICGKSFFCNSRFIRHQRIHTGEKAHQCDICGKSFSENSTLTYHRRSHTGEKPYHSNICGKSFIANSVLNKHKHVHTAKKPYHCDTCGKSFTQERVLSKHECIHAGEKPHH........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1108
28 0.000e+00gi|688549563|ref|XP_009298867.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  10  1.............................................................................GEKPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGK-SFNRSSNLDQHIRIHEKPITCTLCGKSFR---------QSSSLSKHMRTHTGEKPF-----TCTQCGKSFRQASSLNKHMREKPFTCTQCGKSFNRSSHLNQHI-RIHTGEKPITCTQC-------GKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKLITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQTSSLNKHMRIHTGKKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSN.................................................................................................................................................................................................................................................................................................................................................................................................................................. 355
29 0.000e+00gi|1004692795|ref|XP_007441437.2| PREDICTED: zinc finger protein 420-like isoform X2 [Python bivittatus]  clstr ali  10  312...................CFQFGEIVREESDLCEHTRIHMKETQDECREDGKTFKWN--------IPLTLHQSIHMKGKPYKCMECGNSFNNSSHFISHKRIHSGEKPYKCLECGKSFSENSSLTSHKRIHSGEKPYKCLECGK-SFSQSGQLTSHKRIHEKPYKCTECGKNFS---------QNGQLTSHKRIHSGEKPY-----KCMECGKSFSQSGHLTFHKREKPYKCMECGKSFTISSHLTSHK-RIHTGEKPYKCTEC-------GKTCSTNSDLTLHKRIHSGEKPYKCMECGKDFSQRSNFSSHKRVHTGEKPYQCTECGKSFSMSSSLTSHKRIHSGEKPYKCMECGKAFSMSSSLTSHKRIHSGEKPYKCMDCGKTFSQSSNLISHKRIHTGEKPYTCIKCGKSFRWRIRLTFHERIHTGEKPYKC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 704
30 0.000e+00gi|928130322|ref|XP_545867.5| PREDICTED: zinc finger and SCAN domain-containing protein 2 isoform X2 [Canis lupus familiaris]  clstr ali  12  204...........................................................................................REVGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLITHERTHTGEKYYKCNECGK-SFSDGSNFSRHQHTGEKPYKCRDCGKSFS---------RSANLITHQRIHTGEKPFQ-----CAECGKSFSRSPNLIAHQREKPYSCPECGKSFGNRSSLNTHQG-IHTGEKPYECKEC-------GESFSYNSNLIRHQRIHTGEKPYECPDCRQRFSQSSALITHRRTHTGEKPYQCAECGKSFSRSSNLATHRRTHLVEKPYKCGECGKSFSQSSSLIAHQGAHTGEKPYECLTCGESFSWSSNLVKHQRVHTGEKPYQCGECGKSFSQRSQLVVHQRTHTGEKPYECLMCGKSFSRGSI.................................................................................................................................................................................................................................................................................................................................................................................................................................. 544
31 0.000e+00gi|404501518|ref|NP_001258268.1| zinc finger protein 569 [Rattus norvegicus]  clstr ali  12  181...........................................................................................................TPFKCNHCGKGFSQTLDLIRHLRVHTGGKLYECHQCGKG-FSHKEKLINH----HKLHSRDQCYE---CNECGKTFIKMSNLMRHQRIHTGEKPY-----VCQECGKSFSQKSNLKIHTGEKPYECRECGKSFSQKQSLVAHQ-KVHTGEKPYACNEC-------GKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGEKPYECSECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFITHQKIHTREKPYGCNECGKAFIQMSNLVRHQRIHTGEKPYLCKECGKAFSQKSNLIAHEKIHSGEKPYECN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 494
32 0.000e+00gi|961141407|ref|XP_014789586.1| PREDICTED: zinc finger protein 665-like [Octopus bimaculoides]  clstr ali  11  40.........................................................................................................GKTSYHCDICKKPFTQKGNLTTHRRIHTGEKPYNCNICGK-SFSQTGSLTIHKRIHEKPFDCDICGKSFACDICGKTFSQKGNLATHSRIHTGEKPY-----RCDICGKSFFQKGNLAEHKREKPYHCDICGKSFYNRGNLTAHK-RSHTGEKPYYCDIC-------SKSFSKRSVLTSHKRIHTGHKPYHCDICGKSFFRKSSLTEHKYIHTGDKPYHCNICGKSFSNGSNLIQHKRIHTGMIPYHCDICGKSFSKGIDLTSHKHIHTGEKPYHCDICDKSFCSGRNLTAHMHIHAGNISYHCHICGKSFSHRSTLAKHKRIHTGEKPYRTHTGEKPYHCDICGKPFSDGSNLTAHKRIHTGERQ............................................................................................................................................................................................................................................................................................................................................................................................................ 434
33 0.000e+00gi|612012829|ref|XP_007489645.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  13  196MKSHLAVHQRIHTGERPYECNQCGKTFRQNSDLAVHQRIHTGEKPYECKQCGKTFRRSSDLARHQRICKQCHQRIHTGKKPYECKQCGKIFTMNFSLAVHQRIHTGEKPYECKQCGKTFSRSYTVVAHQRIHTGEKPYECKQCGK-TFRQSSDLAGHQRIHTKPYVCKQCGKTFS---------RSSYLAAHQRIHTQEKPY-----ECKQCGKTFSQSSTLAAHQREKPYECKQCGKTFSQSSHLAVHQ-RIHTGEKRYECNQC-------GKTFTDNSYVAVHQRIHTGEKPYECKLCGKTFSQSSHLAVHQKIHTGEKP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 520
34 0.000e+00gi|611984953|ref|XP_007477699.1| PREDICTED: zinc finger protein 850-like isoform X1 [Monodelphis domestica]  clstr ali  11  154...........................................................................................PQNSSHIEHQRMYTEEKSGESTLCEKTFMQKASLSGHQSIHIGERPYECKQCGK-TFSQRSHLAVHQRVHEKPYECKQCGKAFS---------HSCSLIVHQRVHTGEKPY-----ECKWCGKTFSWSSSLAAHQREKPYECNQCGKTFTNNSKLVVHQ-RVHTGEKPYECKQC-------GKSFSQRFHLAIHQRVHTGEKPYECKQCGKTFSQRFHLAIHQRVHTGEKPYECKQCGKTFSQRFHLAIHQRVHTGEKPYKCKKCGKAFSQRFHLAIHQRVHTGEKPYDCKQCGKTFRQRFHLTIHHRVHTGEKPYECKQCGKAFSRNFSLVEHHRVHTGEKPYKCTQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 484
35 0.000e+00gi|831234929|ref|XP_012663979.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 135 [Otolemur garnettii]  clstr ali  11  213.SSALVEHHRTHTGERPYECHECGKGFRNSSALTKHQRIHTGEKPYKCTQCGRTFNQIAPLIQHQRTCSECHERTHTGEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQRIHSGEKPYECHECGKA-FTQITPLIQHQRTHEKPYECSECGKAFSQST---------LLTEHQRIHTGEKPYG-----CNECGKTFSHSSSLSQHEREKPYECHQCGKAFRQSTHLTQHQ-RIHTGEKPYECSDC-------GKAFSHSSSLTKHQRIHTGEKPYECNECGRAFSQLAPLIQHQRIHTGEKPYECNECGRAFSQSSLLIEHQRIHTKEKPYGCKECGKSFSHSSSLSQHERTHTGEKPYECQDCGKSFRQSTHLTQHRRIHTGEKPYACRNCGKAFTHSSSLTKHQRTHTG.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 645
36 0.000e+00gi|946695793|ref|XP_014436199.1| PREDICTED: zinc finger protein 345-like isoform X1 [Pelodiscus sinensis]  clstr ali  10  240.......................EKKFRSGSHIIRHEKISPEGTHYTCLDCGKTFKHNSV--------FLIHQRTHTGEKPYTCPECGKGFSRSSNLIIHHRIHTGERPYTCPECGKSFSRTSELIIHRRMHTGERPYICSECGK-SFTRSSELNKHQRIHERPFQCHECGKDFTCPECGKGFTSSSQLVSHRRIHTGERPYGERSYSCPVCGKSFSHSSQLATHQRERPYICPECGKSFSRSSNLITHH-RTHTGERPYACLEC-------GKSFSRSSELIRHHRIHTGERPYICLECGKGFTRSSDLSKHQRIHTGERPYRCPECGKGFRYSSHLVSHRRIHTGERPYSCPVCGKGFSDSSQMITHQRSHTGETPYMCPECGKSFSWHSNLITHQRIHTGERPYTCPECGKSFSRSSNLATHHRIHTGEMPY---------ACPECGKSFSRSSELIIHRRTHTGER............................................................................................................................................................................................................................................................................................................................................................................................................. 708
37 0.000e+00gi|965874733|ref|XP_012005426.2| PREDICTED: zinc finger protein 2 isoform X3 [Ovis aries musimon]  clstr ali  12  460VFSSKSSVIQHQRLHKPWKCNECEKAFSYYSAFVLHQRIHTGEKPYECNECGKAFSQSIHL--------TLHQRIHTGEKPYRCHECGKAFSHRSALIRHHIIHTGEKPYECNECGKAFNQSSYLTQHQRIHTGEKPYECSECGKA-FSQSTFLTQHQHTGEKPYKCNECGKAFS---------DRSGLIQHQRTHTGERPY-----ECNECGKAFGYCSALTQHQREKPYKCNDCAKAFSDRSALIRHQ-RTHTGEKPYKCKDC-------GKAFSQSSSLTKHQKTHTGEKPYRCKECGKAFSQSSSLSQHQKTHSGGKV---KEYGKAFSEHSAFNQQKRIDTG........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 781
38 0.000e+00gi|821426104|ref|XP_012394672.1| PREDICTED: zinc finger protein 883 [Orcinus orca]  clstr ali  12  326.SSSLTQHQRVHTGEKPYECPECGKAFSHSSSLTQHQRIHTGEKPYECHECGKAYTQISHLMRHQSV--------HVGEKPYICNECGKAFSHTSSFTQHQTIHTGEKPYKCNECGKTFSQNSSLMRHQRIHTGEKPYECTICGRAY-TQISHLIQHQRTHEKPYECSECGKAFS---------RSAHLIEHQKIHTGEKPY-----KCKECGKTFSHNSSLTQHQREKPYTCKECGKAFNQSIHLIQHQ-RIHTGERPYKCKNC-------GKTYAQISHLVQHQKVHMGGKRYACKECGEDFSWGSHLAEHQRLHTVHDGYVCGNFEKAFAWNMQLSDHQRTHA......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 645
39 0.000e+00gi|795343214|ref|XP_011782927.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 782 [Colobus angolensis palliatus]  clstr ali  10  353...................................................GKSFSQKS----HIRECH----RVHVGMKPFEY---GKSFNHSSTLPVHQRTHATDKSSDYNPCTETFSYQSTLSVHPKVHVREKPCEYNECGK-SCSINSRLKSH--TGEKPYECRECGKAFS---------EKSRLRKHQRTHTGEKPYQ-----CDGCEKAFSAKSGLRIHQREKPFECHECGKSFNYKSILIVHQ-RTHTGEKPFECNEC-------GKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYTCNQCGKAFGQKSQLRGHHRIHTGEKPYTCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRTHTGEKPYECDECGKAFSEKSVLRKHQRTHTGEKPYDCHQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 712
40 0.000e+00gi|688549173|ref|XP_009298784.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  11  1........................................................................MMIHTGEKPFTCTQCGKSFNRSSSLNKHIKIHTGEKPFTCTQCGKSFNQSSSLNNHIKIHTGEKPFTCTQCGK-SFNQSSSLNNHMKIHEKPFTCTQCGKSFN---------QSSYLNLHMRIHTGEKPF-----TCTQCGRSFNRSSSINKHMGEKPFTCTQCLKSFNRSSHLNNH-MKIHTGEKPFTCTQC---GKSFSQSTYLNKHMRIHTGEKPFTCTQCEKSFNQSSSLNKHMKIHTGEKPFTCTQCGRSFNQSSHLNSHMNIHTGEKPFTCTQCGKSFNQSSSLNKHIKIHTGEKPFTCTQCGKSFNQSSSLN----NHMKIHTGEKPFTCTQCGKSFNQSSYLNLHMRIHTGEKPFTCTQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 350
41 0.000e+00gi|640782698|ref|XP_008046998.1| PREDICTED: putative zinc finger protein 724 [Tarsius syrichta]  clstr ali  10  160.....................................................................................................PIHS--KLSRFNEFGKAFDQCSILPVHKKIHNGEKPYSCEECGK-SFNHFLTLNKHKKTHEHPYKCKECGRAFKCEECGKSFNRCSSLIQHNRIHTGEKPY-----NCEECGKSFNRYSSLTHHKRKKPYSCEECGKSFNRWSSLTQHN-RIHTGEKPYSCEEC-------GKSFNQCSHLTQHKRIHTTEKPYQCEECGKAFKQSSTLFKHKRIHTGEKPYQCEECGKSFKQYAGVTQHMKIHTGEKPYQCEECGKSFNKCSTLIQHNRIHTGEKPYSCKECGKSFNQCSNFTQHKKIHSKEKPYKCEECGKAFKQISTLIKHKIIHTGEKP---------HNCEECGKSFNQGSSLTQHMKTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 555
42 0.000e+00gi|688549730|ref|XP_009298900.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  13  1........................................TGEKPFTCTQCGKSFNQSSQLNDHMM--------IHTGEKPFTCTQCGKSFNRSAHLDQHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTQCGK-SFRQSSSIYKHMRIHEKPFTCTQCGKSF---------IQSSNFNLHMRIHTGEKPF-----TCTQCGKSFRQASSLNKHMREKPFTCTQCGKSFRQASSLNKH-MRTHTGEKPFTCTQC-------GKSFNSSSHLNQHMRIHTGEKPITCTQCGKSFRQSSHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNCSSYLKQHMTIHTGEKPFTCTQCGKSFRQASSLN----IHMRTHTGEKPFTCTQCGKSFNRSSHLDQHMRIHTGEKPFTCTQCGKSFSQSSN.................................................................................................................................................................................................................................................................................................................................................................................................................................. 384
43 0.000e+00gi|1004692797|ref|XP_015745957.1| PREDICTED: zinc finger protein 493-like [Python bivittatus]  clstr ali  13  393...........HIKERQYECREHEKRYNGNFPPIVHQDFDTGDKKYKCMECGKSFSKNSNL--------TAHKKTHTLEKPYKCMECGKSFRRNNNLTSHKRIHSGEKPYKCMECGKSFRKNSHLTSHKTIHTGLKPYKCMECGK-SFSMNSYLSSHKRIHEKPYKCTECGKSFNGLT---------SFTTHKRLHSGEKPY-----KCMECGKSCNTSSDLTYHKREKPYKCMECGKTFRISSSLTCHR-RIHTGEKPYQCPEC-------GKCFIMSSSLTCHRRTHTGEKPYKCLECGKSFSQNGHLTSHKKIHTGEKPYKCMECGKSFSKNSNLNAHKRIHMVEKPYKCMECGKSFRRNDNLTSHKRIHSGEKPYKCMECGKSFRKNSHLTSHKTIHTGLKPYKCTECGKSFSMNSYLSSHKRIHTGEKPYKC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 793
44 0.000e+00gi|611980840|ref|XP_007476289.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  154...........................................................................................PQNSSHIEHQRLYPEEKSSESNLYGKTFMHRANLAVYQRIHYGEKHYECKQCGKI-FPSNSNLVVHQRIHTGPYECKPCGKKFSCKQCGKVFTTNSSLAVHQRIHTGERPY-----ECKQCGKTFSQNSNLAVHQRERPYKCKQCGKTFSQRPYLAVHQ-KIHTRDKPYECKQC-------GKTFSRTSNLAVHQRIHTGERPYECKQCGKTFTDKSNLAVHQRIHTGNKPFECKQCGKTFSQTSHLAVHQRIHTGERPYKCKQCGNTFSQRSYLAVHQRIHTGERPYECKQCGKTFSRSSNLAVHQRIHTGERPYECMQCGKTFPSNSNLAVHQKIHTEERPYKCKQ---------CGKTFSQRSYLAVHQRTHT................................................................................................................................................................................................................................................................................................................................................................................................................ 531
45 0.000e+00gi|260795603|ref|XP_002592794.1| hypothetical protein BRAFLDRAFT_202033 [Branchiostoma floridae]  clstr ali  11  1........................................................................MRTHTGEKPYKCEECSRQFSRLGDLKSHMRTHTGEKPYKCGQCGKKFSQLGALKSHMRTHTGDKPYMCEECSRQ-FSQQSDLKTHVRTHEKPYNCEECGKKFSCEDCSKQFSQLGDLKKHVRTHTGEKPY-----RCEECSRQFSVLNNLKSHMGEKPYSCEECSRQFRHPGSLERHK-RTHTGEKPYRCEEC-------SRQFGESGALTKHMRTHTGEKPYRCEECSRQFSQPGELKTHMRTHTGEKPYRCEECSKQFSRLDSLKKHMRTHTGEKPYRCEECSRQFSKLGYLKTHIRIHTGEKPYRCEKCSRQFSRLDSLKIHKRTHTGEKPHKCDECSKQFSQLGDLKKHIRIHTGEKPYKC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 376
46 0.000e+00gi|688551313|ref|XP_009299144.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like [Danio rerio]  clstr ali  13  7.........................................................................................................................................FTCNQCGK-SLANKSKLKIHMRIHEKLFTCTQCGKNFN---------QSSHLNQHMRIHTGEKPF-----TCTQCGKSFSNSANLNQHMREKPFTCTQCGKSFSQSSYLNIH-MRIHTGEKPFTCPQC---GKSFSQSQYLNQHMRIHTGEKPFTCSQCGKSFSQSSSLNLHIRIHTGEKPFTCTQCGKSFNKSSILNIHMRNHTGEKPFTCLQCGKSFSQSTSLNQHMRIHTGEKLFTCTQCGKSFSNSANLN----QHMRIHTGEKPFTCSQCGKSFSQSSYLNIHMRIHTGEKPFT---------CPQCGKSFSQSPYLNHHMRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 312
47 0.000e+00gi|488531534|ref|XP_004457521.1| PREDICTED: zinc finger protein 658 isoform X1 [Dasypus novemcinctus]  clstr ali  12  277MENSKVHLAVTH-----YENHESENNFNRTLYFTPPQRTITGKSTFESNKCEENVSQNSALTVHQKTQ--------TGDKLCECNECTNAFFQKLDLTVYHRTQTEEKLYHCGEYGKSFHQNSAFSAHRHSDVGEKSFQCSESGK-FFYQKAYLIEHQRTGEKRYECELCSKPYKCDEYGKTFCQKSDLSDQVRIHT-EKSLHQGTHR-EICEKTFSSMSHLRAHQREKPYECTECGKTFSKTSHLRAHE-RIHTGEKPYECTKC-------GKTFSHKTHLSAHQRTHTGEKPYKCTECGKTFADNSTLRAHERIHTGEKPYECNECGRSFAHISVLRAHQRIHTGERPYECNDCRRSFAHNSALRAHQRIHTGEKPYECNDCEKTFAHNSALRVHQRIHTGEKPYECNECEKTFAHNSALRAHQKIHTGEKLFECN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 735
48 0.000e+00gi|929272888|ref|XP_014013110.1| PREDICTED: zinc finger protein 420-like, partial [Salmo salar]  clstr ali  11  135.SGQLTLHQRTHTGEKPYSCDQCGKSFVQSGQLTLHQSTHTGEKPYSCDQCGKSFAASTSLALHQRICNQCHQKIHTGEKSYSCNQCGKSFTTSGQLTLHQRTHTGEKPYSCDQCGKSFAASRSLTLHQRTHTGEKPYSCDQCGK-SFAASSILTIHQRTHEKPYSCDHCGKSFSCDQCGKSFGQSGKLTVHRRTHTGEKPY-----SCNQCGKSFTGSCNLTIHQREKPYSCDHCGKSFGQSGKLTVHR-RIHTGEKPYSCDQC---GKRFTGSSNLRIHQRTHTGEKPYTCDQCGKSFTGSSNLRIHQRIHTGEKPYSCDQCGKSFITSRNLTLHQRTHTGEKSHSCDQ.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 519
49 0.000e+00gi|1004697229|ref|XP_015746660.1| PREDICTED: zinc finger protein 91-like [Python bivittatus]  clstr ali  11  61.............................NGSLTSHKRIHTEEKPYKCMECGKSFCHSGSLTYHNS--------IHTGEKPYKCVECGRSFSNSSQLTSHKRIHTGEKPYKCMECGKSFTNSSELTSHKRIHTGEKPYKCMECGK-SFTNSSELTSHKRIHEKPYKCMECGKSFT---------NSSELTSHKRIHTGEKPY-----KCLECGKTFIQSGQLTSHKREKPYKCLECEKSFPHSSQLTSHK-RIHTGEKPYKCTEC-------GKHFSQHSTLTTHKRIHTGEKPYKCTECGKHFSQHSTLTTHKRIHTGEKPYKCTECGKHFSQHSTLTTHKRIHTGEKPYKCTECGKHFSQHSTLTTHKRIHTGEKPYKCTECGKHFSQHSTLTTHKRIHTGEKPYKCTECGKHFSQHSTLTTHKRIHTGEKPYKC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 443
50 0.000e+00gi|260841715|ref|XP_002614056.1| hypothetical protein BRAFLDRAFT_57245 [Branchiostoma floridae]  clstr ali  12  163..SHLKTHTLTHTGEKPYRCEQCSKYFSELGHLKTHMRTHTGEKPYKCEECSKQFSQLGSLKTHTRTCEECHMRTHTGEKPYRCEECNKEFSLLNSLKIHIRTHTGEKPYRCEECSKQFSQLSHLKGHMRTHTGEKPYGCEECSKQ-FSRLSHLKTHMRTHEKPYKCEECSKYFSCEECSRQFSQLGDLKKHTRTHTGEKPY-----RCEECSKQFSLLNSLKTHMREKPYRCEECSRQFSQLGDLKKHT-RTHTGEKPYRCEEC-------SKQFSLLNSLKTHMRTHTGEKPYRCEECSKQFSLLNSLKTHMRTHTGEKPYRCEECSKQFSLLNSLKSHMRTHTGEKPYRCEECSKQFTTRSHLKKHMQTHTGH........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 567
51 0.000e+00gi|918289563|gb|KOF68488.1| hypothetical protein OCBIM_22007217mg [Octopus bimaculoides]  clstr ali  11  25.................HDCDVCKKSFSQKSHLNMHKCIHAVEKPFHCDICGKSFSKKFYLTT--------HQRIHTGEKPFHCDICGKSFPQSNNLTTHKRIHTGEKPFHCDICGKSFPQSNTLTTHKRIHTGEKPYHCDVCG-TSFSHHSALNSHKRVHEKPYQCNICSKSFSCDVCFTSFYDRSAFNSHMHLHEGKKPFH-----CDICGKSLSRKDSLTRHKGEKPYHCGVCGTLFFKKINLTKHN-RIHTGENPFHCDIC-------GKSFSKKIYLTKHNRIHTGEKPFRCEVCGKSFSQSYNLTTHKRIHTGEKPYHCDVCGTSFSNQSSLNSHVRVHTGEKPFHCDICGKSFPRSNSLTTHKRIHTGEKPYHCDVCGTSFSDQSALNSHITIHTGEKPFHCDICGKSFTRKIYLTKHNRIHTGEKPFRC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 447
52 0.000e+00gi|961083848|ref|XP_014769490.1| PREDICTED: zinc finger protein 62-like [Octopus bimaculoides]  clstr ali  12  240..SLLNKHKRIHTGEKPYHCDICGKSFSQTSNLKAHKRIHTGEKPYHCDICGKKFSINIHLSNHKYHCDICHQLLHTGEKPYQCDICGKNFSTSQYLSNHKRIHTGEKPYHCNICGKSFTTNGHLTKHKRVHTGEKPYHCDVCGRM-FSGSSNLLTHKRIHEKPFHCDICGKSFHCDICGKTFTDHSSLHSHKRVHTGDRPY-----RCNICGKTFTASVSLIAHTGEKPYGCDICGKSFSRSCNLSRHK-HLHTGKKPYHCDSCE-------KTFTSNYDLAIHKRIHTGERPYPCDICGNAFAQKSHLRIHTGDKPYCCDICNKAFSQQSTLSTHKRIHK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 642
53 0.000e+00gi|914930079|ref|XP_013221385.1| PREDICTED: zinc finger protein 83-like [Ictidomys tridecemlineatus]  clstr ali  13  199.............................................HKCNEFGKSFNQESQCTIHQT------LRMR--EKQFMCDICGKVFTQKSKLTRHHRIHTGEKPFKCNECGKVFNHSSHLAQHRRIHTGEKPFKCDDCGKV-FSQKSYLANHQRIHERPYKCDACGK---------VFNQISHLASHRRIHTGEKPY-----KCDECGKVFHQISHLTIHTGEKPFKCNECGKVFSRNSYL-IHHLIIHTGEKPYKCNEC-------GKVFSQKSILTSHRRIHTGEKPYKCDECGKVFNQISHLAEHRRIHTGEKPYKCNECGSVFSQKSSLANHQRIHTGEKPFKCSECGKGFSRNSYLTEHLIIHTGEKPCKCNECGKVFSQISHLTCHRRIHTGEKPYKCNDCGKVFSLNSSLAHHRRIHTGEKPYKCN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 566
54 0.000e+00gi|688549308|ref|XP_009298802.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  10  16..................................................................................................KHQDIPTDEKPFSCKQSRKSFSQKPNLDVYMRVHNREKHYTCKQCGK-SFPKIHFLKAHMRIHERSYTCQQCGKSFH---------HARNLAVHMRVHTGEKPY-----SCPQCEKSFKQNYNLEVHMRERSFTCTQCGKCFAKKQNLKIH-MRIHTGEKPYTCTEC-------GKSFRNKSTLNIHKRTHTGEKPYTCTECGKSFPNKSTFNNHMRIHTGEKPYTCTECGKSFSQSSHLNPHMMIHTGEKPFTCTQCGKSFNCLAHLNKHMRIHTGEKPFICTQCGKSFSLSSNFNQHMRIHTGEKPFTCTQCGKSFSQSSSLNHHMRIHTGEKPFTCTQCGKSFNCSS................................................................................................................................................................................................................................................................................................................................................................................................................................... 368
55 0.000e+00gi|694936255|ref|XP_009455236.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 782 [Pan troglodytes]  clstr ali  10  440...................................................GKSFSQKSHIREHHRV--------HIGVKPFEY---GKSFNRNSTLPVHQRTHATDKYSDYHPCTETFSYQSTFSVRQKVHIRAKPYEYNECGK-SCSMNSHLKSH--TGEKPYECPECGKAFS---------EKSRLRKHQRTHTGEKPY-----KCDGCDKAFSAKSGLRIHQREKPFECHECGKSFNYKSILIVHQ-RTHTGEKPFECNEC-------GKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRTHTGEKPYNCSQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 799
56 0.000e+00gi|641785039|ref|XP_008174790.1| PREDICTED: zinc finger protein 420-like isoform X1 [Chrysemys picta bellii]  clstr ali  12  479.SSNLITHRRIHTGEKPYGCSECGKRFIHSSALISHQRIHTGEKPYACSECGKSFNQSSAL--------ITHQRIHTGETPFTCSECGKSFNKSSNLVAHRRIHTGEKPYGCSQCGKRFIDSSTLTSHQRIHTGERPYTCSECGK-SFNQSSNLIKHQRIHETPFTCSECGNSFSCSECGKRFSYSSALTTHQRIHTGEKPYG-----CSQCGKRFIHRSALISHQREKPYTCSECGKSFNQNSTLIVHQ-RIHTGETPFTCSEC---GKSFNQSSNLIKHQRIHMRETPYGLSECGKSFNQSSSLIRPQKIHMGENCNKC.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 805
57 0.000e+00gi|831245865|ref|XP_012668061.1| PREDICTED: zinc finger protein 665-like [Otolemur garnettii]  clstr ali  11  216..............................................................................EKPYKCTEWDKALNHGLHFTIHEVMHAEKKQFKCDICGKVFNKKSSLGSHQRIHVGQKSYKCNDCDKV-FQQISQLTRHQRIHEKPYKCNECGR---------VFNQISQLIRHGRIHTGEKPY-----KCNKCGKMFSNNSHLIIHTGEKPYKCNECGKVFNHISRLVQHQ-RIHTGEKPYKCNEC-------GKVFSQNSHLASHQRIHTGEKPYKCNECGKMFSQKSSLGKHWRIHTGEKPYKCNQCGKVFRQKSSLGKHWRIHTGEKPYKCNECGKVFGQKSSLGKHWRIHTGEKPYKCNECGKAFREKTSLTCHQRIHTGEKPYECNECGKVFRESSALAQHRRIHTGEKPYKC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 563
58 0.000e+00gi|688550357|ref|XP_009298970.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  11  125...QSSNFNLHMRIHTGEKCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNSSSHLNQ--------HMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGK-SFNCSSYLKQHMHTGEKPFTCTQCGKSFR---------QASSLNIHMRIHTGEKPF-----TCTQCGKSFNRSSHLDQHMREKPFTCTQCGKSFSQSSNLNLH-MRIHTGEKPFTCSQC-------GKSFSQKPKLNVHIRDHTREKAYTCKQCGKSFYNTRNLTVHMRIHTGERPYTCQQCGKSFHKTGNLTVHMRIHTGERPYTCQQF............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 455
59 0.000e+00gi|1002606927|ref|XP_015682750.1| PREDICTED: zinc finger protein 658-like isoform X2 [Protobothrops mucrosquamatus]  clstr ali  13  305.KSDLMLHQRTHSGEKPYKCPVCGKAFNRNSHLVTHQSTHAGMKPYECLECRKTFSRNSEL--------VIHQRTHTGEKPYECLECGKSFSQNSHLMTHHRTHTGEKPYECPECGKSFTRNSHLVIHQRTHTGEKPYECPDCGK-SFSQYCHLVIHQRTHEKPYKCLDCGKSF---------IQNSDLVIHKRIHTGEKPY-----VCLDCGKSFSRNSYLRTHTGEKPYECLECGKAFGRNSELMIHK-RTHTGEKPYECPDC-------GKSFSQNSHLVVHHRTHTGEKPYECPDCGKGFSTRCKLINHVGLHTGEKPFKCLECGRCFTHHSCLTAHKKIHMRQK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 628
60 0.000e+00gi|918313295|gb|KOF83315.1| hypothetical protein OCBIM_22024025mg [Octopus bimaculoides]  clstr ali  11  136..............................................................................EKPYHCD---KSFSPTGSLTTHICIHTEEKPYRCDVCGKSFSVRSKLTMHERTHTGEKPYHCDVCGK-SFSQLANLTTHKQIHTKPYHCDICGKSF---------YQKCQLTTHTYIHTGEEPFH-----CDICGKSFSKKSKLHTHTGEKPYCCDICGRSFSELGNLNSHK-RMHTGEKPYHCEIC-------GNSFSVRSSLIKHKYTHTGERPYCYKICDKSFSLSSHLARHKRIHTGEKPHHYNICGKSFAERSMLTKHKHTHAGQKHYHCDICGKTFSQMNKLTTHEYIHTGKKPYDCEICGESFSYTSHLTKHKYIHTGEKPYHCEICGKSFSHTSLLTRHKRIHTGEKPY---------HCEICGISFSVRSTLTTHK.................................................................................................................................................................................................................................................................................................................................................................................................................... 501
61 0.000e+00gi|847016034|ref|XP_012804509.1| PREDICTED: zinc finger protein 420-like [Jaculus jaculus]  clstr ali  12  382.SSQLSRHQKVHTGEKPYKCKECGKAFTQNSQLNLHQRIHTGEKPYECKECGKAFICGSQLSQHQKICKECHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKTFSHGSQLTQHQRIHTGEKPYHCNECGKA-FNRGSLLTRHQRIHEKPYECKECGKNFSCKECGKSFIRGSQLTQHQRIHTGEKPY-----ECKECRMAFTQSSHLSQHQREKPYHCKECGKAFIRSSQLTQHQ-RIHTGEKPYECKEC-------GKAFGHGSQLTLHQRIHTGEKPYECKECRKAFTQSSHLSRHQRIHTGEKPYQCKECEKAFTRGSQLTQHQRIHVSEKSFVYKEC............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 798
62 0.000e+00gi|975121733|ref|XP_015276429.1| PREDICTED: oocyte zinc finger protein XlCOF6-like [Gekko japonicus]  clstr ali  12  214................................................................................TYKCLACGMNFLDKSQYNVHLWMHSGKKTHRWLEAGKTMIRRPELLRLQRTHRGEKPYSCSGCGK-RFSEKSDLVQHQRIHTKLFICSLGGKRFKCFSCGNYFKYRSQLLEHQRIHRGEKPS-----KCSECGKRFSCSGALQKHLREKPFECSQCGKRFGDSGTLQIH-LRTHTGEKPFECSQC-------GKRFSQSGALQIHRRTHTGEKPFECSECGRRFSRSDALEIHLRTHTGEKPFECSQCGKRFSQNGTLQIHRRTHTGEKPFECSECGRRFSRSGALQIHQRTHTGEKPFECSECGKRFSRSAHLQTHLRTHTGEKPFECSECGKRFSRSGNLQNHLRTHTGEKPF---------ECSECGKRFSESSSLQKHLRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 604
63 0.000e+00gi|641658119|ref|XP_008180607.1| PREDICTED: zinc finger protein 62 homolog [Acyrthosiphon pisum]  clstr ali  13  242.SSHLTRHKRTHTGEKPYACDVCEKLFSECSHLTKHKRTHTGEKPYACDVCEKSFSESGSLTKHKRTCDVCHRRMHTGEKPYACDVCEKSFSESSSLTKHRRTHTGEKPYACDVCDKSFSRSTDLTIHRRMHTGEKPFPCDVCEK-SFSKSSNFTAHMHTGEKPYACDVCEKSFSCDVCEKSFSTSSNLTAHRHTHTGEKPY-----ACDVCDKSFPTSSNLTTHRREKPYACDVCKKSFSEIGSLTKHK-RTHTGEKPYKCDVCE-------KSFSTSSNLTTHRRTHTGEKPYACDVCEKSFSLTIHRRMHTGEKPFPCDVCEKSFSKSGNFTAHRRTHTGEKPFPCDVCEKSFSESGNLTAHRRTHTGDKPYACDVCDKSFSESGNLTRHKRTHMA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 674
64 0.000e+00gi|731233077|ref|XP_010630218.1| PREDICTED: zinc finger protein 569 isoform X1 [Fukomys damarensis]  clstr ali  12  238...............TPFKCNHCGRGFSQTLDLIRHLRIHSGEKLYECNQCRKAFSHKERLIKHHKICNECHQRIHTGEKPYACNECGKSFSQKSNLIEHEKIHTGEKPYECNECGKAFSQKQSLIAHQKVHTGEKPYACNECGKA-FPRIASLALHMRSHEKPYKCDKCGKAFSQF---------SMLIIHVRIHTGEKPY-----ECSECGKSFSQSSALTVHMREKPYECEECRKAFSHKKNFITHQ-KIHTKEKPYECNEC-------GKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNLIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNKCGKAFSQIASLTLHLRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKPYECNK---------CGKAFSQSSSLTIHIRGHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 685
65 0.000e+00gi|611985253|ref|XP_007477823.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica]  clstr ali  12  219............................QNSSHIEHKRIHTEEKSNESNQCRRTFMHTASLSEQ--------QRIHSSKRTYECKQCGMTFNQSSSLAVHQRIHTGMKPYDCNQCGKTFTNNSSLAVHQRVHTGEKPYECNQCGK-TFTYNFNLAVHQRIHEKPYDCKQCGKTFR---------RSFELAIHQRIHTGEKPY-----ECKECGKAFNQSSSLTLHQRKKPYECKECGKTFSQNSHLTVH-WRIHTGEKPFECKQCR---KTFRRSFELAIHQRTHTGEKPYECKQCGKTFRRSFYLAVHHRVHTGEKPYECNECGKTFSNNSSLTVHQKIHTGEKPYECNQCGKTYTYNSNLVVHQRVHTGEKPYECNQCGKTFTYNSNLAV----HHRVHTGEKPYECNQCGKTFTYNSSLAVHQRVHTGEKPY................................................................................................................................................................................................................................................................................................................................................................................................................................................ 600
66 0.000e+00gi|961108063|ref|XP_014777881.1| PREDICTED: zinc finger protein 91-like [Octopus bimaculoides]  clstr ali  10  1........................................................................MYVHTGEKPYQCDICLKSFADGNRLNRHKHIHAGEKPYQCDVCGKSFREEAHLSIHKRIHTNEKPYHCEICGK-SFINPSLLTVHKRIHEKPYQCDICGKSFHCNICGKSFSQRPHLTVHVRTHTGEKPYD-----CDICGKSFSQTGHLKIHRREKPYQCDICGKSFFQSSALITHK-RIHTGEKPYECNIC-------GKSFSVRSHLADHIRTHTGEKPYHCDICGKSFSRSNGLTRHIRIHTGEKPYLCNICGESFSEKGNLTKHKYIHTGEKLYHCDICGKSFFQKVHLNSHKYVHTGEKPYHCDVCGKSFADRNTLIKHQHIHTGERPYPCDICGKSFSNRSTLNVHKRIHTGNKPY---------HCDICDKSFSQTSQLTLHKRRIHTRE............................................................................................................................................................................................................................................................................................................................................................................................................. 429
67 0.000e+00gi|961112288|ref|XP_014779346.1| PREDICTED: zinc finger protein 420-like [Octopus bimaculoides]  clstr ali  10  48............................................................................................................DYCCAICGKSFAYNSNLISHKRMHTGEKPYHCEICGK-YFVSNSNLTSHKRIHEKPYSCEVCGKSFRCEICGKSFITNSKLTAHIRVHTGEKLFH-----CEICGKFFTQNSNLVIHKREKPFHCEICGKSFITNGLLKTHKQRIHSGEKPFHCDIC-------GKSFCVNSGLIVHKRIHTGEKPYHCEICGKSFIENSKLTIHIRRHTGEKPFHCEICEESFVSNSKLTVHQRIHTGEQPYCCEICGKSFVNNSDLNRHRRIHSGEKPFHCEICGKSFINNSHLVIHKRSHTGEKPYQCEICGKSFVDNSYLTSHKRIHTGEKPF---------NCEMCGKSFVSNSYLTSHKRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 466
68 0.000e+00gi|674040225|ref|XP_008825863.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 420-like, partial [Nannospalax galili]  clstr ali  13  525.......HQRTHTGEKPYRCEECGKSFRYVSNLRSHQRIHTGEKPYRCQGCGKSFRERSHLRLHHQICEECHQRIHTGEKPFRCEECGKSFRYVSHLRSHQRIHTGEKPFRCEECGKSFRYVSHLRSHQRIHTGEKPFRCEECGK-SFRYVSHLRSHQRIHEKPFRCEECGKSFRCEECGKSFRYVSHLRSHQRIHTGEKPF-----RCEECGKSFRYVSHLRSHQREKPFRCEKCGKSFNQMSQLRVHQ-RTHTGEKRYRCEEC-------GXSFSQILYVRLHQQIHTGEKPHRCEECGKSFSQISHVRLHXQIHTGEKPYKCKECSXSFSECSHLRLHQQIHTGEKSFRCEECGKSFTLSTRQRIHTXEKPH----KXKCFGKSIPCISTLREHQR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 945
69 0.000e+00gi|918295859|gb|KOF72268.1| hypothetical protein OCBIM_22039730mg [Octopus bimaculoides]  clstr ali  12  23........................................................................................................EGESSYQCDVCDEAFSERDSLIKHKCIHAGDKPYSCDICGK-SFRQKSSLNKHMRIHEKVYCCDICGKSFSCDICRRSFSRKAELSVHKRIHTGEKLYH-----CDICGKSFLKNSNLTIHKREKPFKCDICDKSFTHVSPLNRHKF-IHTGEKPHQCDIC---GKSFTQSFSRKADLNVHKRIHTGENLYHCDICGKSFLKNSNLTKHKLVHTGEKPYHCDICDKSFTQVSTLTKHKLVHTGEKPYHCDICGKSFTQSQGLTMHKRIHTGEKPFHCNICGQEFTQGSGLNRHKRVHTGKKPHHCDICGKSFSHNSSLKTHKRTHTGEKPY---------HCDGCGKTFPRNNSLTTHKRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 473
70 0.000e+00gi|918333663|gb|KOF96366.1| hypothetical protein OCBIM_22035371mg [Octopus bimaculoides]  clstr ali  10  1......................................................................................................................................MKPYHCDICGK-SFSQNGNLVRHSRIHEKPYRCDICGKSFSCDICGKSFSKNDGLAKHCRSHTGEKPYC-----CDICGKSFSQNGHLRIHTGEKPFQCDICGKSFSQNEHLAKHN-RIHTGEKPYCCDICDICGKSFGKSFSQNHNLTKHIHIHTGEKPYRCDICGKSFSQNEHLARHNRIHTGEKPYRCDICGTSFSQKDNLAKHNRIHTGEKPYRCDICGKSFSHNYHLVMHNRIHTGEKPYHCDVCGKSFSWNDSLAKHNRIHTGEKPYCCDICGKSFSQSRQLAVHNRIHTGENPYRC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 368
71 0.000e+00gi|961121142|ref|XP_014782540.1| PREDICTED: zinc finger protein 91-like [Octopus bimaculoides]  clstr ali  12  561LFSQNSSLTTHKRVHTPYHCDICGKSFSGSSNLIRHRRTHTGEKPYCCDICGKSFCENGDLTK--------HRRIHTGEKPYHCDICGKSFSESGKISAHKRSHTGEKPYRCDVCGKSFSHSHALITHKRIHTGGKPYRCDICG-SSFSQIGHLTIHKRVHEKPYHCDVCGKSFSCDICGKSFFRNHHLIRHKRIHTGENPYH-----CDICGKSFSESSNLTTHRREKPYHCEICGKSFAEKGKLNTH-MHIHTGERPYQCDIC-------GKSFSDGSHLTKHKRIHTGEKPFHCDICGKSFSRNEHLTIHKRIHTGEKPYTCDICDKSFSEKGTLKTHKRIHKGKNPV.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 917
72 0.000e+00gi|612015860|ref|XP_007490868.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  13  639LRSRLARHQRIHTGEKPYECNQCGKTFSQSTSLAVHQRIHSGEKPYECNQCGKTFSRSSSLAE--------HQRIHTGEKPYECNQCGKTFSQCSHLAVHQRIHSGEKPYKCNQCGKAFSRKSSLAVHQRIHTGEKPFECNQCGK-TFSMRSHLASHQRIHEKPYECNQCGKTFS---------MSYYLAEHQRIHSGERPY-----ECNQCGKAFSRNSSLAVHQREKPYDCKKCGKTFSLHSHLARHQ-RIHTGEKPYECNQC-------GKTFNQSSYLAVHQRLHTGEKPYECNQCGKTFSLSSYLAVHQRIHTGEKTYECKKCGKIFSQSSYFAVHQRIHIREKS..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 963
73 0.000e+00gi|1004692071|ref|XP_007440653.2| PREDICTED: zinc finger protein 420-like isoform X1 [Python bivittatus]  clstr ali  11  174....................................................................................................................KKMKEKLDLNKHYKTHTGDKPYKCMECGKN-FRWNCLLISHKRIHEKPYTCTECGKSFKCMECGKSFSKNSSLTSHKRIHTGEKPY-----KCTECEKTFSRSSHLISHKREKPYKCMECGKSFRENGSLTSHK-RIHTGEKPYKCMEC-------GKSFRENGSLTSHKRIHTGEKPYKCMECGKSFRENGSLTSHKRIHTGEKPYKCMECGKSFSQSSQLISHKRIYSGEKPYKCTVCGKSFSENGSLTIHKRIHTGEKPYKCMECGKSFSQNSNLISHRRIHTGEKPYKCTECGKSFGENGSLTSHKRIHTREKPYKCME---------CGKSFNTSSNLSSHRRIHSKEKQ............................................................................................................................................................................................................................................................................................................................................................................................................ 557
74 0.000e+00gi|961076415|ref|XP_014790911.1| PREDICTED: zinc finger protein 91-like [Octopus bimaculoides]  clstr ali  13  682..TSLAKHNRIHTGERPYRCDICGESFSHNYSLAKHKHIHTGEKPYCCDICGKSFSQNGHLAVHS--------RIHTGEKPYHCDICGKSFSQNDNLAMHSRIHTGEKPFQCDICGKSFSQNEHLAKHNRIHTGEKPYRCDICGK-SFSQNDNLHNHIHTGEKPYCCDICGKSFSCDVCSKSFSQKDNLAMHSRIHTGEKPYH-----CDICGKSFSHNDSLAKHCREKPYCCDICGKSFSRNDHLAVHI-RIHTGEKPYRCDIC-------GKSFSQNENLTKHKRIHTREKTS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 977
75 0.000e+00gi|927195798|ref|XP_013930868.1| PREDICTED: zinc finger protein 420-like [Thamnophis sirtalis]  clstr ali  10  346.......................................................................................KKSDSNNSNIIPHKMMHMKANSYKCDDGRNSSSLISSLTCHKKTHKGEKPYKCLECGK-SFSSSSYLTIHKRIHEKPYKCTDCGKSFS---------MKSSLTSHKRIHTGEKPYQ-----CVECGKSFGNRDHLTSHQREKPYKCTDCGKTFNWHGHLTSHK-RIHTGEKPYKCLQC-------GKSFSMNSSLTSHKRIHTGEKPYQCLECGKSFSMNSSLTSHTRVHTGEKPFQCLECGRSFSMKSSLTSHQRIHTGEKPYKCVDCGKNFSMKSSLTSHQRVHTGEKPYQCLECGKRFSHSSQLTSHKRVHTGEKPFICTVCGKSFSNSNHLTSHKRMHTGEKPYK---------CTDCGKSFSMNSSLTSHKRIHSGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 701
76 0.000e+00gi|641652391|ref|XP_008178367.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum]  clstr ali  12  5............................................PYPCDICDDSFAHCNTLK--------SHQRAHMGEKPYPCDVYDRSFTQSNNLTSHKRTHTGEKPYPCDVCDKWFSRNDSLTKHKRSHTGEKPYPCDVCDKW-FSRSHNLTVHKRTHEKPYPCDICEKSFSCDVCDKWFSRNDSLTKHKRSHTGEKPY-----PCDVCDKWFCGSHNLTVHKREKPYPCDICEKSFSQSSQVAVHK-RTHTGEKHYPCDVCD-------KWFSQNVHLVVHKRTHTGEKPYPCDVCEKSFAQNYYLTNHKRTHTGEKPYPCDVCDKSFRRNTHLTVHKRTHTGEKPYPCDVCDKSFAQNGALTVHKRTHTGEKPYPCDVCDKSSDLTVHKRSHKRSHTGEKPYPCDVCDKSFAQNSALTVHKRTHTGEKPYPTHTGEKPYPCDVCDKLFAQSSTLTVHKRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 479
77 0.000e+00gi|511895353|ref|XP_004767285.1| PREDICTED: zinc finger protein 260 [Mustela putorius furo]  clstr ali  11  254......QHHIIHTGEKPYVCGECGKTFTQSSSLTEHQRIHTGEKPYKCKECGKAFTQSSSLIKHQRC--------HTGEKPYKCNQCGKFYSQVSHLTRHQKIHTGEKPYKCAECGKAFCHTSSLTQHQTIHTGEKPYKCNECGKKAFSHSSSLTQHQRIHEKPYECNECGKAYTCNECGKAFSHTSSFTQHQTIHTGEKPY-----KCNECGKTFSQNSSLTRHQREKPYECKVCGKAYTQISHLIQHQ-RIHTGEKPYECSDC-------GKAFSRSTHLIEHQKIHTGEKPYKCRECGKTFSHNSSLTQHQRIHTGEKPYACKECGKAFNQSIHLIQHQRTHTGEKPYKCNNCGKTYTQISHLIQHQKVHVGGKRYVCEECGEDFSWSSHLAKHRRLHAMHSTYVCNDFEKPFAWSTQLADIPRT....................................................................................................................................................................................................................................................................................................................................................................................................................................................... 706
78 0.000e+00gi|961093096|ref|XP_014772716.1| PREDICTED: zinc finger protein 91-like [Octopus bimaculoides]  clstr ali  11  5........................................................................................................TGKSSYDCDICKKSFSQKCNLKTHECIHTGEKPFHCDICGK-SFSQTGGLTAHKRSHTKPYHCDICDKSFS---------HTGSLTTHKYIHTGEKPYH-----CDICGKLFSQNDTLAKHKREKPYHCDTCGKSFSQTGTLTRHK-RIHTGEKPYHCDVC-------GKSFSHTGNLTIHKYIHTGDKPYRCDICGKSFSQTGSLTTHKYTHTGEKPYHCDICGKSFSQTSHLSAHKYIHTGEKPYCCDVCGKAFSEGSKLTKHIRSHTGDKPYPCNICGKSFSDGAVLTKHRHIHTGEKPYQCDICGKSFSRSGDLAKHRRVHLEIETIMLMPKMTGKSSYDCDICKKSFSQKCNLNTHKCIHTGEKP......................................................................................................................................................................................................................................................................................................................................................................................................... 357
79 0.000e+00gi|918291956|gb|KOF69818.1| hypothetical protein OCBIM_22004025mg [Octopus bimaculoides]  clstr ali  10  854..SSLTSHKRIHTGEKPYHCNICGKSFSENSKLTRHKHIHTGEKPYQCDICDKSFSQFNELTRHKRVCNICHKHTHSEEKPYHCDICGKSFSVRFSLTIHKHTHTGERPYHCDICGKSISRKSNVNKHKRTHTGEKPYHCDICG-NSFSETSSLTKHRRTHEKPYQCDICGKSFSCDICGNSYSGGSSLTQHRRTHTGEKPYQCDPYHCDVCGKSFSKNANLTTHKGQKPYDCDTCGKSFSERSSLTKHS-HTHTVEKPYQCDIC-------GKSFSLNNRLNIHKRIHTGEKPYHCDICGKSFTKKSTLTCHKRLHTGEKPYHCNICGKCFTQNGELIKHKLTHTGEKAFHCNICGKSFSENSKLTRHKRIHIGEKRYQCDICSKSFSHNGTLTCHKRIHTGEKPYQCDICGKSFSKNSTLTSHKRIHTGEKPY---------HCDICGKSFSQNGHLSRHLTNHT................................................................................................................................................................................................................................................................................................................................................................................................................ 1368
80 0.000e+00gi|640809303|ref|XP_008061212.1| PREDICTED: zinc finger protein 658-like [Tarsius syrichta]  clstr ali  10  336..SQSSAHVVRQKTQTGKVCEYCTNTFYQKLDLTIHQRTHKEEK-FCCSRCRKYFHQKAHL--------IWYPRTHSGEKQY--EERGKSFYTSSHCIQHSGAYVGFKLYECNECGKTFCQKSNLSEHVRIHTKEKTYGNNDCGKSYFFNMACLKEHWRIEEKPYECIECGKTFECIECEKTFSDKTHHNAHQRIHTGEKPY-----ECIECGKSFTCNSALKIHTREKPYKCDECGKTFSEKSNVSAHQ-RVHTGEKPYECNEC-------GKSFSKKSHLRAHQRTHTGEKPYECNECGKTFSEKSYVSTHQRIHTGEKPYECDICGKPFAHNSTLRVHQRIHTGVKSYGCNECGKTFSQKSHLNAHQRTHTGEKPYECNECGKTFSGKSYVMAHQRVHTGEKPYECNICGKPFALNSSLRVHQRIHTGQKPYQCNE---------CGKTFSQKSHLNTHLRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 856
81 0.000e+00gi|918291962|gb|KOF69824.1| hypothetical protein OCBIM_22004040mg [Octopus bimaculoides]  clstr ali  13  177.SGDLSKHKRIYTGEKPYQCDICGESFSEYSTLISHKRTHTGEKPYHCNICGKSFSQSGNLTK--------HKRTHTGEKSYHCNICGKSFSQSDDLTKHKPTHRREKAYHCNICGKSFCRNSDLIRHKRIHTGEKPYQCDICG-ESFSRNSTVTSHKRVHERPYHCDICGKSFS---------ENSSLTNHKRIHTGEKPYH-----CNICGKSFSENSSLTSHKREKPYRCDICGKSFSQSSNLTEHK-RTHTGEKAYRCDIC-------GKSFSYNIKLIHHRHIHTGEKPYHCDICGESFFQKGHLSTHMSIHT..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 468
82 0.000e+00gi|830012525|ref|XP_012613266.1| PREDICTED: zinc finger protein 160-like isoform X1 [Microcebus murinus]  clstr ali  14  542VRSSLTTHQAIHTGEKPYKCIECGKGFTQKSHLTSHQGIHSGEKPYKCNDCGKVFSQTSQLARHW--------RIHTGEKPYTCNECGRAFSVRSSLTLHQAIHTGQKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNQCGKA-FSMHSNLTTHQHTGEKPYKCNECGK---------VFTQNSHLANHRRIHTGEKPY-----RCNECGKAFSVRSTLTTHQGKKPYKCNECGKVFTQNSHLANHR-RIHTGEKPYRCIVC-------GKAFRVRSSLTTHQAIHTGEKPYKCNECGKVFRQSSNLASHHRLHSGEKHY................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 839
83 0.000e+00gi|961084475|ref|XP_014769707.1| PREDICTED: zinc finger protein 208-like [Octopus bimaculoides]  clstr ali  34.............................................YQCDICNKSLSQK---------CGLTHKHIHTRGKLYNSDISDKSLSHKSSLISHKHIHTKDKPYHCDICGKSFSENGNLTKHKRIHTGEKPYHCDICGKFSDSSSLSRHKHIHTRERPYHCDICGKSFHCDICSKSFPSPSILVKHKRVHTGEKPYGYKPHRCDVCGKFFSQNSHLTAHKREKPFQCDICSKSFLESSELIRHK-RTHTGEKPYQCDIC-------GKSFSQSSHLTTHKRIHTGEKPYVCNICGKSFSQSSELISHTHIHTGEKPYQCDICGKSFSVSNAVTKHKYIHTGEKPYHCDICGKSFSGRSELTSHKRTHTGEKPFHCDVCRKSFAAPGHLTNHRRIHTGEKPYHCNICGKTFSQSGDLATHKRIHTGEKPY---------HCDICGKSFSQNGSLITHKSIHTGER............................................................................................................................................................................................................................................................................................................................................................................................................. 479
84 0.000e+00gi|830013840|ref|XP_012613531.1| PREDICTED: zinc finger protein 135 isoform X1 [Microcebus murinus]  clstr ali  13  237..............................................................................EKPYKCQECGKAFSHSSALVEHHRTHTGERPYECHECGKAFRNSSALTKHQRIHTGEKPYKCTQCGK-TFNQIAPLIQHQRTHEKPYECSECGK---------SFSFRSSFSQHERTHTGEKPY-----ECSECGKAFRQSIHLTQHLREKPYQCGECGKAFSHSSSLTKHQ-RIHTGEKPYECHEC---GKAFTQITPLIQHQRTHTGEKPYECNDCGKAFSQSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLNQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECSDCGKAFSHSSSLT----KHQRIHTGEKPYECNECGRAFSQLAPLIQHQRIHTGEKPYACN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 579
85 0.000e+00gi|795376866|ref|XP_011750065.1| PREDICTED: zinc finger protein 135 isoform X1 [Macaca nemestrina]  clstr ali  12  295..........................................................................................................EKPYKCQECRKAFSHSSALIEHHRTHTGERPYKCHECGKG-FRNSSALTKHQRIHEKPYKCTQCGRTFN---------QIAPLIQHQRTHTGEKPY-----ECSECGKSFSFRSHERTHTGEKPYECSECGKAFRQSIHLTQH-LRIHTGEKPYQCGEC-------GKAFSHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECSECGKAFSQSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECNQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 610
86 0.000e+00gi|918336065|gb|KOF98032.1| hypothetical protein OCBIM_22027457mg [Octopus bimaculoides]  clstr ali  10  36........................................TGEDVYHCDICGKSFSRNHHLTT--------HKHIHSGDKPYHCDICGKSFSRSHHLTTHKHIHTGDKPYHCDICGKLFSQNSHLTTHKRSHTGDKPYHCEICGK-SFPQNGDLTTHKRIHEKPFHCDICGKSFSCEVCGKTFSRGSYFTAHKRMHTGEKLYH-----CNICGKSFSGSSYFNTHKREKPYRCDICGKSFSGSSDLIKHR-RIHTGEKPYHCDIC-------GKSFSFSSNLSTHKHIHTGEKPYDCNICGKSFSQKIHLTIHNNIHTGEDVYNCDMCGKSFSAPGHLTNHKRIHTGEKPYQCDICGKSFSRNHHLTTHKHIHTGDKPYHCDICGKLFSQNSHLTAHKRSHTGEKPYHCDICNKSFLQNGDLTTHKRIHSGEKPFP---------CDICGKSFSQKGNLITHKHFHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 467
87 0.000e+00gi|961076267|ref|XP_014790859.1| PREDICTED: zinc finger protein OZF-like [Octopus bimaculoides]  clstr ali  12  157.RSHLTSHERIHTGEKPYHCEICGKAFTENCHLTNHKRVHTGERPYRCRVCGKSFSQTSYLNEHNKRLHSGEKHIRTQEKPHHCDFCGKSFSEASYLMSHKRIHTGEKPYHCNICGKAFSERSHLINHKRIHTGEKPYHCDVCDK-SFSQRGHLNIHKRTHEKPYSCDTCGKSFSQNIH---------LTIHKYIHTGEKPYY-----CAFCSKSFSQNSNLATHKRENPYHCDICGNSFPVIYKLTRHR-RIHTGEEPYACNIC-------GKSFSQNFNLTRHKHIHTGERPYRCDTCGKSFFQNCNLTRHNRIHTGEKPYHCDICGKSFSDGAGINIHKRIHTGEKPYYCDICGTSFPRRDSLIKHKFIHTGEKPYHCDICGKSFPRMIH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 531
88 0.000e+00gi|193591726|ref|XP_001944018.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum]  clstr ali  12  2......................................................................................................................FNKNGKLIKHLQTHARQKPYTCDVCDK-SFSQSGSLLVHQRTHEKPYLCDICDRSFS---------NKGELMAHYRTHPGEKPYQ-----CDVCDKSFSVSSSLTKHRREKPYQCDVCDKSFSNNGDLKRHQ-RTHTGEKPYQCDVCD-------KSFSVKSSLTIHRRTHTGEKPYQCDVCDKSFSNNGALIIHRRTHTGEKPYQCDVCDKSFSVSSSLTIHRRTHTGEKPYQCDVCDKSFSNNGDLKRHQRTHTGEKSHQCDVCDKSFSVSSSLTKHRRTHTGEKPYQCDVCDKSFTVSSQLTMHRRTHTGEKPYQ---------CDVCDKSFSHSGHLTNHRRMHTGDKPYF.......................................................................................................................................................................................................................................................................................................................................................................................................... 330
89 0.000e+00gi|918285471|gb|KOF66347.1| hypothetical protein OCBIM_22012705mg [Octopus bimaculoides]  clstr ali  13  19............................................................................AGEKPYHCNICSKSFSCISALNIHKRTHTGEKPYHCDICGKSFSTSSHLTAHRRIHTGEKPYHCDICGK-SFYTSGQVTCHKRIHEKPYHCNICGKSFS---------QSYHLTKHNLTHTGEKPYH-----CDICGKSFSHNSALTRHKREKPYHCDICGKSFCGNGDLTTHK-RTHTGEKPYNCDIC-------GKSFSKNGHLTTHKHRHTGEKPYHCDICGKSFSGSSHLRIHKLTHTGKKTHHCDICGKSFYQSSALTTHKRTHTGEKPYNCDICGKSYSLRGTLTGHKRTHTGEKPYHCDICGKSFSESGHLTRHNRTHTGEKPYHCDICGKSFSVRYHLTKHKRTHTGEKPY---------HCDTCGKSFSDSGAWTAHKRKHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 385
90 0.000e+00gi|918326209|gb|KOF92231.1| hypothetical protein OCBIM_22006984mg [Octopus bimaculoides]  clstr ali  10  35..............................................................................EKPHQCDICGKSFSQSSHLTTHKRIHTGEKPYVCNICGKSFSQSSELISHTHIHTGEKPYQCDICGK-SFSVSNAVTKHKYIHEKPYHCDICGKSFS---------GRSELTSHKRTHTGEKPFH-----CDVCRKSFAAPGHLTNHRREKPYHCNICGKTFSQSGDLATHK-RIHTGEKPYHCDIC-------GKSFSQNGSLITHKSIHTGERPYHCDICGKSFSVSSHISKHKRIHTGEKPYHCDICGKSFSGRSARTKHKRIHTGEKPYHCGICGKSFSGNGDLNTHKRIHTGEKPYHCDICGKMFSVSSAVTKHKYIHTGEKPYHCDICGKSFSGSTNLTIHKRIHTGEKPYHCNCGEKPYHCDVCGKSFSGGGDLTKHKRIHTGER............................................................................................................................................................................................................................................................................................................................................................................................................. 410
91 0.000e+00gi|688550233|ref|XP_005168212.2| PREDICTED: gastrula zinc finger protein XlCGF57.1-like, partial [Danio rerio]  clstr ali  11  172..SQSSNLNIHMRIHTGEKCSQCGKSFSQSPYLNHHMRIHTGEKPFTCSQCGKSFSKSSNLNI--------HMRIHTGEKPFTCTQCGTSFSQSSNLNIHMRNHTGEKPFTCLQCGKSFSRSTSLNRHMMIHTGEKEFICKQCGK-SFSQKSNLDVHMRVHEKPYTCEQCGKSFSCQECGKSFYHVGNFAAHMRIHTGEKPF-----SCKQCGKSFSQKPNLYVHMREKPYTCEQCGQSFSQKQSFKSH-MRIHSGERPYTCQQC-------GKSFRHARNLAEHMRIHTGEKPFSCKQCRKSFSKKLHLIAHMRVHTREKPYTCEQCGTSLGKKEDLYIHMRIHTG........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 522
92 0.000e+00gi|918281327|gb|KOF64325.1| hypothetical protein OCBIM_22017511mg [Octopus bimaculoides]  clstr ali  11  30.........................................................................................................GKTSYDCDMCEKSFSRKGRLVTHKRSHTGEKPYHCNICSK-SFSVRHSLTIHKRTHEKPFHCDICGKTFSCDVCSKSFSEGGNLAKHKRIHTGEKPYH-----CDVCSKSFFQRVHLTTHKREKPYQCDICGKSFIEGSVLNKHK-HIHTGEKPYNCDIC-------GKSFSRNDHLVVHKHIHTGEKPHHCDICGKSFSQNYLLAVHKHVHTGEKPYHCDICGKSFSARSNLTVHRYIHTGKTQYHCDICGISFSRRSDLTTHKYIHTGEKSCYCNICGKSFSQTSQLTIHNTIHTGERPHRCDICGKSFAAARYLTKHIRIHTGERPY---------HCDICGISFSQTGHLTTHKRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 396
93 0.000e+00gi|724806891|ref|XP_010355339.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 708-like [Rhinopithecus roxellana]  clstr ali  13  213.SSNLTNHKIIHTGEKPYKCRECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFNWYSHLTT--------HKRIHTGEKPYKCEECGKAFNWYSHLTTHKRIHTGEKPYKCDACGKAFSVFSTLTKHKIIHTEEKPYKCEECGKA-FKRSSHLTNHKVIHEKPYKCEECGKAFKCGECGKAFKKSSNLTNHKIIHTGEKPY-----KCEECGKAFNQSSTLTRHKREKPYKCEECGKAFNRSSNLTKHKI-VHTGEKPYKCEECGKAFKQCGKAFTLSSHLTTHKIIHTGEKPYKCRECGKAFTLSSHLRIHTGEKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLLS....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 615
94 0.000e+00gi|961082350|ref|XP_014768972.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  12  182.SSNLTIHKRVHTGEKPYHCDVCDKSFAQSNDLTKHKRIHTGERPYQCDICGKSFSACTQLIIHKRVCDICHKRIHTGEKPYCCTICGKSFSHESSFTSHQRIHTGQKPYNCDICDKSFSRNDYLTNHKRIHTGEKPYHCDICGK-SFSLYCHIRIHKRIHEKPYRCNICGKSFQCDICGKSFTVNSTLTKHNRIHTGIKPYH-----CDICGKSFLHAQALTKHKGEKPYRCNICGKFFSEGGALTKHK-RIHTGEKPFHCDIC-------GKYFSDSSSLTKHKRLHTGEKPYHCDICGKSFSLTKHKRVHTGEKPYQCNICGKAYSKKCSLVKHKCNPT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 557
95 0.000e+00gi|918319605|gb|KOF88180.1| hypothetical protein OCBIM_22015302mg, partial [Octopus bimaculoides]  clstr ali  13  244VRSSLTTHRRIHTGEKPYQCSTCCKSFSVSSSLTIHKRTHTGEKPYKCDICSRSFSQLEI-RKLSYDCDICHKCIHKGKKPYHCVVCDKSFSRIDSLTSHKRIHTGDKPYQCDICDKSFTRIDYLTSHRRIHTGENPYHCEFCGK-SFSANSNLTAHKRTHEKPYLCDICGKSFSV---------RSVLTSHKRIHTGEKPYH-----CDICRKSFSDSSYLRIHKREKPYHCGICGKSFSVSSKLTKH-TRIHTGEKPYHCDIC-------SKSFSVSSKLTRHKHIHTGEKPYQCDVCGKSFTESSNLSRH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 550
96 0.000e+00gi|641673773|ref|XP_008186458.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum]  clstr ali  11  14..........................................DKQYPCDACDKRFNSDDDLM--------VHKRTHAGEKLYLCDE---SFTQMRNLTLHQRTHTGEKPYPCDVCDKSFSQISSLTIHQRTHTGEKPYPCDVCDKW-FSSNGQLTVHKRSHEKPYPCDVCDKSFSQMI---------NLTLHQRTHTGEKPY-----PCDVCDKSFSQISSLTIHQREKPYPCDVCDKSFSQMINLTLHQ-RTHTGEKPYPCDVCD-------KSFSQMINLTSHQRTHTGEKPYPCNVCDKSFSQISSLTTHQRTHTGEKPYPCDICDKWFSSNGQLTVHKRSHTGEKPYPCDICDKWFSSNGQLTVHKRSHTGEKPYPCDVCDKSFSQISSLTIHQRTHTGEKPYPCDVCDKSFSQMINLTLHQRTHTGEKPYPSHTGEKPYPCDVCDKSFSKISSLTLHQRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 431
97 0.000e+00gi|961083290|ref|XP_014769294.1| PREDICTED: zinc finger protein 160-like [Octopus bimaculoides]  clstr ali  11  10.................................................................................YHCNVCKKSFNQKCNLTTHRRIHTGEKPFRCDICGNSFSDGSVLTTHKRIHTGEKPFRCDICGK-SFSANSNLTTHKRCHEKPFHCDICGKHFHCDICGKSFSYNNDLNRHKRIHTGEKPCH-----CAICGKSFSGSSNLIAHKGEKPFRCDVCGKSFSQRNNLTDHK-RIHTGEKPFHCDTC-------GKSFSRSSVLTDHKRIHTGEKPFHCDFCDRSFSQRSNLTAHKRTHTGERPYHCDVCGKSFSRNDHLTTHKRIHTGEKPYRCDICGKSFSEGTVLTKHKRIHTGEKPYHCDVCGKSFSVASHLTTHKRIHTGEKPHHCEICGKSFTVTSSLTTHKRIHTGEKPY---------HCDICGKSFSITSCLTTHIRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 455
98 0.000e+00gi|961084472|ref|XP_014769706.1| PREDICTED: zinc finger protein 665-like, partial [Octopus bimaculoides]  clstr ali  11  34.............................................YQCDSCNKSFSLKCNLTTHKRICDICHKHIHTKDKPYQCDICGKSFPQSCNLTTHIRTHTGEKPYHCDFCGKSFAHKGSLVTHKHIHTKDKPYQCDICDK-SFPRSCDLTTHIRIHEKPYHCDICGKSFSED---------SNLTKHKRIHTGEKPYHCDPYHCDICGKSFPATRILNIHKREKPYHCDICGKSFPAPSVLTIHK-RVHTGEKPYECDIC-------GKSFSVKHHLMIHKRIHTEDKPYHCDVCGAFFSQNSHKYIHTGEKPFQCDICSKSFFESSELSRHKRTHTREKPYEKPNHCDICGKSFSVSSHLTKHKRIHTGERPYLCDVCGKSFTGSSDLTTHKRIHTGEKPYHCDICGKSFSGSSYLTTHKRIHTGEKPFC---------CDVCGKSFPKNCTLTRHKRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 483
99 0.000e+00gi|918311879|gb|KOF82223.1| hypothetical protein OCBIM_22025536mg [Octopus bimaculoides]  clstr ali  11  80.SSYLSTHKHIHTGERPYHCDICGKSFSSSGYVTAHKRTHTGEKPYQCNICGKSFSRSNRVTAHKRTCDICHKRIHTGEKPYRCDICGKSFSHNCVLIAHKRTHSGERPYQCDICGKSFSESGTLTKHNSIHTGEKPYHCDICGK-SFSQNSNLMKHKYIHEKPYHCDICGKSFSCDICGKSFSSSSNLSTHKRIHTGEKSYH-----CDICSKSFSKYNDLTKHKREKPYHCDICGKSFSLNSILTAHK-RIHTGEKPYHCDVC-------GKSFSESSKLTRHNSIHTGEKPHHCDICGKSFSQNSNLMKHKYIHTGERRYHCGSCGKSFSNSSNLSRHKHIHTGEKPYHCDICGKSFSRSSHISAHKRIHTGEKPYQCDICGNSFSENTALTKHNRTHTGEKPYHCDICGKSFSQNCDLTKHKHIHTGEK.................................................................................................................................................................................................................................................................................................................................................................................................................................................. 542
100 0.000e+00gi|612014376|ref|XP_007490241.1| PREDICTED: zinc finger protein 420-like isoform X1 [Monodelphis domestica]  clstr ali  15  438LSSHLAVHQRIHTGEKPYVCKQCGKSFSRSSNLFLHQRIHTGEKPYECKQCGKTFSMSSHLA--------VHQRIHTGERPYKCKQCGKTFTNNSHLAVHQRIHTGEKPYECKQCGKTFRRGFHLAVHQRIHTGEKPYECKQCGKA-FTNNSHLAVHQRIHEKPYECKQCGKAFK---------ERSKLTVHHRIHTGEKPY-----ECKQCGKIFTDNSNLAVHQREKPYECKDCGKTFTHSYSLAVHQ-RIHTREKP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 678
101 0.000e+00gi|961115527|ref|XP_014780608.1| PREDICTED: zinc finger protein 135-like [Octopus bimaculoides]  clstr ali  14  175MSVALTEHRRTHKEEKPYHCDICGKSFSQSGARTIHKRTHPGEKPYHCDICGKSFSQSYTLRRHELT--------HTGEKPYHCDICGKSYSSSSHLTCHRRTHTGEKPYHCDICGKSCSQRSDLTEHKRTHTGEKPYHCDICGK-SFSYNSQLPIHKRLHEKPYHCDICGKSF---------LQNSGLTRHKLMHTGEKPYY-----CDICGKSFSESSNLSKHEREKPYHCDICGNSYSTHGQLTIHE-RVHPGEKPYQCDIC-------GKSFAQKGHLNRHLTIHTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 440
102 0.000e+00gi|929069229|ref|XP_014037605.1| PREDICTED: zinc finger protein 883-like isoform X1 [Salmo salar]  clstr ali  10  259.SGDLTIHQRIHTGEKPYSCDQCGKSFNQLGHLTRHQRIHTGEKPYSCDQCGKSFNQSGDL--------TAHQRIHTGEKPYSCDQCEKSFNRSGNLTTHQRIHTGEKPYNCDQCGKSFNQLGQLIIHQRIHTGEKPYSCNLCEK-SFNHSGVLTRHQRIHEKPYSCDQCGKSFN---------HSGTLSEHQRLHTGEKPY-----SCDQCGKSFNHSGHLTIHTRKKPYSCDLCGKSFSQSGDLTAHQ-RIHTGEKPYSCDQC-------GKSFNQSVHLTTHQRIHTGEKPYSCDQCEKSFRTSDHLIKHQRIHTGEKPYGCDQCGKSFNQSGHLTTHQLTHTGEKPFSCL-CGNSFAHSGSLKKHHKAQTCH........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 607
103 0.000e+00gi|961100007|ref|XP_014775070.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  13  186..SNLTEHRHIHTGEKPYHCDICDKSFSKSSNLTSHKRIHTGEKPYHCEICGKSFSKSSDLTK--------HKRIHTGEKPYHCEMCGKSFVSNSELRKHKRIHTGEKPFHCETCGKSFVYNSDLTKHKRIHTGEKPYRCEICDKA-FSINSSLVIHIRTHEKPFPCKICEKSFHCRICGKAFVYNSDLKKHERIHTGEKPYHEKPFPCEICGKSYVNNSHLLVHKREKPYHCEICGKSFSNNSNFAVHR-RIHTGEKPYNCKICEKSCEICGKSFSLNSSLTIHKRSHTGERPYHCEICGRSFILKRHKRIHTGGKPCE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 594
104 0.000e+00gi|674065103|ref|XP_008839434.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 260-like, partial [Nannospalax galili]  clstr ali  11  249.RSILRRHQHIHTGEKPFKCEECGKSFSQISNLRVHQRIHTGEKPYRCEECGKSFSQRSHLRRHQQ--------IHAEEKPYRCEECGKSFSQISSLRVHQRIYAGEKPYRCEECGKSFCERSHLRLHRRIHTGENPFRCEECGK-SFSRQSILRKHQHIHEKPFKCEECGKSFS---------RISNLRKHQRIHTGEKPY-----RCEECGKSFSQLSNLRAHQREKPYRCEECGKSFRYVSNLRVHQ-RTHTGEKPYRCQGC-------GKSFSERLHLRLCQRIHTGEKPFRCEKCGKSFSQMSQLRVHQXTHTGEKPYRCEECGKSFSKRSHLRRHQQIHTGEKPYRCEECGKSLIEMSVLRIHYSIHTGEKPYKCEECDKSFIDSSKLRTHYRIHSGERPYKCDECDRS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 642
105 0.000e+00gi|918277911|gb|KOF62828.1| hypothetical protein OCBIM_22021601mg [Octopus bimaculoides]  clstr ali  12  134.RSILTIHKRIHTGEKPFHCNICGKFFTASCDFTKHKRIHTGEKPFHCDTCGKSFSQ--------GTALTLHKRIHTGEKPFHCDICGKSFSQGPTLTSHKRIHTGEKPFHCDICGKSFSQGPTLTEHKYIHSGEKPFHCDICGK-SFSWATVLTLHRRIHEKPFHCDICGKSFS---------RGPVLSIHRRIHTGEKPFH-----CDICGKSFSQATALTIHKREKPFHCDICGKSFSQGPALTSHK-RIHTGEKPFHCDIC-------GKSFSRGPTLSVHKRIHTGEKPFHCDICGKSFSREPDLTIHRRIHTGEKPFHCDICDKSFAQGTALTIHKRIHTGEKSFHCDICGKSFSQKCNLTKHMSVHT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 481
106 0.000e+00gi|929219576|ref|XP_013985953.1| PREDICTED: zinc finger protein 883-like [Salmo salar]  clstr ali  12  322.SGHLTTHQRIHTGEKPYSCDQCGKNFYTSGHLTTHQRIHTGEKPYSCDQCGKSFNHSGSL--------IIHQRIHTGEKPYSCDQCGKSFNHSGALTTHQRIHTGEKPYSCDQCGKSFNYSGNLTAHQRIHTGEKPYSCDQCGK-SFSRSGDLITHQRIHEKPYSCDQCGKSFN---------RSGPLTIHQRIHTGEKPY-----SCYQCGKSFVRDSNLIAHQREKPYSCDQCGKSFNQSLELTRHQ-RIHTGEKPYSCEHC-------GKSFNQSGNLSKHQRIHTGEKPYSCDQCGKSFALDFTLTTHQRIHTGEKPYCGKSFAHSGSLKKHKEAQT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 640
107 0.000e+00gi|918327992|gb|KOF93342.1| hypothetical protein OCBIM_22004698mg [Octopus bimaculoides]  clstr ali  11  214.RSSLTSHKVIHTGEKPFHCDICGKSFSSNTNLTVHKRVHTGEKPYHCYVCDKSFAQSNDLTK--------HKRIHTGEKPYQCNICGKSFSACTQLIIHKRVHTGKKPYCCDTCGKSFSQSNSLISHKRIHTGEKPYCCAICGK-SFSHRNSFANHQRIHQKPYNCDICGKSFCCDICGKSFSLYCQIRIHKRIHTGEKPY-----RCDICGKSFPQICGLTSHKREKPYQCDICDKSFTVNSTLTKHKL-IHTGMKPYHCDIC-------GKSFSGSSNLTKHKRVHTGEKPYCCDVCGKFFSLSNHKRIHTGEKPFNCEVCGKSFSCNSYLTVHKRIHTGEKPYHCDICGKSFSAGSKLTRHKRIHTGEKPYHCDICGKSYSKKCSLTTHVCTHR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 622
108 0.000e+00gi|961101969|ref|XP_014775764.1| PREDICTED: zinc finger protein 91-like, partial [Octopus bimaculoides]  clstr ali  10  365..SNLIAHKRIHTGEKPYHCDICGKSFSDNGDLTKHKRIHTGEKPYHCDICGKSFSQSNSLTSHKRACDVCHKRIHTGEKPYHCDICGKSFIRNNDITRHRRIHTGVKPYHCDFCGKSFIESGKLTAHNRIHTGEKPYHCDICGKKSFIESGKLTAHKRIHEKPYHCNICGKSFSCDICGKSFIESSKLNSHKRIHTGEKPYH-----CGICGKSFSESSNLTAHIREKSYHCDICGKSFSQNSSLTAHK-RTHTGEKPYHCDIC-------GKSFPDNGDLTKHKRFHSGERPYHCDICGKSFSQNSDLTKHKRFHSGERPYHCDICGKSFSQSYSVTSHKRTHTGEKPYYCDVCGKSFTESSNLTRHVRLHREEK.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 798
109 0.000e+00gi|961130220|ref|XP_014785692.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  10  5..........................................................................................FSIMNHLPKPKYRDTGEKPYHCDICGKSFSQRSDLTRHKRTHTGEKPYSCDICGK-SFSVSSNLKTHKHTGENPYQCDICGKSFACNICGKSFTENSNLTAHRLIHTGEKPYH-----CDICGKSFSVRFSLTIHKGERPYHCDICDKSFSAGFQLTKHKQ-IHTGERLFNCDTC-------GKSFSQSCELSRHKRVHTGEKSYHCDICDKSFFQGSDLTRHKRTHTGEKPYHCDICGKSFSQGGVLGKHKLTHTGEKPYHCNTCGKSFSISSNLRIHKRVHTGENPYHCDICGKSFSVRCSLTRHKLTHTGEKPYHCDVCGKSFTEIRNLTTHRTVHTGEKPY---------HCDICGKSFSLKFHLTRHKHTHTGER............................................................................................................................................................................................................................................................................................................................................................................................................. 386
110 0.000e+00gi|612015568|ref|XP_007490738.1| PREDICTED: zinc finger protein 420-like isoform X1 [Monodelphis domestica]  clstr ali  10  126...........................................................................................PQNSSHIEHQGIHSGEKSSEDNQCRKTFMQRAIPVGHQRMHSLKKPYECKQCGK-TFTCYSNLARHQRIHEKPYKCNQCGK---------SFSRRSSVVVHQKIHSGEKTY-----ECKQCGKTFRWNSYLAKHQREKPYECNQCGKTFHLKSSLVKHQ-RIHTGEKRYECKQC-------GKTFNQSSRLAIHQRIHTGDKPFECKQCGKRFSENSSLGVHQRIHTGEKPYECNQCGKTFSQCSYLARHQRIHTVEKPYECNQCGKTFSLRSHLARHQRIHTGEKPYECNQCGKTFSWSSYLAVHQRIHTGEKPYECNQCGKPFSQSSSLAVHQRIHTGEKPYECNQCGKPFSRSS................................................................................................................................................................................................................................................................................................................................................................................................................................... 465
111 0.000e+00gi|1002600431|ref|XP_015679295.1| PREDICTED: zinc finger protein 678-like isoform X2 [Protobothrops mucrosquamatus]  clstr ali  14  517MSSSLTYHKRIHTGEKPYKCTECGKSFTQNIQLTSHKMIHTGEKPYKCTECGKSFNTSSNLA--------CHKRIHTGEKPYKCTECGKSFTQNIQLTSHIRIHTGEKPYECKECGKSFTQKIQLTSHKRIHTGEKPYKCRKCGK-SFRNNGSLTLHERIHEKPYTCMECGKSFS---------RGSHFASHKTIHTGEKP-----HKCLECGKSFRENTSLTIHKREKPYKCLECGKRFRENGSFTSHK-RIHTGERPYKCMEC-------GKSFTTSSNLTSHMRIHLVRDMQENENKKKSSWLTSQIAKH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 804
112 0.000e+00gi|918335751|gb|KOF97756.1| hypothetical protein OCBIM_22028603mg [Octopus bimaculoides]  clstr ali  11  270.KSKLRRHIYVHTGEKPYSCNICGKSFSQNVDLNKHIRIHTGEKPYHCDICGKSCSTSSDL--------IKHKRVHTGEKPYHCDICGKSFSEGSALHKHRRIHTGETPYHCDVCGKSFSDGSTLIKHKNIHTGEKPYHCDICGK-SFSKSHALTKHKRIHTKPFQCDICGQSFS---------RNGYLTKHKHTHIDEKTYH-----CVICGKSFSQSNDLAKHKRERPYHCAICGKSFSQSNDLYRHK-RTHTGDKPYQCDVCE-------KAFSTNRYLIKHKYVHAGEGPYQCDICGKSFSQ-QYLTIHKRTHTGEKPYLCVICGKSFSQNVHLTLHKRTHTGEKPHHCDICGRSFSQISTLSNHKYIHRAEKLYLCDICGKSFSRKFELTRHKRLH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 671
113 0.000e+00gi|961138805|ref|XP_014788678.1| PREDICTED: zinc finger protein 665-like, partial [Octopus bimaculoides]  clstr ali  12  77..NHLTKHKRVHTGEKPYHCDICGKSFSENGQLTRHKRIHTGEKPYHCEICGKSFSQNYVLTTHQL--------IHTGEKPYHCDICGKSFSENYNLTRHKRIHTGEKPYHCDICGKSFSETGYLTIHKRVHKGEKPYHCDICGK-SFSQSYHLTTHRRIHEELYCCXXXXKPYHCDICGKSFSQSYHLTTHRRIHTGEELYC-----CDICGKSFSENSCLTKHMRENPYHCDICGKSFSYGHSLTVHR-YIHSGVKPYHCEIC-------GKSFSQNCRLTKHKRVHTGEKPYHCNICGKSFSENGHVTIHKRSHTGEKPYHCDICGKSFSHNSHLTRHRRIHTRE....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 406
114 0.000e+00gi|589965761|ref|XP_006995411.1| PREDICTED: zinc finger protein 160 isoform X1 [Peromyscus maniculatus bairdii]  clstr ali  10  244..............................SLLMKKQKAHIKEKPYQCNECGKVFSYTSSLAHHQQT--------HTGEKLYKCVECGKAFFRRSYLLVHERHHTGAKPYKCNECGKVFTQNSHLTSHRRVHTGEKPYKCNECGKA-FSVRSNLTNHQHTGEKPYKCNECGKVFSCNECGKVFSSHSNLNTHQIIHTGEKPY-----KCSECGKVFTQNSHLRIHTGEKPYKCNECGKAFSVYSSLTTHQA-IHTGEKPYKCDECPYKCEECGKVFSQTSNLARHWRVHTGEKPYKCNECGKAFSVRSSLTSHQVIHTGEKPYKCNECGKVFSQTSSLAIHQRIHTGEKPYRCNECGKAFNSHSNLNTHQVIHSGQKPYKCLECGKVFTQNSHLANHRRTHTGEKPYKCNECGKAFSVYSSLTTHQAIHTGEKPYKCNE---------CGKVFTQNSHLASHRRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 704
115 0.000e+00gi|929069221|ref|XP_014037582.1| PREDICTED: zinc finger protein 271-like isoform X1 [Salmo salar]  clstr ali  12  323LSGSLITHQRIHTGERPYSCDQCGKSFNHSGHLTTHQRIHTGEKPYSCDQCGKSFNHSGTLSE--------HQRTHTGEKPYSCDQCGKSFNQSGHLTIHQRLHTGEKPYSCDQCGKSFNQSGDLTAHQRIHTGEKPYSCDQCGK-SFNRSGNLTAHQRIHEKPYNCDQCGKSFSCHQCGKSFKRSGYLTTHQRIHTGEKPY-----SCDQCGKSFRNLGHLTIHQRERPYSCDQCGKSFARDFTLTKHHL-IHTGEKPYSCDHC-------GKSFRTSEHLTKHQRIHTGEKPYSCDQCAKSFSQDSSLTTHQLTHTGEKPYCGKSFAHSGSLKKHQKAQT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 670
116 0.000e+00gi|918295082|gb|KOF71752.1| hypothetical protein OCBIM_22000576mg [Octopus bimaculoides]  clstr ali  11  3....................................................................................................................KSFLGSSNLPRKKRFHRREKPCLCNICGK-SFSVGVTLTEHKRIHTKPYHCDICGISFS---------RNSNLIRHKHLHTGEMPYH-----CDVCGKSFSVSSNLITHKREKPYHCDICGQSFSQKVSLTTHK-YTHTGEKPYPCDIC-------GKSFSLTGYLTIHKRTHSGEKPYHCDICGTSFARSSYLTSHKRTHTGEKPYHCDICGKSFSVNGYLPVHKRTHTGEKPYHCNVCGKSFSQNSYLTIHKYTHTGEKPYHCDICGKSFSVNSNLTKHKDIHIRMEPYYCDVCGKSFAQKRYLNVHKRVHTGEKPYHCHSGEKPYHCDICGRSFAESGTLAIHKRLHTGER............................................................................................................................................................................................................................................................................................................................................................................................................. 358
117 0.000e+00gi|961120458|ref|XP_014782311.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  11  35.............................................YPCDICKKSFSRKDSLAI--------HKRTHTGEKPYHCDICGTSFFQNNHLTKHKRTHTGEKPYHCDICGKSFTLSGNLTAHRRIHTGEKPYDCDICGK-SFSRSGNLTTHSRIHEKPYQCNTCGKSFS---------NGSALTKHKHIHAEEKPY-----RCDICGKSFTQTGSLTIHIREKPYDCDTCGKSFSLHDQLTTHQ-RIHTGEKPYVCDTC-------GKSFSQRAHLTKHKRTHTGEKPYHCDICSKSFSVNSHLNRHKRIHTGEKPYSCDICGKSFSETDPLTKHMRTHSGEKPHHCDICGKSFSRSDSLTTHKYSHTGEKPYQCDICGKSFTETSRLTKHVRTHTGEKPYHCDICDESFSRNDSLTAHKHIHTGEKPY---------HCNICAKSFSRSNSLIKHKHTHTGEKQ............................................................................................................................................................................................................................................................................................................................................................................................................ 426
118 0.000e+00gi|667323163|ref|XP_008588790.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 665-like [Galeopterus variegatus]  clstr ali  11  324..................................................................................................................YGTDFIFSSSLTQDQKIHIKEKLCKCNKCGKA-FSDSLTLTKHQVIHEKSYKCNECGKVFKCSECGKVFRKNTHLAVHQRIHTGEKPY-----KCNACGKAFSDSSVLTIHTGEKPYKCDECGKVFSQRSSLASHR-RIHTGEKPYKCNEC-------GKVFRKNAHLAVHQRIHTGEKPYKCKECGKAFSDSSVLTNHQTIHTGEKPYKCDECGKVFSHRSYLAGHWRIHTGEKPYKCNTCGKSFSDSLNLTKHQVIHNGEKSYKCNECGKVFSQRSSLASHRRIHTGEKPYKCDECGKVFRKNAHLAVHQRIHTGEKPYKCN---------ACGKAFSDSSVLTNHQTIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 681
119 0.000e+00gi|961103018|ref|XP_014776136.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  12  174.KSDLTIHIRIHTGEKPFQCDICGKSFSRNGEVTVHKRIHTGDKPYQCDICDKSFSQNSDLTIHKRTCDTCHKRVHTGDKPYHCDICGKSFSQKSNLTIHVRIHTGEEPYQCDICDKSFSEKGGLTIHKRIHTGEKPHHCDICGK-SFSQRSNLTVHMRIHEKPFHCDICGKPFS---------GSGDLTKHKRTHTGEKPY-----RCDICDKSFSGSTDLTKHKREKPYHCDVCCKSFCQLSELSSHK-RIHTGEKPYHCDIC-------GKSFSHSKTLTTHKYIHTGERPYHCKICGKSFCQSGQFAMHKRIHTGERPFHCGICAKSFTEEVHLTTHACVST......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 521
120 0.000e+00gi|674089858|ref|XP_008852934.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 420-like [Nannospalax galili]  clstr ali  11  79.......................................................................HEYIHTGNKPYRFEECGKSFIPLSDIRAHQRIHTGEKPYRCGECGKSFRRMSYLRAHQRIHAGEKPYRCEECGK-SFIQMSHLRAHQRIHEKPYRCEECGKSFRCEECGKSFRLILHLRAHQRIHTGEKPYGEKPYRCGECGKSFIQMSHLRAHQREKSYTCEECGKSFRYISTLRRHQ-RIHNGEKPYRCEEC-------VKSFRRISDLTTHQRIHTGEKPYRCGECGKSFSEMSHLRTHQRIHIGERPYKCEECGKSFRYISSLRAHQRRHTGEKPYRCGECCKSFSQMSHLRTHQRIHIGEKPYKCEECGKSFRRILHLRAHQRIHTGEKPYRCGECGKSFSQMSHLRGHQRIHVGEKPYRC.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 483
121 0.000e+00gi|918313804|gb|KOF83696.1| hypothetical protein OCBIM_22023350mg [Octopus bimaculoides]  clstr ali  13  162.SSALPRHKRIHTGEKSYHCDICGKSFPVGSDLTKHKRIHTGEKPYHCDICDKSFSWISNLST--------HKRIHTGEKSYHCDICGKSFSQNGDLTTHKHTHTGEKPYHCDICGKSFSRSSNLSTHKRIHTGEKSYHCDICSK-SFSKCNDLTRHKHIHEKPYQCDICGKSFS---------LNSILSRHKRIHTGEKPYY-----CDICGKSFSGSSNLSIHKREKPYYCDICGKSFSESSTFHRHKL-THTGEKPYQCDICD-------KSFNQNGDLTKHKRIHTGEKPYHCDICGKSFSNSSDLTKHKRSHTGEKPYHCDICGKSFSRNSHLNEHKLIHTGEKR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 485
122 0.000e+00gi|918316417|gb|KOF85737.1| hypothetical protein OCBIM_22019863mg [Octopus bimaculoides]  clstr ali  11  41.SSDVSRHKRIHTGEKPYHCDICGKSFSENTDLTKHNSIHTGEKPY-CNICGKSFSNSSHLSRHKHICDICHKRIHTGEKPYYCDICGKSFIENTALKKHIRIHTGEKPYHCDICGKSFSNSSHLTRHKLIHTGEKPY-CDICGK-SFLDNSYVSIHKRIHEKPYHCDICGKSFHCDICGKSFSQSIHLTGHKRIHTGEKPYH-----CDICGKSFSENTALTKHNREKPYHCDICSKSFSNCSQLTEHN-RIHTGEKPYHCDIC-------GKSFSQNTALTKHNRTHTGEKPYQCDICSKSFSNNSQLIEHNRIHTGEKPYQCDICGKSFSQCGSLKSHRSIHMGEKPHHCDICGKSFSRSSHLSRHKQIHTGEKPYHCDVCGKSFSQSSHLKIHIRIHTGEKPCQCDICGKSFSENRTLTSHRRIHTREK.................................................................................................................................................................................................................................................................................................................................................................................................................................................. 501
123 0.000e+00gi|641658099|ref|XP_008180596.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum]  clstr ali  13  102.SSDLTTHRRTHTGEKPYACDVCEKSFSASTDLTIHRRMHTGEKPFLCDVCEKSFSKSGNLTAHRRTCDVCHKRTHTGEKPYACDVCEKSFSQSSHLTKHKRTHTGEKPYECDVCEKSFSETTNLMIHRRMHTGEKPFPCDVCEK-SFSKSTNLTTHRRTHEKPYACDVCEKSFSCDVCEKSFSQSGDLTAHRRTHTGEKPF-----PCDVCDKSFSKSTNLTTHRREKPYACDVCEKSFSESSHLTKHK-RTHTGEKPYVCDVCE-------KSFSQSGNLTKHKRTHTGEKPYACDVCEKSFSESSHLRTHTGEKPYACDVCEKSFSASTDLTIHRRMHTGEKPFPCDVCEKSFSQSGNLTAHRRTHTGEKPFPCDVCEKSFSESGNLIRHKRTHMA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 534
124 0.000e+00gi|612044888|ref|XP_007501210.1| PREDICTED: zinc finger protein 160-like isoform X1 [Monodelphis domestica]  clstr ali  12  324.RSNLAVHKRIHTGEKPYACNQCGKAFRLKIDLAKHERIHTGEKPYECKQCGKTFRLRFNL--------VTHQRIHTGEKPYECNQCGKTFRLRFDLAKHERIHTGEIPYKCKQCGKPFRLRFSLATHQRIHTGEKPYECKQCGK-TFSRSFSLATHQRIHEKPYECNKCGKMFR---------LRFDLAKHQTIHTGEKPY-----ECNQCGKTFRLRFDLAKHQREKPYECNQCGKTFSCSSSLAIHQ-RIHTGEKPYECSQC---GKTFSRGSSLAVHQRIHTGEKPYECNQCGKAFRLGFSLATHQRIHTGEKPYECKQCGKTFSRSSSLAVHQRIHTGEKPYECKQCGKTFSRSSSLAVHQRIHTGEKPYECNQCGKAFNQRSNLAV----HQRIHAGKK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 702
125 0.000e+00gi|837832809|ref|XP_012785787.1| PREDICTED: zinc finger protein 160 [Ochotona princeps]  clstr ali  11  260..............................SLLTQEQKAHIREKPYACEECGKIFSYTSSLA-HHR-------RIHTGEKPYKCIECGKAFFRRSYLLVHERHHTGVKPYKCNDCGKVFTQNSHLISHRRIHTGEKPYKCNECGKA-FSIRSNLTNHQHTGEKPYKCNECGK---------VFSQTSSLAIHRRTHTGEKPY-----KCNECGKVFSSHSNLNTHQGEKPYKCXECGKVFSSHSNLNTHQI-IHRGEKPYKCYEC-------GKVFTQNSHLANHRRIHTGEKPYKCNECGKAFSVYSSLTTHQAIHTGEKPYKCNECGKVFTQNSHLASHRGIHTGEKPYKCEECGKFFSQTSNLARHLRVHTGEKPYKCNECGKSFSVRSNLIAHQVIHTGEKPYKCNECGKVFSQTSSLAIHRRIHTGEKPYRCN............................................................................................................................................................................................................................................................................................................................................................................................................................................. 642
126 0.000e+00gi|961139875|ref|XP_014789057.1| PREDICTED: zinc finger protein 91-like, partial [Octopus bimaculoides]  clstr ali  12  1......................................................................................CGKSFSQNNHLTDHKRIHAGEKPYHCDICGNSFSCSGSLTVHKRTHTGERPYHCDICGKA-FSQNTTLKKHKHTGEKPYHCDICGKSFSQSIH---------LTEHKHIHTGEKPYH-----CDICGKAFSRNSDLTRHIREKPYHCDICGKSFSENIALTKHI-RTHTGEKPYHCDIC-------GKPFSDNTALATHKRIHTGEKPYHCDICGKSFSQNSNLMRHKRIHTGEKLYHCDICGKSFSCSSKLSTHKRSHTGEKPYHCDICGKSFSRNSNVTVHKRIHTGEKPYHCDICGKSFPQSNHLTEHKRIHTGEKPYQCDICGKSFSQSIHLSTHIRSHTGEKPY------------HCDICGKSFSRSSNVTMHKLIHTGEKPYH....................................................................................................................................................................................................................................................................................................................................................................................................... 361
127 0.000e+00gi|961079358|ref|XP_014767942.1| PREDICTED: zinc finger protein 726-like [Octopus bimaculoides]  clstr ali  10  2.........................................................................................SFSEKDKLTTSKRIHTRKKAYPCDICGKVFSTRGELTTHKRIHTGEKPYQCDICGKA-FPQNHHLITHKRIHEKPYHCDTCGKSFHCEICGKSYSRNDELTIHKRVHTGEKPYQ-----CDICGQSFTRKDSLTTHKREKPYQCDICGKSFSKNTNLTDHK-RIHTGEKPYHCDIC-------GRSFTQNNQLTKHKRIHTGEKPYRCDICDESFSRNDELTTHKRFHTGEKPYHCTICGKLFSGAINLTLHKRIHTGEKPYQCDICGKSFPQHGHLSKHKRIHTGEKPYHCDTCGKSFLQSDHLSKHKHIHTGEKPYHCEICGKPFSRNDELTIHKRVHTGEKPY---------HCIICGKSFSRSNLLSGHKRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 383
128 0.000e+00gi|918283900|gb|KOF65645.1| hypothetical protein OCBIM_22014788mg [Octopus bimaculoides]  clstr ali  10  1....................................................................................................MPKHTGKSSYHCDICGRPFSLKGNLITHKHIHTGEKPYHCDICGK-SFPGKHDLTTHKRTHEKPYHCEICGDSFSCDICGKSFSHGNTLTIHKRIHTGEKPYH-----CNICGKSFSVNHRLIKHKGEKPYHCDICGVSFSQRSNLTKHK-RIHTGEKPYHCEIC-------GKSFSETGHLTTHKRIHTGEKPYQCDICGKSFSHGNSLTIHKRIHTGEKPYHCDVCGKSFSENGVLTKHKRIHTGEKPYQCDICGKFFSRNGEVTTHRRIHTGDKPYHCDICGKSFSFNGDLTKHKRIHTGEKPYQCDICGKLFSQKGNLTTHIRIHTGEKPY---------HCDVCGKSFSVGSSLNKHKRIHTKE.............................................................................................................................................................................................................................................................................................................................................................................................................. 377
129 0.000e+00gi|961126177|ref|XP_014784291.1| PREDICTED: zinc finger protein OZF-like [Octopus bimaculoides]  clstr ali  11  16.........................................GETLYNCDVCKKSFSQKDNLTSHKC--------IHRGEKPNH----------RGHLTTHKFIHTGEKPYQCDICNKSFSEKYKLTRHKNIHTGEKTYPCDICGK-SFILRSHLTTHKRIHEKPFHCDICGKAFS---------QISELSSHKRIHTGEKPYH-----CDICGNSFSHGHTLTNHKRDKPYHCDVCGTSFSQTGNLTRHK-RIHTGEKLYNCDIC-------SKSFSHKGNLTTHKRIHTGEKPYHCDVCGKSFIGSGDLTKHKRIHTGEKPYHCDICGKSFSEGSILTKHKRTHTGEKPYHCDICGKSFSQNGVLTKHKRTHTGDKPYHCDICGKSFPQSGDLSTHKRIHTGEKPYHCDICGKSFSAKSNLITHKRIHTGEKPYPCN---------ICGKAFSQTSELTTHKRIHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 399
130 0.000e+00gi|918319293|gb|KOF87946.1| hypothetical protein OCBIM_22015821mg [Octopus bimaculoides]  clstr ali  13  897LRSHLTKHKRIHTGEKPYHCDICGKSFSQKCNLKTHECIHTGEKPFHCDICGKSFSQTGGL--------TAHKRSHTGDKPYHCDICDKSFSHTGSLTTHKYIHTGEKPYHCDICGKLFSQNDTLAKHKRIHTGEKPYHCDTCGK-SFSQTGTLTRHKRIHEKPYHCDVCGKSFSCDICGKSFSQTGSLTTHKYTHTGEKPYH-----CDICGKSFSQTSHLYIHTGEKPYCCDVCGKAFSEGSKLTKHI-RSHTGDKPYPCNIC-------GKSFSDGAVLTKHRHIHTGEKPYQCDICGHQTTLTE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1217
131 0.000e+00gi|961101957|ref|XP_014775760.1| PREDICTED: zinc finger protein 493-like, partial [Octopus bimaculoides]  clstr ali  12  1................................................................................................LTKHIRIHTGEKPYPCDVCGKSFYQSSTLAKHIRIHTGEKPYHCDICGKL-FSRNTALKRHKHIHEKPYNCDICDKSF---------YQRSSLTSHIRIHTGEKPYH-----CDICGNSFSQSFLLNVHKREKPYHCDICGKSFTGSSNLTKHI-RTHTGEKPYHCDIC-------GKSFSQSSVLTAHKCIHTGEKPYHCDICGKLFSGNTALIKHKHIHIAEKPYNCDICSKSFYQRSSLTCHRRIHTGEKPYHCDICGNSFTTSSTLNTHKLVHTGEKRYPCDICSKSFTQSSSLTTHKRIHTGEKPYHCAICGKSFSQNACLISHNRIHTGEKPY------------NCDICGKSFSRSSHLSKHKCIHTGEKPYDCDICGKSFYRSSNVTR....................................................................................................................................................................................................................................................................................................................................................................................... 367
132 0.000e+00gi|961084699|ref|XP_014769787.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  12  127.SSQLTSHRRIHTGEKPYHCDICGKSFSESSHLTSHRRIHTGEKPYNCDICGKSFCTNSKLTVHRYICDVCHRRIHTGEKPYQCDICGKSFSRNGMLAVHKCIHTGEKPYHCAICGKSFSLSSNLTIHTRIHTGEKPYHCDICGK-SFSQSSSLTIHKRIHEKPYNCDICGKSFSCDICGNSFSESSQLTTHRRIHTGEKPYH-----CDICGKSFSLNSHLTTHTREKPYHCDICGKSFSINSALTRHK-HIHTGEKPHHCDIC-------GKSFSEWGSLATHKRLHTGEKPYHCDICGKSFCRAGQVTSHKRIHTGEKPFHCDVCGKSFAVKCHLNRHISVHH......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 502
133 0.000e+00gi|961072907|ref|XP_014784079.1| PREDICTED: zinc finger protein 665-like [Octopus bimaculoides]  clstr ali  16  210..NHLTTHIRVHTGEKPYHCDICGKSFSVACSLTKHKRIHTGEKPYQCDICGKSFTLNSHLTT--------HKRIHTGEKPYHCDICGKSFSQSGDLTTHKRIHTGEQPYLCDICAKSFSDKGSLTRHKCIHTGEKPYNCDICGK-SFSQNGDLTTHKRIHEKPYLCDICGKSFS---------EKGSLTKHRRIHTGEKPYH-----CDICGKSFSIDSHLTTHKREKPYHCNICGKSFSQSGDLTTHK-RIHTGDKPYLCDVC-------GKSFSVICSLTRHQCIHHFHK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 477
134 0.000e+00gi|918279703|gb|KOF63395.1| hypothetical protein OCBIM_22019148mg [Octopus bimaculoides]  clstr ali  11  213VSGNVTIHKRIHTGEKPYQCDICGKSFTESNKLTKHKRIHTEEKPYHCDICGRSFSQNNHLTRHKYTCGTCHELIHTGRIPYHCDICGKSFFHNCDLVIHKRIHTGEKPYHCDICGKSFSLSGHLTRHKNIHTGEKTFRCDICGK-SFSEKGYIIKHKRVHEKPYHCDICGRSFSCDICGKSFAQRARLTTHKRTHTGEKP-----HNCDTCGKSFSRTDLLSSHKREKLYYCDICGKSFCLNQHLTLHK-RIHTGEKPFHCDIC-------GKSFLQSNHLTKHKRIHTGEKPYHCDVCGKSFSQNDSLTAHKRIHTGEKPYPCDICGKSFSQRAHLARHISNH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 588
135 0.000e+00gi|148706079|gb|EDL38026.1| zinc finger protein 160 [Mus musculus]  clstr ali  12  205...............................................................................KPYQCKECDKVFSYTSSLAYHRQIHTGEKLYKCLECGKAFFRRSYLLVHERHHTGAKPYKCNECGKV-FSQNSHLKSHRRIHEKPFKCNHCGKAFKCNECGKVFSQTSSLTIHRRTHTGEKPY-----RCNECGKVFSSHSNLNTHQGEKPYKCSECGKVFTQNSHLANH-WRIHTGEKPYKCNEC-------GKAFSVYSSLTTHQAIHTGEKPYKCNECGKVFTQNSHLASHRGVHSGEKPYKCEECGKLFSQTSNLARHWRVHTGEKPYKCSECGKAFSVRSSLIAHQVIHTGEKPYKCTECGKVFSQTSSLSIHQRIHTGEKPYRCNECGKAFNSHSNLNTHQVIHTGQKPYKCMQ---------CGKVFTQNSHLANHQRTHTGE.............................................................................................................................................................................................................................................................................................................................................................................................................. 596
136 0.000e+00gi|961122482|ref|XP_014783012.1| PREDICTED: zinc finger protein 62 homolog, partial [Octopus bimaculoides]  clstr ali  14  372.SSGLTIHKRIHTGEKPYQCDICGKSFSRSSHITKHKRIHTGEKPYHCDICGKSFSGNSDLTT--------HKRIHTGEKAYQCDVCGKSFSGTSNLSKHIRVHTGERPYPCDICGKSFSANSDLSTHKRIHSGEKPYQCDICTKP-FSRHSHLTKHKRIHEKPYHCDICGKSFS---------GSSDLTTHKRIHTGEKPYQ-----CSVCGKSFSGSSNLSKHIRERPYPCDTCGKSFSRYSNLINHR-RIHTGEKPYRCDIC-------SKSFTLKRNLVTHALIHT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 635
137 0.000e+00gi|918306004|gb|KOF78179.1| hypothetical protein OCBIM_22031193mg, partial [Octopus bimaculoides]  clstr ali  12  211LSDKLTEHKQVHTGEKPYHCDICGKSFSHRNSLIEHKHTHTGEKPYCCNICGKSFSATGNLSKHKY--------IHTGKKPYHCDICGKSFSHGNTLTEHKYIHTGEKPHRCDICGKSFSATSNLTKHKRIHTGEKPYRCDICGK-SFSQRSNLTTHKHIHEKPYHCNICGKS---------VSQRSNLTTHKRIHTGEKPYH-----CVICGKSFSLTGHLATHNREKSYHCDICGKSFSHGNTLIEHK-RIHTGEKPYHCDVC-------GKPFSLSTNLTIHKRIHTGEKPYHCDICGKSFSQIGNLTKHKRTHTGMKPYHCDICSKSFSQKNHLSTHICIYTQE....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 533
138 0.000e+00gi|961125008|ref|XP_014783888.1| PREDICTED: zinc finger protein 91-like [Octopus bimaculoides]  clstr ali  10  33............................................................................................................................................................................SYDCDTCGKLFSQKADLVIHKCIHTGEKPYH-----CDICGKSFVNNSYLTTHIREKPYHCDICGKSFSQNGNLSLHK-RIHTGEKPYHCDIC-------GKSFSGNYYLTTHIRIHTGEKPYYCDICGKSFSESGNLTKHKLVHTEEKPYHCDICGKSFSQNGNLTLHKRIHTGEKPYQCDICGKSFSGIDYLTKHKRVHTGKKPYQCDICGESFYVNSHVTIHKRIHTGEKPYHCDICGKSFSQNRNLARHQRSHTGEKPY---------HCDICGKSFSETGNLTKHKLVHTEE.............................................................................................................................................................................................................................................................................................................................................................................................................. 311
139 0.000e+00gi|961128044|ref|XP_014784939.1| PREDICTED: zinc finger protein 160-like [Octopus bimaculoides]  clstr ali  11  187.RSHLTAHRRIHTGEKPYHCDICGKSFSVGTKLNKHKYIHTGEKPYHCDMCGKSFSDGGNLTKHKYICDICHRRSHTGEKPYHCDICGKSFSERSYITTHKRIHTGEKPYHCNICGKSFSQTSHLTTHKRIHTGEKPYNCGVCGK-SFSQTSHLTIHRRIHEKPYHCDICGKSFHCDICGKSFSQRSPLTTHKRIHTGEKPYH-----CDICGYSFSTKSHLNTHKRETPYHCDICGKSFSEGGKLNKHKF-IHTGEKPYHCDTC-------GKSFSTRSHLTTHKHIHTGEKPYHCDVCGKSFSQTSHLTIHKRIHTGEKPYHCDICGKSFYQNSDVTKHKRIHTGEKPYHCDSCGKSFSEGRFLSKHKHIHRGEKPKQNNIYS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 601
140 0.000e+00gi|940762769|ref|XP_014321769.1| PREDICTED: zinc finger protein 598 isoform X4 [Myotis lucifugus]  clstr ali  28  98..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIR--IDQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSYTPRHSRRNEGTVSGEDYEEVDRYNRQGRAGRASQSRRGSWRYKREEEDREVAAAIRASVATQ-QQQEIHKSPKEASTNGPVSQEAFPA-------------NTSAAGATHLSSTSKLKDEDFPXXXXXXXXXXXXXXPGPVGLALVYPVPTRGRSTFQEDDFPALVSSTSKPSPAPTSLISAWNSSGSKKVVQPTPGAQAAGGGSQPPRKAXXXXXXXXXXXXXXXXXXXXXDSRT--GLTTQELRSVPTTVAVSSLLALASTQTTSPLSLPPEKDGPPAAEQASRAPKGRAEGPVAVIVNGHTEGPAPAWSVPKEXXXXXXXXXXXXCPTPQEDFPALGGPCLPRMPPPPGFSTVVLLKGTPPPPPPGLVQVSKPPPGFSGLPSPHPAGVPSTTT----TTKAPRLTPAPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSEFKSHSGEFRQGVISAAQYYKSCRDLLGENFQKIFNELLVLLPDTAKQQELLSAHTDFRGQERLPGTQADLDCCVCPTCQQVLANGDLRSHQALHTADDDFPSLQAVARTLT.. 937
141 0.000e+00gi|940762763|ref|XP_014321766.1| PREDICTED: zinc finger protein 598 isoform X1 [Myotis lucifugus]  clstr ali  27  98..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIR--IDQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSYTPRHSRRNEGTVSGEDYEEVDRYNRQGRAGRASQSRRGSWRYKREEEDREVAAAIRASVATQQQQEIHKSEDREEGSRLKRGSRRLLRTGPGPKEASTNGPVSQFPANTSAAGATHLSTLPPSTSKLKDEDFPXXXXPGPVGLALVYPVPTRGRSTFQEDDFPALVSSTSKPSPAPTSLISAWNSSGSKKVVQPTPGAQAAGGGSQPPRKAXXXXXXXXXXXXXXXXXXXXXDSRT--GLTTQELRSVPTTVAVSSLLALASTQTTSPLSLPPEKDGPPAAEQASRAPKGRAEGPVAVIVNGHTEGPAPAWSVPKEXXXXXXXXXXXXCPTPQEDFPALGGPCLPRMPPPPGFSTVVLLKGTPPPPPPGLVQVSKPPPGFSGLPSPHPAGVPSTTT----TTKAPRLTPAPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSEFKSHSGEFRQGVISAAQYYKSCRDLLGENFQKIFNELLVLLPDTAKQQELLSAHTDFRGQERLPGTQADLDCCVCPTCQQVLANGDLRSHQALHTADDDFPSLQAVARTLT.. 974
142 0.000e+00gi|961135840|ref|XP_014787659.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  10  41................................................................................................................................................KKSFSPKTNLTIHARK--KPYHCDICGKSFSQNDH---------LTTHKRIHTGEKPF-----LCNICGRSFSQINHLTIHKREKPYLCDICGKSFSGSGELTCHK-RIHTGEKPYHCNICN-------KSFSRSDHLSKHKRIHTGEKPHHCDICGKSFCRSGELTSHKRVHTGEKPYHCDICGKSFSHGKTLTNHRRIHTGEKPYHCDICGESFSENGDLTKHKRIHTGEKPYNCDTCGKSFSQINHLTKHKRIHTGERPYHCDVCGKSFSQNSVLTKHKRIHTGEKPYCTHTGEKPYHCDICGKSFSHRNTLTTHKRIHTGEE............................................................................................................................................................................................................................................................................................................................................................................................................. 368
143 0.000e+00gi|961082339|ref|XP_014768968.1| PREDICTED: zinc finger protein 271-like [Octopus bimaculoides]  clstr ali  12  214.SSSLSKHRDIHTGEKPYHCDICGKSFSENGTLTTHRRIHTGEKPYQCDVCGKSFCQKNDLTTHKRICDICHKRIHTGRKPYHCDICGKSFSQSGYLTPHKRIHTGEKPYCCNICGKSFSQGSALTNHRRIHTGLKPYNCDVCGK-SFSRNDNLTNHKRIHEKPYHCDICGKSFSCDICGKSFPQTCGLNSHKRIHTGEKPYH-----CDVCDKSFSVNSTLTKHKREKPYHCDICGKSFSVGSELTIHK-RIHTGMKPYHCDIC-------GKSFPRICGLTIHKRIHTGEKPYHCDICGKSFSLTKHKRIHTGEKPYHCDACGKSFSEGSALVKHKRIHTGEKPYCCEICGKSFTVNSTLTKHKRIHTGEKPYHCNICGKSFSKRSHLTTHAVDHKYSTTVKK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 652
144 0.000e+00gi|24762671|ref|NP_611932.2| uncharacterized protein Dmel_CG11414 [Drosophila melanogaster]  clstr ali  100  1MQNGKPRSSARPSFHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKNVEIFSIGDCDHPVCYECSTRMRVLCQQNECPICRHVLSKVLFTLDKLPYRELEANNRSDLYSKKYRIGFCTAEIRQQFFKLLDHPCPKCDAPPYRTFEGLRNHVRSEHKLLYCDLCVETLNIFTFERRCYTQAELQLHNTKGDPDNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADGCNEFYNDYADLAEHFRAEHFLCEEGKCATEQFVGAFRNEIEYKAHVANVHGKSLNKQQAKQTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALXXXXXXXXXXPTSSSIAARAAQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKKAATPQVDFPALPGKGNKKNLRNLEEDMLPSGSPVPMANISAKHRSLADDYVSVASPSTFQKLQMVQKEEDEAKARQEALKKSAPKLTAAEFPSLGPSASASSSRTTAPKPSSGSPSLNWSKPANEKKQRELENRKAKVAPAPVLPSPTSKPAPKASNNNVQEQQANXXXXXXXXXXSNQENQPKTAKPKERNNNNEQKTNGAPSTPIRAPPGLKPGGPLKPPPGFVSNVTVNSVAKLPNNLTFTNSLGESYDIVPSPYTYTDPPDTEVRNQKLVDEVMSLLKTPEALNEFRLLSSKFRDGSCSGQAYYEHCQCAMLSSFYNLFPELLAMLPDISKQQELYLVHKQHLNSLPPAERKSVPALEVCKVCKQILITADLKSHQQAHELTKNFPVLGSSASNTHRN 867
145 0.000e+00gi|688549365|ref|XP_009298810.1| PREDICTED: zinc finger protein 135-like [Danio rerio]  clstr ali  10  549....................................................................................TQCGKSLASKSSLKIHMSIHTGKKSFTCLQCGKSFNQISALSKHKKIHTGEKPYTCTQCGK-SFSQSSNFNLHMRIHEKPFSCSQCGKSFNC---------SSHFKQHMRIHTGEKPF-----TCTQCGKSFSQSSNFNLHMRQKPFTCTQCGKSFSQSSSLNLHMM-SHTGEKPFTCTQC---GNSFNRSSHLNQHMRIHTGEKPFTCTQCGKSFNCSSHLNQHMRIHTGEKSFTCTQCGKSFSQSSNLNQHMKIHTGEKPFTCTQCRKSFSQSSSLNDHMKIHTGEKPFTCTQCGKSFNRSSNLN----KHMRIHTGEKPFTCTQCGKSFSQSSSLYQHMRIHTGEKPFTCTQ---------CGKSFNCSSHLNQHMRIHTGEKS............................................................................................................................................................................................................................................................................................................................................................................................................ 909
146 0.000e+00gi|749891770|gb|KIJ59677.1| hypothetical protein HYDPIDRAFT_100159 [Hydnomerulius pinastri MD-312]  clstr ali  17  76..............................................VCWICAEPVKYYSVSACNHRTCHVCSLRLRALYKKLDCTFCKEPQPTVIFTSSPDAQFSSYTPDSIPHKDPKLSIHFETQDMMEETLILLRFNCPDCDYTA-SGWGDLKLHVRAMHGKMLCDLCIRFKKVFAHEHALYPPNMLPLHLPSMPHEPIEGGIHPLCAFCRECFFSDDELFVHMRERHEECFICKRNERDQYFQNYESLEQHFAQAHFACTNPSCQAQKFV-VFGSALDLKAHQVEVHGADMSSRDKRDARRVQAEFEFDDTG-----GNXXXXXXXXXXXXXPPPLQNQNTTHAVPRGVVRRREGFGGHITAESGGNQTVQSSGPSRRASPSPPRGAERHAAFIARLQAAAPNPNSAVPAVKAAIRGYRTNELSARDLISTVWNILDNNLDDTASIDEDEKKSDLLASWNGFKIEQRHQFPDLVPTAVGSGYAGIASGRVLNAKHVTATRSSQQSSRQVWDRVAQAASSSSLRPVPGTSSASRPAERFPALAGPSNSGFRQPQRNTPWASSSSTGARPSSSIPTPALKKASTATSKPPPLSAAAFPELPALTNTRTKPSVGGNRSLRNIMGDSTPTSSAWRPNG...................................................................................................................................................................................................................................... 684
147 0.000e+00gi|597586285|ref|XP_007296199.1| zinc finger protein [Marssonina brunnea f. sp. `multigermtubi` MB_m1]  clstr ali  22  110.......................................EEGVDAEVCFICASEIEHESIAPCNHRTCHICCLRMRALYKDQNCAHCRTPAPFVVFTNDKTKRYEDFTDADIASVDKINGIRYESTEIEGDTTLLLRFNCPICDVACIS-WPDLHRHVRVAHKKKICDLCSKHKKIFTHEHELYTDAELSKHMKNGDDDQSGFKGHPLCSFCGTRFYSDDELFVHCRNSHEKCHVCDERGVPQYFLNYEAVYAHMVKDHYVCREPECLEKKFI-AFASEMDLKGHQLEEHANSLSKDVRRDARTVDISSFDYRAPYVEARRGGGXXXXDPNAEPIPASSAQPLRRDEQAFQRQMAIQSAQSITPRTFGGQLTANPTPAQSRAPAPAAMTVPPPSRNVEATPQEHARAARHSAVIERASTLLQSNTNKLSQFRNFISSFQKNAIAAPALIDSFFALSDTPPSALGTLIREVADLFEDPAKAAAIRAAHSSWRAVNEDYPSLPAASSSGGGSIPLNWVTTPSTSSSAKPKTSRVLKLKSSTAQSSRSSVSQNRSWGXXXXXXXXXXXXXXXXXNPFPGLPSAAARPSAPTRTXXXXXXXXXXXXXGPARPTPPTSRPVSRNVGKGDSSAFPALPAAAKPMS.................................................................................................................................................................................................................................... 744
148 0.000e+00gi|928028052|ref|XP_013862367.1| PREDICTED: zinc finger protein 598, partial [Austrofundulus limnaeus]  clstr ali  25  1...................................................................................................................................................CSSSSNLEKTFGKQHELFCCKLCLKHLKIFSHERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYKYLSEHFRESHYLCEEGRCATEQFTHAFRTEIDYKAHKAAAHSK--NRAEARQNRQIDLQFTYAPRQQRRNEEDYEEMRHNRGGRGRPQMGQKSWRYSREREEEDRQMEAALRASMAMRRQAERAAVQERNTPKHCREERMERVEAEEPKPLTKHLKTTTKPPVKTMKSTNPAASVKPAPVGPPAAQAALKEDDFPSLSSAAVSAPMTPYSGQTKKTSSFQEEDFPALVSKVRPFKPAAGTNLAWSSHTAAPKTNTHQPPPTRAPPPVSSASSGPRRKKKVGENGKAAPHHSPPLSDDESGGMTQQEFRSVPTMLDISSLLTVKGGNSKPSTGTSTFSNPSVETTAQKENRPEKTRNKPTSNAAPVPVVNGVAKGRADTPPAVCRDXPVVTPSPCTXXXXXXXXXXXXLIAKKPPPGFKSSFPVKASAASTPAAMSKPPPPPGSAPKPPPGFTGIPLNSNVVEPVVNQPPKGLSNEYLVPDDFQQRNLELIQSIKKFLNNDEKFNQFKNYSAQFRQSLVPAAQYHRSCKDLLGDNFSCIFNELLVLLPDTGKQQELLAAHGDCKALEKQSGAGGGKDCQVCPTCRQVLAPKDFSSHKTLHIGENEFPSLQSISRII... 810
149 0.000e+00gi|1018274751|gb|KZF26844.1| hypothetical protein L228DRAFT_258209 [Xylona heveae TC161]  clstr ali  20  79.....PGHRARGNFGTRLTGDATQAEDNRKVAKPADXXXXXXXXXXXCFICASPVIHQAVSPCNHRTCHICALRLRALYKTKACAHCRTNADYVIFTDHPSKRYEEFEEKDFAKSDDILGVKYEKNEIFEDTVLLLRYNCPDPDCDACLGWPDLHRHVKSTHHKVMCDLCTRNKKVFTHEHELFTANELRKHERHGDNDQSGFKGHPECGFCKMRFYGDDELYTHCRDRHERCHLCDRRDRFQYYVNYDALELHFKKDHFLCPDQECLDKKFV-VFDSEMDLKAHQLEAHPNGLSKDARRDARRVDLSTFGDFRAPHHFDXXXXXXXXXXXXXXDPNSEALPVSTAQPLRRDEIAFQRQRAIQSAQSVTTSTFGTQLSSTEAYAARPPPQSATDDSFPALPQEQARRMRHAAVTERATAMLRNDPSKVSQFRNKISAFRSSSISASELIDSFFSLFDTSSSELGKLVKELADIFEIDSKKAWSDWRAINEDYPALPGPSGPXXXXXXXXXXXXRVLKLKSSTAQSSRSAINKQNSWGTXXXXXXXXXXXXXXXXXFPALPSASAPSSNRAGASKSTTAPSWAGATPSGPAGIQPTSSSLSSYSRPAPKASSRGTPTVNSADAFPALPAAAKPTST........................................................................................................................................................................................................................................ 761
150 0.000e+00gi|597973651|ref|XP_007361512.1| hypothetical protein DICSQDRAFT_98224 [Dichomitus squalens LYAD-421 SS1]  clstr ali  17  46.QNTKPDTHPALIAQTPSDKAASSEAAVDSADATTEGAV---EDAAVCWICAEPVKYWSVSECNHRTCHVCALRLRALYKKLECTFCKEPQPSVIFTTSADAPWSSFTPEHIPFKDAKLSISFETQEMMEETLILLRFNCPDPQCDFIGNWSDLKLHTRATHGKLMCDLCIRFKRVFAHEHALYDPNVLPIHRRDHKPQQIEGGIHPLCEFCRECFFGDDELYAHMREKHEECFVCKRNEKDQYFRNYEALEEHFMNAHYPCRRAECLARKFV-VFGSAIDLKAHQVEEHGAEMSARDKRDARRVEAQFEFEETXXXXXXXXXXXXXXXXXXXXPPPHIVAPPGGASRPQAAGARRREAFGSNLTADGGNSSSQQPSRRQTPSPEPGDADPRLSALTVRMAGLAPNPTTAVPAVKAAIRSYRASESGARDLISTVWNVLDRNLDGTASIVNTLKKRDLLTAWNGFKVEQRNQFPELVPTTTGLEWAGVTSGRVLNAKSSTATRSSAQSSRQLWDRVARAAASTPASHNQASTSSVPTSAPRAAPGPHAFPPLGGGAGPSVTTTPFRQPQRTTPWXXXXXXXXXXXPVPAVRAPTSVPGPGARAKPGPSVLSKAAFPELPTTNSIRVPKAAVSGNQSLRKILGGSAPTQAAWSGDSGGSGSNAAAEP......................................................................................................................................................................................................... 726
151 0.000e+00gi|972546254|gb|KUJ22867.1| hypothetical protein LY89DRAFT_777890 [Phialocephala scopiformis]  clstr ali  19  68..NPHGARPQAVPGNAGTAPALGPGSGESKAGKTIAEGADESE-AEVCFICASPVMHEAIYPCNHRTCHICSLRMRALYKDKNCVHCRTEGTFVIFTDNAEKRYEEFTDADIASVDQNIGIRYESNDIQDDTRLLLRYNCPDGDCDACLGWPDLHRHVRSVHHKKICDLCSRHKKVFTHEHDLFTDAELTKHMRKGDDDQTGFKGHPICSFCNQRFYGDDELFVHCREKHERCQLCDSLGPPQYFLNYEALYNHFKADHYVCSHPSCLEKKFI-AFTSEIDLKAHQLSEHANDLSKDVRRDARIVDISTFEYRQPYVQEQRGGRSQREQREDQRDPNAEPIPASSAQPLRRDEQAFQRQMEIRTAQAAHSRTFGGQLTAPTPPQGLPQSRVRAPPNTPVSGQEQARQLRHREVIERASRLLQNDSTKVQQFRDSISSYKNGAFSATGLIESFFAL-----------------FTDTTPGPLGTLIREVADLYEDKSKADALKSAWNNWRAINEDYPSLPAASGSSGSSIPLTWAVSSSAGPSAASNGSGAKSKKLLKLKESTAASKRSSVSQSRSWGXXXXXXXXXXNAFPTLPPATRQNASSTKVXXXXXXXXXXXXXXXXXXXRPTPPTSRPASRNVGGDAFPALPPAAKPQSTIFGYGNGRMVRRDMGSSPVTTSNPWGPPSASNGGGSN.............................................................................................................................................................................. 772
152 0.000e+00gi|453082108|gb|EMF10156.1| hypothetical protein SEPMUDRAFT_143898 [Sphaerulina musiva SO2202]  clstr ali  20  143...........................................EAEVCFICASPVSHNSVAPCNHRTCHICALRLRALYKTKACAHCRTEATNVIFTDDAEKRYEDFVERDFHRVDKNLGISYEKHEIFEDTVLLLRYNCPDQDCEACLGWPDLHRHVRNTHQKVMCDLCTRNKKVFTHEHELFTHAELKRHEKFGDDDQSGFKGHPECGFCRRRFYGDDELFSHCREAHERCHLCDRRNTPQYFMNYDALEKHFSKDHFPCLDQECQEKKFV-VFDSEMDLKAHQLEQHPNGLSKDARRVDLSAFDYRPQYQEPTXXXXXXXXXXXXDPNAEPLPNLSRAEVAHQREREIHSAQSVSARSFGGQLSAPTPAQAASRPAITQQTATQAAPQSPHPAAPLTPQEQARQLRHAAVNERASNLARNEKVKMDAFRERVSSYTRGGISPGDLIDALFSIFDTSSKEIGKLINELADIFEVPGKRDSLLKAWADWKAVNEDYPTLPGPAGANTTAAGVLGKGVGASRVLKLKSSTAKSSQSAVGRQASWGSASSTPAASSSNPFPSLPPRNGGPSIQLGRGSAAPAPTPSWLATRPATDSAARSPAMTPSSSARASPAINARQQPTGTNTRSAELFPALPAAKKPTSTVFSPGYTGRGILRTNSGNPSVNAWAGGSGTSTP............................................................................................................................................................................................... 788
153 0.000e+00gi|697166212|ref|XP_009591927.1| PREDICTED: zinc finger protein 598 [Nicotiana tomentosiformis]  clstr ali  20  2............................................DDSCAVCAETLEWVAYGACGHKVCSTCVARLRFICNDRRCCICKTEAAVVFVTKALGDYTRMISDFGSYWYHEDTQAFFDDLDHYKMIRAMCRLSCSVCDKARFRNIEQLKGHLFHQHKLLMCSLCLEGRKVFICEQKLYTRAQLNQHIDTGDSERGGFMGHPLCEFCRTPFYGDNELYSHMSTEHYTCHICQRQGQYEYYKNYDDLEIHFRSNHFLCEDESCLAKKFV-VFQSETELKRHNTLEHGGRMSRSQRSAALQIPTSFRYRR------------------------SNEQDSRRRGRSFRRDNSENELVMAIQASLEAANADGRPRDTSSNRRVVSDLAETNDEDF----LIASFESLATDSVEPASRYRQAVSQASGNSQLQESSFPPLAVPVPPANNQPRPQSDALPKNTMASR--------LRGKQNKTTKPSSSSPAWPATGHTPPVIGHQRAWPVVXXXXXXXXXXXXXKAATDNPSAPVITRQHAWPAVNGAIGSSSGSSQIKPPSSSS------------------------RYSKAATDDPSAPVITREHAWPAVNGATGPTSGSSQIKPSTVDGPPPSSYLSSVAARSSLVHEACSSSVGSSK----NWSQSNRISHSTSAPNLVQSGSF---------DSSASDFPPVSAAQTRKLPASGQQAVTNVEDVQTANKSLVERMRLALQDQDKFAAFKDISAEYRQGLMDAETYLAYVEQF---GLSHLILELARLCPDAERQKELIDTFNANLGGTIPIQN............................................... 735
154 0.000e+00gi|752275423|dbj|GAM89193.1| hypothetical protein ANO11243_072300 [fungal sp. No.11243]  clstr ali  19  72.......RTTHNHDGQPSANSTFQGSITRAVSTNATNDTQEDEDAEVCFICASPVVHNSVAPCNHRTCHICSLRLRALYKNKSCAHCRTNAETVIFTDDANKRFEDFSADDFYTQEPNLGINYEKQEIFEDTVLLLRYNCPDPSCEACLGWPDLHRHVKSVHHKVMCDLCTRNKKVFTHEHELFTPQELKKHEKHGDDDQSGFKGHPECGFCKQRFYGDDELYTHCRDRHERCHLCDRRNQPQYYVDYNALELHFRKDHFMCPDQECLEKKFV-VFDSEMDLKAHQLEAHPNGLTKDARKDARRVDISGFDYRAP--HQQXXXXXXXXXXXXXXDPNAEPLPASSAQPLRRDELAYQRQMAIQSAQSVTSRTFGGQLSQSEALAARPPPNTREPATITASPQDQARRLRHAAVTERAALLLKNDSNKLLDFRSKVSAYQQGTLNAAGLIDFFFSIFDTSSSELGKLIKELADIFELQKKRAWSDWKAINEDYPSLPGPGTGASIASGSSVTPNGGSKSAGARVLRLKSSTAQSGRTAASRSLVSGNPFPPLAXXXXXXXXXXXXXLSTGPVPGSKSRPAWFNSIPSGATATTSSKILSAPSSGRSSPSLKPQAAPPPRQTRDMFPALPPGKKPTS........................................................................................................................................................................................................................................ 740
155 0.000e+00gi|671379097|ref|XP_008719439.1| hypothetical protein HMPREF1541_06891 [Cyphellophora europaea CBS 101466]  clstr ali  18  55.....SHSRPPGSFGTRLTGAAPTTQGGDSGPAENPQTDNPADDAEVCFICASPIDHTAIGPCNHQTCHICALRMRALYKTRACAHCRTEAPFVVFTDSTDRVFQDFKDHEFAKIDENLGIKFEKPSILEDTILLLRYNCPDCD-MACQGWPHLQRHVKGKHGKLMCDLCVRHKKVFAHEHEMFAFGELRRHEQKGDDDQSGFKGHPECGFCKERFYGDDELYTHCREKHERCHICDRQNSPEYYLNYQELEKHFATKHYVCLDAECQANK-TNVFESEIDLKAHQLAEHAGSLSKDVRRDQRVVNLSSFDVRTPYQPERXXXXXXXXDPNSEPLPMSSAQPLSRAELAYQRQMAIQSAQSTTTRTFGGQLTQPTAPGSQASQQPRRQPSPPSQDNLTLNPADRARALRHNAVTERAANLLEHDQGKLAQFRSHISSYRTNATTANDLLDAFFALFPSRPADLGILIRELADLYEDGTKRAWNSWRSINEDYPSLPLPSGAAPAASGRRVLKLKSSTAQSGRSNAARQASWGNILTPPTGVNGRAVPGLTGGGEAFPSLPASSGSARRAPSTSIAWAGAPSSNTTSRTITPSISTSASRAAGGGARPQKPPARTQDLFPSLPTASKPLNTMISGFNTRAY---GPALTSSRGGSGRNSGVQTPVNAWGNGGANPTPAQAAAAVSE...................................................................................................................................................................................... 760
156 0.000e+00gi|765128357|ref|XP_011476736.1| PREDICTED: zinc finger protein 598 isoform X1 [Oryzias latipes]  clstr ali  25  110..........................................................................................................................................ECPRCEPKIFCTFEELEKHMRKQHELFCCKLCTKHLKIFSHERKWYNRKELARHRAHGDTDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCATEQFTHAFRSEIDYKAHKAAAHSK--NRAEARQNRQIELQFNYATR--QQRRNEGMLTGEDYEEMRQNRGGRGRPPGGQKSWRYSREREEEDRQVEAALRASMAMRRQAERAAVQERSTPKHCREDRVDRTEPEEPKANTGHKTVNRPPVKTLKSSNPGDDEFPVLGATALIPSVKPASVGGAATLTPAYSAQPRKTSSFQEEDFPALVPKVRPRKPAASTSSAWSNHTAVAAPAASRHSPSLSDDESSGMTQREFRSVPTTVKTDNSKSSTVHAPPSNSTASADSPAPKNSKKKKQKNAGAASTSAFTAPGMTADVNPISVETAAQKENLPEKTRNKPNSSVTAPAEMSRLANGYPDPPQSVGKENPLLIPVSSTEPPPDQEEEFPALATKKPPPGFRASFPLTASVXXXXXXXXXXXXGAPKPPPGFTGIPLNSNVVEVAPSAVNSAPKALSSGYLVPDDFQQRNLELIQSIKKYLNNDEKFNQFKNYSAQFRQSVISAAQYHCCCEDLLGDNFNRIFNELLVLLPDTTKQQELLTAHADWHTPHSAANTAAELDCQVCPTCRQVLAPKDFNSHKTLHITENEFPSLQSISRIIR.. 927
157 0.000e+00gi|678990376|gb|KFV97557.1| Zinc finger protein 598, partial [Eurypyga helias]  clstr ali  26  3...............................................................................................................................................................................VFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNEGYEEVDRYNXXXXXXXXXXXXXXXXNRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRVEDKEDSSSRGRKEDDSEALSSKRVPKPSTDAAVENISFALFADTPKEADFPAIGSAAGPLPGSASAAPAVSSGMSLTYTATAKRTAFQEEDFPALVSKMKPNNKTVTNITSAWNNGSSKSVVKAISNPQIAKKPSSLNSTKGNKKSNKLSQSDDEDGGSVSSLLAASTSQTFMKVSKKKKMGVEKQRPSSPHLSQEASFPRPCAEKLTEAERTSTAAAALHAPDRSAAVMNGHSEKSLAICSTPKEPPGLKKPTVTTKCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKNPPPPPGLSVPVSKPPPGFTVIPSTNVPEPVTTSLKEAAFGLPQCRPKPCHGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRELLGDDFRKIFNELLVLLPDTVKQQELLSAHNDFRNKEKQSSNKPRKDCWICPTCRQVLTPRDVVTHKALHIEDEEFPSLQAISRII... 756
158 0.000e+00gi|72077963|ref|XP_788063.1| PREDICTED: zinc finger protein 598 [Strongylocentrotus purpuratus]  clstr ali  25  1....................................MSKTTDSLTSTCVLCCQEIKIYAIGPCNHPICFKCSTKMRVICNQMYCAVCRSEMPKAIFTIKLH-LFDGIISHKFPN-DRKSGIFFATTDIQGEYRRILTTECRICGREPDATFKKLQVHMRKEHELFSCQLCVENIKVLSSERKFYTRKDLARHRRTGDQDDTSYRGHPLCEFCDDRYFDNDELHRHLRKDHYFCHFCETDGTNQYYGEYEDLEDHFRSDHYLCEEDQCLNEKFVAAFRSEIDLKAHKAKRHASKMTKIQAKQTRQVDVEINLPARQREYQRGPRDGAYGGGTRGGRNRYQRDRKERDTEMAIEASLETAQKEEVKRDNERRDERKKKMVVQPQKEERRTRVIERRR--PDSPVEAIQPKRETKNKFKVEEDKENEVLKPGGAIDPISN------------------RDSYATNIAKKAPDLADFPTLAVPGQPFQMG---------------GRWSTAPQQTEADFPSLGNGDGAIKNAPMNVAASFGFYNSLHGNKAPSSLHGNKAAPATSTVETS--RTASPGADDDAEFPTLSSIASLLGGXXXXXXXXXXXXXXPQAQSASQDPKVMNYRSATESSGKESKREKSNAGAKMESTVQKPAMSVPSQPTTIIHXXXXXXXXXXXXXXXXPGFAAFPALSSSSVPPPGFSSSSAVQPPPPGFSSAANSAASGPEFVQAPNFKQQNRDLVAKIQGCFGDPRLFGQFKQDSGEFRQNMIPAQEYYRRCMQTLSENFQSVFNELVALLPDLTKQQELLAAHNSKSGSKAWKSTGKGESSSICSVCSQIVLARDLAEHMNVH---EEYPALSSGRSSRP.. 817
159 0.000e+00gi|926633070|ref|XP_013782326.1| PREDICTED: zinc finger protein 598-like [Limulus polyphemus]  clstr ali  28  1....................................MNSNDLSSDDNCVVCCRKLSIFAVGICDHPVCHECSTRMRVLCRQNECPICRRETPKVIFTRNLHPFAELSK--STYPMDQKYKIMFADKSVQSSYEKLLQHVCGVCGKSPFRTFNLLKEHMKRYHELFYCELCVEHLRIFSFERKCYTRRELGRHRRTGDTDDTSHRGHPLCEFCEERFLDSDELFRHLRRMHYFCHFCDADGLHQFYSDYEELRRHFRNEHYLCEEDSCRDEKFTSVFRNEIDLKAHKAQNHSKNMTKMQAKQSRTLELEFTITPRNSKPNGIISAADYEDFHTQNRRGRRGNQRGQPNTKSQRQEGFTASDQPARSEKNINTKCEKEFPQLSTNFTKGATLNNDTGSMTTNDTMANRLAKANRFTIRTGAPLKAGGRMNLTNTEEFPTLGSTTIQIPSQTVTSKPESPVSPGTRKTLLFRINSQEEGNNSSKRRAPNVSIQVSRTQNVIPPDGAKNSVADSGTMKKVSSYQNIMLQKPGXVRASRPGVKPSWVSTKTASHGKFDDEFPQLGETKEVPQSLTNNAWSSVTIPVSSCDVPVTESGDTSKPAMVMVKNKSKKKKQKPNCSSKCSIENQENEDPGCTQEQESITDLKKSSEENPKITSSDSTEELTQQTKSLAIEDFPPLDVPLSKKPPTPPGFSSKTSNVITPPPPPGFDSGQSVVKPSVNIPLSTQPTIPNHNYQERNHALIQAIQVILGNMERFRSFKTFSGHFRQNLISAQEYFENCLDILGKAFIRILPELVVLLPDINKQQELLIVLNNFKKSEFDKAGGAIPKFLVCATCQQVLAKEDFHDHMAVHNPDTDFPPLSAQSATTR.. 940
160 0.000e+00gi|909574553|ref|XP_013142981.1| PREDICTED: zinc finger protein 598 [Papilio polytes]  clstr ali  31  1....................................MAETQTNDNTTCVVCFKNVLYYSIGECDHPVCFECSTRMRVLCLQNECPICRQDLSRVVFTETIQPYKELRKVFSDRLFERQFKIGFCTEEIKKEYEKLLEHRCKTCDKPPFHTFTMLSDHMRRVHERYYCDLCVKHLKIFTSERRCYTRQELAHHRRKGDIDDTSHRGHPLCEFCEERFMDADELYRHLRKEHLYCHLCDADGKNLYYPTHSALAHHFRTDHYLCEEGDCAGEHLTAVFRSEIDLKAHKATVHGKGMPRGAARQARTLELQ--------APSRAYKGAEGLTRNDKNFPALDGSGTARSAPPPAPRPHAPVAAAILRNSKPSVSIQVHSQPASASNFRLTQTSTNRISIPAKKKPSHISDDDFPSLGPSVPRDDHPSIGSGTIQPPKVAMINSEEMQA-------FKSKPANHQPRKTNHKIMEAFPALTSTTTPSAPPQWINVSKGNNKPKPR------------------------------------AEPTPPPARAPAFNPVADFPTLPANTNKSKVIKSQPTPATTTTKIINTEAKSKKEKKKQNSNPKKENLFDTNHFNGLCENNNTEMAYITPSVNSNNQSSETDRKIKTITDAPVTSGNKNKNNFTLTQKEYPPLTANNDNHIPERQWKPVKANQNGVTNQKRPTVKCDGMTFTNSAGQVFPAPV--HTFIPPPDFELRNRALVKKFTIALGDIAAVENFKAASRAFRDSSISADDFYQSCQAVLGSQLENVFPDLVALLPDIAKQQELV------------IGRDISSLLEVCTTCGQLVVPDDRIAHDTAH................... 751
161 0.000e+00gi|939233424|ref|XP_014240211.1| PREDICTED: zinc finger protein 598 isoform X2 [Cimex lectularius]  clstr ali  34  3................................KRKQSSAKEENGENACVICFKKVDIYSLGQCDHPVCFECSTRMRVLCRQNECPICRQDLPKVVFTCTIKPFEQIQQNNC--QFDDKYKITFQSKEIKTAFEDLLKHECPECGK-IWANFNELRDHVRRVHQLTYCDLCVDNLKILTSERRCYTRKELAEHRRHGDPNDRSHRGHPLCKFCETRYMDNDELYRHVRRDHLYCHFCDADGIHQYYKTYDSLREHFRAEHFLCEEGECYLEKFTSVFRTEIDLKAHKANEHGKALGKAGIKQARKIDIEFSLSSRPRAYVRRNYRGEGGHSSTHQEEEEVEIQPTPTPQRQPNTNCQQEFPTLGGSPAAPPLSHKVNHPRFTTTLTASKANTNEHTHFPALDLGSGSPGPSSAPQTGQTKSQESTWTTTNKKEGKKKDVSKSHVVSLPHN-------AYNAKPANKNPPNLDDFPALAPKKKQP------EKTLTKSIASNTAPSSDSDHPQPXXXXXXXXXXXTQGSTNVAGTNVKKKQAACVLEKNTP-------------------------------------------GEPETLTKTSNKENECEPKENIEEMEKSDQQKHAKPKSNAEMAKKSGKEKLDEAFPALAGTETSKAPPGFEVNWAPKRP---------------PPGLAPPSQQVVAPPPGFTAMNGASFPPLGGDNLGLGEYIPPLNFEKRNNALVDKVANALGSD-SWVQFKDISMAYRSGIVSPDDYYKHCRLSMTEKFAQLFPELLALLPDINKQEQLWTLYSMDNEADKSKLKK-------CAVCRQVVRSGDFSEHYSRHSLDNHFPPLQKQTKQNRPN 762
162 0.000e+00gi|699626017|ref|XP_009895477.1| PREDICTED: zinc finger protein 598 [Picoides pubescens]  clstr ali  26  24..................................................................................................................HEKKYDIYFMDGDVYALYRKLLQHECSLCDLKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFSHERKWYSRKELARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREQHFLCEEGRCEVERY--------------------------NRQGRASRLAGRGSQQNRRGSWRYKREEEDRDXXXXXXXXXXXXXQEEKKRAEDKEDSSSRGRKEELRDPEVLGSKRVPKSSNDAAEAAANGALSQDDFPAIGAAVGALP--GPAQPSAVKLKEEDFP---------------SLSPAAPSTLSSGISLTYTATPRRTAFQEEDFPALVSRMRPNSKASITSAWSSGSSKSVVKAMSTPCSSQAARKPSLSTSRGSRKSNKLSQSDEEEGGAGLTTQEIRNTPTMFDVSSLLAASTSQKQRPSSPHPPQETAPRAAAEKLPEAEQPPSASAALHASDRPPAVMNGHLEKSLSSCSTPKEPPGLKKPTVTNKCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKSPPPPPGLSVPVSKPPPGF---------AVIPSTNVSEPLTAALKEPKSCHSSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYRSCRELLGENFRKIFRELLVLLPDTAKQQELLAAHNDLRGREKQSSGKPPKDCCICPTCQQVLTQQDLGTHKALHLEDEEFPSLQAISRII... 752
163 0.000e+00gi|475663187|gb|EMT60983.1| hypothetical protein FOC4_g10012274 [Fusarium oxysporum f. sp. cubense race 4]  clstr ali  18  85........................................EDDDGEVCFICANPVAHHSIAPCNHTTCHICGLRMRALYKTKDCAHCRTPAPYVIFTDDPEKRFEDYSEKDITTTDSNIGIKYTKEDIVGDTVLLLRYNCPDASCDFAGGWPDLHRHVKSAHRKRMCDLCTRNKRVFTHEHELFADKELEKHMRHGDDDQTGFKGHPLCGFCGERFYDDDKLYEHCRMKHERCFICDRRDSPHYYLDYNALEEHFKKDHYLCSDRECLEKKFV-VFESELDLQAHQLSDHGGKATGRDARVVNISGFDIRTPYQQXXXXXXXXXXXXXXXXXXXXPNMEPVPASSAQPLRRDEIAFQRQMAIHSAQSVSNRTFGGSLSAPSPTPAQASSSATVPDPANLSPEERARLVRHGAVVERASNLLGNDAQRMATFRNHISSYRQGGLTAPQLIDAFFTLFDTSSNALGTMVREVADLYEDKNKKAWQDWRAINEDYPSLPGATSSSSGWANAASANPAVPNAKATQKYSNRVLKLKNSTRLGGPAPVSSSGASSWTARPAVSAPPSSSNAFPSLPXXXXXXXXXXXXXWXXXXXXXXXXXXLDRPRPAPRPTGED---------------AFPALPTAPKPTTTIFGYGNGRAPLRRDEIAFQRQMAIHSAQSVSNRTFGGSLSAPSPTPAQASSQSRGGSSSNTPRASQTNLANPIESATVPDPANLSPEERARLVRHGAVVERASNLLGNDQRMATFRNHISSYRQGGLTAPQLIDAFFTLFADALGTMVREVADLYEDKNKADALRKAWQDWRA...................................................... 897
164 0.000e+00gi|908399916|ref|XP_013088799.1| PREDICTED: zinc finger protein 598-like [Biomphalaria glabrata]  clstr ali  28  5..........................................ESVDNCPVCHDVFELFGVGPCDHPVCYRCSTRMRVLCDQMDCPICRSPMPQVAFVYNKVLFKDINLRNCIP--NRKFKIFFEDEKVEGKYLELLEIRCKICRKDPDKTFNQLQTHMRREHELFACDLCVTHLKIFPYQRKFYTRQTLAIHRRVGDEDDKSYKGHPLCEFCDTRYNDKDELWKHLRKDHFFCHFCDQRGSNEFYDQYPDLVKHFSESHFLCDECASSSTRFTHAFASEIDLKAHKASVHSKNMSKAQSRETRTLELEFQLPPRRQGNSRGGSDYDSRRDFDYEDDLYRALEASKDGSTAPAKPIVEERVPDSVHDFPTLNGSTVPIPSTSLNYYSNQKPKTLEEEFPTLSSQAAGKKTPVPRSQMAPKITEDEYPALGNSQSLSNTLQSTTAGWIKKSAAETKTKAPSTAPTSKTIRDDNEFPTLETGATRKHYHLFAQPIKNKSKAESTEKTFKSDKADDESFELPDSYYSSYSSLKQTPVENENKKDSNLIAQVSPPPTLNDFPGLPARSLPAKTSSNSAQETNASLNDIALAFVSKTSGNKAPKPTDWFDNPPIVVESSTPKADPLIENKSKNIANDSADSREKTFKSHMESSSNSKIISGSAEPSASFPSADNDNFPSLHTMSTSVQPPKPPPGFSGAQTHISKVSSSNTLSAPPGFKPAPCPPPGSYTYIQPSGFKERNLKLIQDIQQALSGTDAFANFKALSGQFRQGVMEASDYYLSCLALMGDNFEFIFPELLALLPDITKQQELWDVHCAKVNSVKPSEELKNARLSLCQVCGQALLNKDSLEHHRQHNNFSDFPTLGASMSNLNK. 917
165 0.000e+00gi|585675949|ref|XP_006818870.1| PREDICTED: zinc finger protein 598-like [Saccoglossus kowalevskii]  clstr ali  26  1....................................MSKTTDNIESTCVLCCQNVKFYAVGHCDHPVCYKCSTRMRVLSNQKYCAVCRTDLDEVLFEEKPLKFASIS--YQNFPVDRKYQIFFQNSKVKIAFQKLLEHQCKICKIKTIKTFKDLKDHMRKCHELFYCDLCVSNLQSFSSERRYYNRSELARHRRIGDPEDKSHKGHPLCEFCDERYLDNDELLKHLRREHFFCHFCDVVGSHQYYSDYSILRDHFRESHFLCEEGTCKDEQFTSAFQTEIDLKAHAAVRHSSKMSKAEAKQARHLDVEFNYTPRNAGYSRRHXXXXXXXXXXEDIESEMDHQTSLAMAASWSDASSNQAAVVDNSQRKKTTSSQTTSHQSNTEHPGRKKTANSDVPSLKSADDPAPRKKTPVSSRRADVTERKTGHSVAESSGREKVKKTPXXXXXXXXXXXXXSASVTSKESTPKVPDVKSSVEYPDMNKSPKVMKSNKLTSDNKKEAVAVSPSLAKKVAAANHMSVQNGSLQEEEFPTLGGSAQGKTNTRQTSWTNHRMREEDFPPVNVSNPXXXXXXXXXXXXXKASEHGNKKAEPKVKAPKQAKSLVSTSSVDDFPSLSSIAFSLTTEKHKQRKVTNPPPGFSSASKKSATSSPLVSAASPAHRSSPVESSTVKKPTAPPPGLQKIQIMEKSMKSRAPPGFGSISATPVVSTNPVMRTTNVENIAPNSVSYTQPDNFQQRNQKLIMAIKNGLQHDTKFEEFKTMSGQFRQGLIQATDYYTKCQNLLGYDFSKVFSELVALLPDNIKQQQLLAAHNDFKVRETAKSQKKKKSWLTCPACKQVLSTADFNSHVASHDLDSDFPALSSTTVSMPPS 919
166 0.000e+00gi|930667143|gb|KPJ08231.1| Zinc finger protein 598 [Papilio machaon]  clstr ali  32  1....................................MAETQTNDNTTCVVCFKNVLYYSIGECDHPVCFECSTRMRVLCLQNECPICRQDLSRVVFTETIQPYKELRKVFSDRLFERQFKIGFCTEEIKKEYEKLLEHRCKTCEKPPFHTFTMLSDHMRRVHERYYCDLCVKHLKIFTSERRCYTRQELAHHRRKGDIDDTSHRGHPLCEFCEERFMDADELYRHLRKEHLYCHLCDADGKNLYYSSHSALAHHFRTDHYLCEEGDCAGEHLTAVFRSEIDLKAHKATVHGKGMPRGAARQARTLELQFNITPHSVVQR-------APRERAEPQPAASPPAPEPRTRPAPDTRSNEQFPQLSTASPATNL-----ILAPSRAYKGAEGLTRNDKNFPALDGSGXXXXXXXXXXX----XQAPVAATILRNSKPSVSIQVHSQPASASNFRLTQANTNRISIPAKKKPSDDDFPSLGPNMPRDDHPSIGQAFKSKPTNHQTKKTNHKTMEAFPALTSTTAPSAPPQWINVSKGNNKPKPRAEPAPTPARAPAFNDFPTLPVNMTKSKVIKSQPQPKPTTITTKVINTENTKSKKEKKNNPKKENLFDTNHFNGLCENNNTEMAYITPSVNSNNQSSETDRKIKTITDTPAAAGNKNRNNFTLTQKEYPPLTTNNDNHMPERQWKPVKTTQNGVTNQKRPTVKCDGMTFTNSAGQVFPAPV--HTYIPPPDFEYRNQALVKKFAAALGDIAAVENFKAASRAFRDSTISADDFYQSCQAALGSKLENVFPDLVALLPDIAKQQELV------------IGRDISALLEVCTTCGQLVVPDDRIAHDTAH................... 822
167 0.000e+00gi|321463986|gb|EFX74997.1| hypothetical protein DAPPUDRAFT_323704 [Daphnia pulex]  clstr ali  30  19..............................................CCPVCFKDVEIFSIGTCDHPICHECSTRMRVLCKEDACPICRQELTKVYFVKKA-------KPYQLYPMDKITKIHFESASLQDVFEKLLVHICYSCPKPTFQNLQILKDHLRKEHELFFCDLCVENLKIFSQERRAYTRQELALHRRKGDPDNTSHRGHPLCNFCDQRYVDADELFRHLRRDHYFCHFCDADGLNHYYCNYEDLRKHFHDAHFLCEEGECKDEKFTCVFRTEIDIRAHKAQTHSQSLGKAAIKQARTLELEFTLAPRSGENKGRNGRRVGPRASDKKDSNNVGEQQTSRPVASADIGNPEEFPSLSTGSGSVMKSRTNGSDSLAQKLAKSNRFTVKNDEFPSLVAEGLAIDHQDILMPGDKKSSGANRSVREDFLTEGTPIARVSRVSTSQNIHVQPSRDLRLENFPSLSLTSPQLPEQQPLKPGKKYPPKPVNVSSVKSVSHSRNPPSTVEEYPLLVPSSLHDPGDANVWITSKDKVNNGVTVPCTVPSTESSSKNPKERCKKKKNPPI--ATIKNQVEALVFSGETKKKVSQIQVGELNRHPIEVPRASRTGRTKFDMSDGLMETNTCIASKVNIIAPQINSKTIENNGARPKIKDKPINLNSSEFPALGNSSPVTSFFDSSHDGSPLTRVEKVVPTKIALPSSSVQNVPLTLNNN-----SSRAFLQPPDFSVRNQQLIATVMDLLCNQKKIEKFRTISTQFRSGSLDAKEYYTNCLEVMGEDFSALFPELICLLPDISKQQQLLRVHRSEIRVKG--GIVSTEPYVICATCGQVLSPSDLKHHLANHSLETHFPSLGTAQDDITWN 850
168 0.000e+00gi|47210852|emb|CAF89718.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  27  6........................................SKETEKICVLCCQEVEVFAVGKCDHPVCYRCSTKMRVLCDQKYCAVCREELDKVVFVEKLQPFSCL--PARQFRCEKKYDIYFSDEKIYAKYR-----------------FEELEQHMRKQHEVFSCKLCTNHLKVFCHERKWYNRKELAQHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYRDYQYLTEHFRERHYLCEEGHCATEQFTHAFRTEIDYKAHKAAFHSK--NRAEARQNRHIDLQFNYAPRQQRRNEDEMRLASGLVSGGDYEEVRQGGRPHMRQKSWRYSRQEEDRAVAAAMRASMAMQRQEEKGAAPERAPPKHHREERESGEPDEPHSSHRNRNPKPANKPQAAAASAPLKEDEFPRLSKAPMALALN-----------SAYSTQAKKKSSFQEEDFPALVTKVQPLKPAACSRSAWSKNAPLNNPSPQAPSSSNAAPPFSSXXXXXXXAPPSPLSSDEEGKGLTQQEVRSVPTMLDISSLLTVKGETRNSATTSSPPNQSPSLDPPFTSXXXXXXXXXXXXTQNPISVETQKENVPEKPWNKLLFNAATEPVTNGVDCCPPVKSSSPPLEAVETSQPTSEPQLIQEEDDFPKNPPPGFKSSFPTKATNLPTPPPGLGVKATKPPPGFTGIPLNSNIVEPAPTPSYSDYSVPENFQERNLALILSIRKFLNNEEKFNEFKNYSSQFRRGAISATQYHHSCKELLGDNFNLIFNELLVLLPDISKQQELLTAHRDFKATEKKPSAAAELDCQVCPTCTQVLAPKDFNSHKSLHNRDEEFPSLQSISRI.... 872
169 0.000e+00gi|957821721|ref|XP_014681187.1| PREDICTED: zinc finger protein 598-like [Priapulus caudatus]  clstr ali  27  10..........................................ESDISCNICCKDISIYSFGECNHAVCCECSTRMRVLCQENYCPVCRSNLAKVVFAVSVRPF---EKVDVRHLQDRKYGVYFSDDGVAQAFRDLLSHRCHVCDRRPERSFAALRDHMRREHDLFYCDICVEHLKMFSHERKAYTRKQLAMHRRCGDADDLSYKGHPLCEFCDERYLDNDELYRHLRREHYFCHFCDADGHYKYYSDYTVLREHFRAEHHLCEEGDCIDEKFTSAFRSDIDLRAHRMGHHSKNMTKAEARQARTLELEFTFTRNRPN-----GRDFEEVSRAESRGRGGQRSRNAYRGRSSDTRSDRYANRQENYRPSDRAKETEDIELALAASISDQKNVPKHDDFPALGGEAAAPPKKQAVETIAKRLAKVNKYTVKEDDDPDFPALXXXXXXXXXXXXXXXXLASLADWITTTSSTNSSRAPKEAAFPLAPWQLAPRKFSADEFPALGGAASSTHNGXXXXXXXXXXXXXXXXXXXXXXXRGKPPASNAAVRGKPPKVGWQTKQHSLDMKAEDFPPAVAPQHNNNTKVRRMSADHGADHASAAVPPGSAGLVRKNRPPGLKLRLSTSQENLAGDDADSRPSIASQDDFPKLPPAAARPRFARSISVQLSPTSENFPAMITITTPPAATTKRDAPPGFARSRPAMPAPPGFGGTVTITSTPASCGGGGGAHAYAQPPAYAARNHALIASVRAALDGDAAFDAFKTMSGGFRRGAVPAHEYYAQCVALFGAHFRDIVPELLVLLPNIARQQELLAAHNRHLSAQGRAPNVSRARFAICSTCRQVLADRDVTMHQSSHSLDADFPALS......... 855
170 0.000e+00gi|357625884|gb|EHJ76173.1| hypothetical protein KGM_07916 [Danaus plexippus]  clstr ali  35  11..............................................TCVVCFKTVVYFSIGECDHPVCFECSTRMRVLCLQNECPICRQDLSRVVFTDKIQPYKELRNQEFPDLFERQFKIGFCSEQIKKAYEKLLENSCSICDKTPFRTFSMLSDHMRKVHERHYCDLCVKHLKIFTCERKCYTRQELAHHRRKGDLDDTSHRGHPLCEFCEERFMDADELYRHLRKEHLYCHLCDADGRNLYYASHAALAHHFRTEHYLCEEGECAGQHLTAVFRSEIDLKAHRATVHGRGLARGAARQARTLELQFNITPHPVVRSTR----------DRTEXXXXXXXXXXXXXVTIDPRSDEQFPRLSXXXXXXXX-----XXXXXRSLRGSEGLARTERNFPALDGSRAAPAPTSAQASRPAAPVAAAVRNCEFGSHTIQLHSQPSASNFRLTQTSGNRISIPPQKKQQNHLSDEDFPSLGHPRDDHPSIGAGTIQPSKSQPKKFQSKSSSEAFPALSSSSVPATPPQWITVSKTKEKSKPKAEAPAKPRNPVFNPVADFPTLPINTNA-KTKPKKTQPPPQPQTINTSQXXXXXXXXXXXXXXXXXAKKDVKIDYDLVNGVDEVDIKKEYIVASVNANNNSGDSDRKVKTIATDT--TTNSTKNSSSDNFKLAPKEYPPLNPKAAETPRPVQNGSVPPGFKKRPPCDGMTFTNSSGQTFPAP--LHTYIPPPDFEQRNRALVKKFAVALGGAAAVENFKVASRAFRDSVLSADDFYQHCKSALGPQLDSVFPDLVALLPDIAKQQELV------------IGRDISSKLEVCSTCGQLLSPVDRIAHDSAH................... 800
171 0.000e+00gi|755805055|ref|XP_011289075.1| PREDICTED: zinc finger protein 598 [Felis catus]  clstr ali  25  126............................................................................................QVVFGKKLPAFATI--PLHQLQHEKKYDIYFADGKVFALYRQLLQHECPQCELPPFGLFGDLEQHMRRQHELFCCKLCLRHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGTPPPVSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHSRRNEGVVGGEDYEEVDRYNRQGRAGRASQSRRGSWRYKREEEDREVAAAIRASVAAXXXXXXXXXXXXXXXXXXTRRSEDREEGGRPKKEEAGVRGLEEQRGARRPPRTQGEGPGPKEASANGPISQESSTLPPPTSKLKDYHVPARGRSTFQEDDFPALVSSASKPSSAPTSLISAWNSSGSKKVAHPTTGAQAAGGSSQPPRKAXXXXXXXXXXXXXXSEEEEEDGRAGLTAQELRSVPTTVAVSSKKKKVGSEKPGAASXXXXXXXXXXXXXAERAPGAPTGRAEGPVAVIVNGHTEGPAPARSTPKEXXXXXXXXXXXXCPTAQEDFPALGVPCPPRMPPPPGFNAVVLLKGXXXXXXXXXXXSKPPPGFSGLLPSPHPACVPSTATAT----KAPRLTPAPQAYLVPENFRERNLQLIQSIRDFLQSDEAFSKFKSQSGEFRQGVISAAQYYKSCRDLLGENFQKIFNELLVLLPDTAKQQELLSAHTHFRGRERPPGTKAKKDCCVCPTCQQVLAHGDVSSHQALHAADNDFPSLQAIARILT.. 977
172 0.000e+00gi|936714611|ref|XP_014235247.1| PREDICTED: zinc finger protein 598 [Trichogramma pretiosum]  clstr ali  32  11...........................................NSNTCVVCYKDGEYFSIGLCEHAVCFECSTRMRVLCEQNECPICRQDLPKVVFTKEIKPYRLLKKG---PLVDAKYNIHFECPEIQRKFQKLLSHNCYICNKKEFNSFESLKEHMKKKHDLYYCDLCAENVKIFPHERRCYNQSDLKHHMSKGDLDDKSHKGHPLCKFCVKRYMDNDDLFRHLRREHLFCHFCDADGLHQYYQSYNDLRSHYKSKHYLCEEAGCIDEEFTSVFRSEIDLKAHKANVHAKGLSKAAAKQARTLELEFNYGQLRSDTRTRRQNGNRFDNSSNRHQEPVEEEPATPTQIQPDVQSTAEFPSLGGAS-APTLLSGPVRSKGGLNLRSKLKPGNYDLNFPTLGXXXXXXXXXXXXXXXXXNSRTSITSAPVNGLKKTFNMSVNTNTSGKVMGAIANQRPKETVKPTTKGPSRPPIPTIVPKPSSSRESRDVDFPALGGTXXXXXXXXXXXXQSTQSWTKVTCSKQYPVQKKVQTQXXXXXXXXXKSSNDFPSLSKTNTRQPIPGWVQAPDSDSTKGXXXXXXXXXXXXXISYSTLASGSKNNXXXXXXXXXXENIKVNNTNDSSCFGANTSAHPVTEKQQQITKSKNNSQENKPPNKISQDDFPSLTNIRNAPSGPPPGFTTQSISSAPPGFNSKPNGFTKNLDDRLSIDDLLLTKAPA------DYINPQNFQERNRQL---IKELSIHGQDFEDFKYISALFRNNQCLAADYYKKCRSVMNDSFDNIFSELLALLPDINKQRELYMAYI------LENNGKGIKGLTMCPSCGQILCNRDLHAHMSSHNLDDNFPCLGMTMKKL... 824
173 0.000e+00gi|939233422|ref|XP_014240202.1| PREDICTED: zinc finger protein 598 isoform X1 [Cimex lectularius]  clstr ali  31  3................................KRKQSSAKEENGENACVICFKKVDIYSLGQCDHPVCFECSTRMRVLCRQNECPICRQDLPKVVFTCTIKPFEQIQQNNC--QFDDKYKITFQSKEIKTAFEDLLKHECPECGK-IWANFNELRDHVRRVHQLTYCDLCVDNLKILTSERRCYTRKELAEHRRHGDPNDRSHRGHPLCKFCETRYMDNDELYRHVRRDHLYCHFCDADGIHQYYKTYDSLREHFRAEHFLCEEGECYLEKFTSVFRTEIDLKAHKANEHGKALGKAGIKQARKIDIEFSLSSRPRAYVRRNYRGEGGHSSTHQEEEEVEIQPTPTPQRQPNTNCQQEFPTLGGSPAAPPLSHKVTATVRSLRPTGY-------EEFPALP-----------------SSATSEPTVSLRVDSTDRPTPSSTNFSIQVNHPRFTTTLTASKANTNEHTYNYHFPALDLGSGSPGPSSAPQTGQTKSQESTWTTTNKKEGVSKSHVVSLPHNAYNAKPANKNPPNLDDFPALAPKKKQPKTLTKSIASNTAPSSDSDHPQPXXXXXXXXXXXTQGSTNVAGTNVKKKQAACVLEKNTPGEPETLTKTSNKENECEPKENIEEMEKSDQQKHAKPKSNAEMAKKSGKEKLDEAFPALAGTETSKAPPGFEVNWAPKRPPPGLAPPSQQVVAPPPGFTAMNGASFPPLGGDNLGLGEYIPPLNFEKRNNALVDKVANALGSD-SWVQFKDISMAYRSGIVSPDDYYKHCRLSMTEKFAQLFPELLALLPDINKQEQLWTLYSMDNEADKSKLKK-------CAVCRQVVRSGDFSEHYSRHSLDNHFPPLQKQTKQNRPN 811
174 0.000e+00gi|913300617|ref|XP_013199692.1| PREDICTED: zinc finger protein 598 [Amyelois transitella]  clstr ali  32  1....................................MADTQGNDNSTCVVCFKNVLYYSIGECDHPVCFECSTRMRVLCLQNECPICRQDLARVIFTETVLPYKELRKVFNDRLFERQFKIGFCTQEIKNAYDKLLENHCKLCDKPPFRTFAMLSEHMRKVHERFFCDLCVKHLKIFTSERKCYTRQELGHHRRKGDLDDTSHRGHPLCEFCEERFMDADELYRHLRKEHLYCHLCDADGRNFYYATHGALAQHFRNDHYLCEEGECADQHLTSVFRSEIDLKAHKATVHGRGMNRGAARQARTLELQFNITPHPVAHR---------APRNNEQRQEPPSPTPAVSSPHIDPHSDAQFPRLSAAQPAPSLMLGGP----VKHYKAADALTRNERNFPALGPEAAG-----SSARPPRAASQPVAAAVLRNSKPSVSIQLHSQPASASNFRLTQTSGNRISIPKKTPLSDDDFPSLGGTVQPPKVAMINSQEMNAIKKNQHSSQSKKPQLSGEAFPALSGSGAPAAPPKPSKPAKTKDKPAPEPPRAPTFNPVADFPTLPVNSKTINNTKPKKAPANPAPTIQSDPKTSXXXXXXXXXXXXENVNEFAHVNGAIDKKIAREMSYVGISVNNNSTIEPQKKVKTIETTVSEGNRNGH-GDFSLAARDYPPLSARVTSKEPEWPCKKEKVSNGNVPPGFKARPACDGLMFTNSSGQTFSAPV--HAYIPPLDFEQRNRALVKKFAVALGGAAAVEDFKVASRAYRDSIINADEFYQHCKTALGPQLDSVFPELVALLPDIAKQQELV------------VGRDMGSKLDTCATCGQLLVPSDKIAHDSAH................... 799
175 0.000e+00gi|1007718896|ref|XP_015800935.1| PREDICTED: zinc finger protein 598 [Nothobranchius furzeri]  clstr ali  26  1....................................MSSATAKDSETCVLCCQDIDIFALGKCDHPVCYRCSTKMRVLCDQKYCAVCREELDKVVFVKKLEAFQSL--HYQRFPCERKHDIYFADETIHSQYRRLLLSECPFCEPKVFSRFEELEQHMRKQHELFCCKLCLKHLKIFSFERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCSSEQFTHAFRTEIDYKAHKAAAHSK--SRAEARQNRQIDLQFNYAPRQQRRNDGHVTGERHSRGGRGRPQMGQKSWRYSREREEEDRQMEAALRASMAMRRLEERAAVQERSTPKHIREERMERVEAEEPRPLTGHIKAASKPPVKTLKSTNPGEEDDFPVLGATAGTSMVKSAPVASSSAAVSAPMTPAYTGQPKKTSSFQEEDFPALVSKVRPFKPASGTNSAWSNHTTTAKPNPHPSSASSGPQPLSSSNLSSSRKKKKVGVNGKTAYPSASLSDDESGGMTRQEFRSVPTMLEISSLLTVKGGSSKPPNATSASPNPPPPSSPASTMSAVTPAGNTISVETAAQKENVPERTWGKPLSNAVPAPLSNGIGSIKADTPPPVCRDSPAVTPPPRAEPAPEAEEEFPALITKKPPPGFKTSFPVKXKPPPGFTGIPLNSNVVEPVASEPPKVLNSGYLVPEDFQHRNLELIQSIKKYLDNDEKFNQFKNYSARFRQSLMSAAQYHRHCKDLLGDDFSRIFNELLVLLPDTGKQQELLTAHGDFKALEKQSGAGGGRDCQVCPTCRQVLAPKDFSSHKTLHIRENDFPSLQ......... 912
176 0.000e+00gi|640782517|ref|XP_008046901.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 598 [Tarsius syrichta]  clstr ali  25  63................................................................HRTCSGLVM----------CQQC----LGVVFGKRLPAFATI--PVHQLQHEKKYDIYFMDGKVYTLYRQLLQHECPRCELPPFSLFGDLEQHMRKQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRMACHSR--SRAEARQNRQIDLQFSYAPRHSHRNEEDYEEVDRYSXXXXXXXXXXXXXXXSRRGSWRYKREEEDRAVAAAIRASMATPAWTLGEGPGPKETSPDSPVSQEAFPATGPAMANQLCLP-----APSTLPPPSPKLKDEDFPSLSACTSSSCSTAALGPVGLALVYSIPTRGRNAFQEEDFPALVSSASKPSTAPTSLISAWNSSCSPTLAAQAAGGGGQPTRKAGKGNRGGKKGGPPPVEEEEGGLAAHELRRTRATVSVSSSTQTSKVGKKKKVGSEKPSVAXXXXXXXXXXXXXHGIEQVPEAPASKAEGPVAVIINGHAEGAAPARSAPKEPPGLPRPLGPLSCPTPQEDFPALXXXXXXXXXXXXXFNTVVLQKGMXXXXXXXXXXXVSKPPPGFSGLLPSPHPACVPSPATTTKVXVPRLPAIPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSKFKSHSGEFRQGMISAAQYYKSCRDLLGEKFQKIFNELLVLLPDTVKQQELLSAHMNFCSREKPPSTKSKKDCCVCPTCQQVLAHGDVSSHQALHTADDDFPSLQAIARIIT.. 910
177 0.000e+00gi|512887500|ref|XP_004921935.1| PREDICTED: zinc finger protein 598 isoform X1 [Bombyx mori]  clstr ali  33  7...........................................NENTCVVCFKNVLYYSIGECDHPVCFECSTRMRVLCLQNECPICRKDLLRVVFTDSIHPYKEGNREYPDRLFERQYKIVFCSEDIKNAYENLLENRCKICDKPPFRNFSLLNDHMRRVHERFFCDLCVNHLKIFTNERRCYTRQELAHHRRKGDLDDTSHRGHPLCEFCEKRFMDPDELYRHLRKEHLYCHLCDADGKNFYYASHSALAQHFRKDHYLCEEGECAGQHLTAVFRSEIDLKAHIATTHGRGMPRGAARQARTLELQFNITPHPVVTQ-------RTPRDRGAXXXXXXXXXXXXXXXRLDTHSDQDFPRLSAAPPAQNLVLGAP----LRNFTGGDRLTRNDKNFPALDG------AGPSXXXXXXXXXXTVAATILRNSKPSVSIQLHSQPASASNFRLTQTSGNRISIPPQQKKPDDDFPSLSMGRDDHPNIGASSVQPPKVTMSQPKKSQRSTEAFPALSATAHSPAAPPQWITVSKGKDKPRARAEPAPPPPAFNQVADFPTLPLNKSKSKPKNVIVIPQATPRPQPQHQQQPAEAKLTXXXXXXXXXXXXXIAEIPLVNGLDKKYAKDPSFTEVNSNVERSVERDKKETTSSVTVNSDRNTGNGDFALAPTEYPPPPLQTRAENVAFNRRVTNGSVPPGFKPRPACNGMTFTNSAGQTFSAPV--HKYIPPPEFESRNRVLVKKFAVALGGAEAVESFKVASRAFRDSIISADEFYEHCRSALGSQLESVFPELVALLPDIGKQQELV-------------VGKNVSELEVCATCGQLLSPGDRIAHDTAH................... 818
178 0.000e+00gi|657802598|ref|XP_008328367.1| PREDICTED: zinc finger protein 598 [Cynoglossus semilaevis]  clstr ali  26  12..............................................HCVLCCQEVEIFAVGKCDHPVCYRCSTKMRVLCEQKYCAVCRVELDKVIFLKKVDAFASLS--FLHFPCEKQHGIYFGNEMIYAKYRHLLLSECIHCEPKVFSRFEELEQHMRKQHELFCCKLCTKHLKIFSYERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCASEQFTHAFRTEIDYKAHKAAAHSK--NRAEARQNRQIDLQFNYAPRQQRRNEGKSWRYSREEEDRQMEAAMRASMAVRRQEERAMMQERNVFREERKERPEQEEPRHKSGPIKATSKPPSSNLREEEDFPALGAAAPTPTYPIVKSAPALMPVTPAALKEDDFPSLSTVSVAAPMTPA-----------YSAQPKKSSSFQEEDFPALVSKVRRPKPAAGTASAWSNNTAHNKPTVQLPPPSSRATPPXXXXXXXRKKKKVGENGKAAPPHSPPTSDDESKGMTQQEFRSVPTMLDISSLLTVKGGNTKPSSVTPSSSNPAPNSDVSTSKASXXXXXXXXXXXXXSAPVSSPPTPMNKETTSVASHPNIDQLLEQEEEFPALITKKPPPGFKSSFPLKASAAAXXXXXXXXXXXXXGLGVSGPKPPPGFTGIPINSNVVETAPPPVNQPPKVPSTGYLVPENFQQRNLELIQSIRKYLHNDEKFNQFKNYSAQFRQGVISAAQYHRSCKDLLGDNFNRIFTELLVLLPDTGKQQELLSAHGDCRAMEKQSGTXAELECQVCPTCRQVLAPKDFNSHKTLHLGEEEFPSLQSISRII... 936
179 0.000e+00gi|719752766|ref|XP_010213560.1| PREDICTED: zinc finger protein 598 [Tinamus guttatus]  clstr ali  27  123..................................................................................................................HEKKYDIYFTDGNVYALYRKLLQHECSVCDARPFSTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSSEQFTHAFRTEIDYKAHKTACHSK--SRAEARQNRHIDLQFSLAPRHQRRSDGVIGGEDYEEVDRFNRQGRSGRLSSRRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRVEDKDDSSISRAKKEELRDLEVPSSKRVPKSSNAAANGALCQDDFPAIGAAVGPLQGSAQLAPVSSSAAPISSGMSLTYIASAKKTAFQEEDFPALVSKMRPNKTVTSITSAWNNGSSKSVSSPSANQIAKKPPSLNSSKGSKKSNKLSLSDDEDGGSGLTTQEIRNTPTMTFTKVSKKKKMGAEKQRPSSPQLLQDTSFPKAPAEKLPGAEQTANASSALHGPDRSAAVVNGHSEKSLATCSTPKEPPGLKKPTVTNPCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKSPPPPPGLSVPVSKPPPGF---------AVIPSTNVPEPVTTSLKEPKSCHGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRDLLGDNFKKIFNELLVLLPDTDKQQELLSAHNDFKIKEKQSSSSSDLDCCICPTCKQVLTQQDVVTHKALHIEDEEFPSLQAISRII... 913
180 0.000e+00gi|831552076|ref|XP_012728572.1| PREDICTED: zinc finger protein 598 isoform X1 [Fundulus heteroclitus]  clstr ali  28  49....................................DPTTAKESEKTCVLCCQDIDIFALGKCDHPVCYRCSTKMRVLCDQKYCAVCREELDKVVFVKKLKTFQAL--PYQQFPCEKRYDIYFVDEMTHSQYRRLLLSECVRCEPKVFSRYEELEQHMRKQHELFCCKLCSKHLKIFSYERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCATEQFTHAFRSEIDYKAHKAAAHSK--SRAEARQNRHIDLQFNYAPRQQRRNEGMVSGEDYEETRHNRGGRGRPQMAAQRQSERAAQRQSERAAQRQSERAAQRQSERAAAAQERSALKNCREERTEAEEPRQLAGQLKAVNKPPVKTMKSSNPRDEDDFPALGATAVAPIVKPGPPAPSAAVSSPMTPAYSGQPRKTSSFHEEDFPALVPKSGGSAWSNSTAAAKPNPQMPPSSRVPPPHSAAPSGPQLLAXXXXXXXXXXXVGEKGKVAASRSPCLSDGGGMTQQEFRSVPTMLDISSLLTVKPAVTSSSANPAPSADLPSSKASKKKKQRNADAPVASAPAAPGMAAPANAISVETAAQKENVPEKTWSKSLSTRDSPRGTXXXXXXXXXXXXXXFPALMTKKPPPGFKSSFPVKXXXXXSSAPKPPPGFTGIPLNSNVVEPAVSLPPKMPTNGYLVPDDFQQRNLELIKSIKKHLHNDEKFNQFKNYSAQFRQGVISAAQYHRSCKDLLGDNFNSIFNELLVLLPDTGKQQELLSAHADCKALEKQSGAGAGGDCQVCPTCRQVLAPKDFNSHKTLHITEEEFPSLQSISRII... 1005
181 0.000e+00gi|646705101|gb|KDR12980.1| hypothetical protein L798_13186 [Zootermopsis nevadensis]  clstr ali  35  7........................................TENSENACVVCFKNVVIYSVGECDHPVCYECSTRMRVLCRQNECPICRQDMPKVIFTKEVQ-LFRNIKNYS-YLMDKKFKICFDTADIQAAYSRLLEHVCSVCGRPAFRTFQNLKDHMRKEHELQYCDLCVENLKIFTGERRCYTRQELALHRRKGDPDDRSHRGHPLCEFCDQRYMDSDELFRHLRRDHLFCHFCDADGFHQYYSSYDYLREHFRSEHFLCEEGNCMEEKFTSVFRTEIDLKAHRASVHGRSIGKAATKQARMLELEFTLAPRPRDRMRHDEEEPQGAVGGDCDNQHFDPAPMFRNAPNINTSCIEEFPTLGGEAPNSRKVPANNSGLTIRTVHQSQPLAITDENFPALGLEGSTGGCKTVRLSVNSGSQDRPNSAAASSISKVSTASSSVQWLGNHGSMGAKTKVQPQTQAPRAFKTEEDFPSLSSKFSTGCNVANTTSSSDAGSDDRFKKASSVMIPVTSSWTMTQGSSDVSRIHESSGEPSGIPGRSNYDILANTTSSLGNIKVKSRKKKTKNAVSHNANMYSNDSVLTKPAQSAVSESGKRKKKQGNREAEVQQNTQTNKNDCENRENEKPAEFGNGTDNSSTFERKRSEHAIGSPGCWPPGLDVPVNRGKLSSAPPPGFGGTTNSCSTTAPPPGFSVTLNSVARPQSNGLTFTSSSGQSYSILPGSYKFVPPQDFSHRNQALVTRVKKMLGDAQSVDEFCQLSKMFRQGDISASDFYTHCQEKMGMKFTEIFAELLVLLPDIEKQQELWSVHAD-------TGKWSAKDLEVCATCQQVLSAADLRHHVGSHTLENHFPALGSSEPVSQ.. 941
182 0.000e+00gi|612041460|ref|XP_007499984.1| PREDICTED: zinc finger protein 598 [Monodelphis domestica]  clstr ali  26  86.........................................................................................ELRQVVFGKKLPAFAAI--PVHQLQYEKKYDIYFADGKVYALYRKLLQHECPLCEQRPFSLFVDLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCNTEQFTHAFRTEIDYKAHKTSCHSK--SRAEARQNRQIDLQFSYVPRHTRRSEGVVGGEDYEEVDRHNRQSRASRPAQQQNRRGSWREEEDRDXXXXXXXXXXXXXQEEKKWVEDKEDGSRVKKEEGKDFEET-RGSKRAPRPSAEAPAPKEATANGPASQEDFVSFSSAAGGAVQSSLHPASVKLKEEDFPSTAKKTSAFQEEDFPALVSKMRPSKAVSSISSAWSNSSTKSVVRPVAPVQASSSQLTKKPSLITKGSGKAGKKNNKALISDDEDDSIGLTTQEIRNAPTMKKTGAEKQSSASPPPQPEVTTKSAWREKAPSPEHGTASVATANGSERPTAIVNGHSEKTAHVGSVPKEPPGLTKPPVTNQCPLPQEDFPALCSVGPPRMQPPPGFNSVVLLKXXXXXXXXXXXXXKPPPGFTV---------IPPNSISEPITTSIKEQGPCQGTYLIPENFQQRNIQLIQSIKEFLQSDERFNKFKSHSGQFRQGLISAAQYYKSCRELLGENFRKIFSELLVLLPDTAKQQELLSAHNDFRVQEKQGGPKSRKDCCICPICQQVLTQDDLGTHRALHIDDEEFPSLQAISRII... 906
183 0.000e+00gi|471365818|ref|XP_004373449.1| PREDICTED: zinc finger protein 598 [Trichechus manatus latirostris]  clstr ali  25  46.....................................................................................VCPKVSRAVVFGKKLPAFATI--PIHQLQHEKKYDIYFADKKVFALYRQLLQHECPQCSAPSFSLFGDLEQHMRRQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMLGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFNYTPRHPRRQSRRGSWRYKREEEDRDVAAAVRASVAMQQQEEKHRSEDREEGSRAKEEAAARVSEEPRGARRSPRTQAEGPGPKEASTNGLVSQEAFPASTPAAGLPPPRATLPPEPKLKDEDFPSLS----SCPTPAVPGPAGLALTYPVPARGRGTFQEEDFPALVSSTSRLGAAPTSIVSAWNSSKKVTRASLGVPAAGGGQSTRKAGKGSGQGGRKEEEETVSQELRXXXXXXXXXXQPVAKGSRKKKMGSEKPGATSPPSLDHTPKAP---DKDGPPGAEQVPTALGRAEGPAAAIVNGHVEGPALAHSAPEEXXXXXXXXXXXXXXTPQEDFPALXXXXXXXXXXXXXFNTVVLLKGA--XXXXXXXXGLATTVSKPPPGFSSFLPSPQPACVPNTTTKAPRLTPPPRAYLVPENFRERNLKLIQSIKDFLQSDEAFSKFKSRSGEFRQGVISAAQYYKTCWELLGESFQKIFSELLVLLPDTVKQQELLLAHTDFCSHEKPPGQTTGLDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARVIT.. 868
184 0.000e+00gi|734601078|ref|XP_010727423.1| PREDICTED: zinc finger protein 598 [Larimichthys crocea]  clstr ali  27  2....................................DSTTTKEAEKHCVLCCQEVDIFALGKCDHPVCYRCSTKMRVLCDQKYCAVCRVELDKVVFVKKLEAF--LSLPYQQFPCEKKHDIYFSDEKIYAQYRHLLLPECLRCEPKVFSKFEELEYHMRKQHELFCCKLCTKHLKIFSHERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYPYLSEHFRESHYLCEEGRCATEQFTHAFRTEIDYKAHKAAAHSK--NRAEARQNRQIDLQFNYAPRQQRRNERGARPQGGQKSWRYSREEEDREMAAARRASLAMRRQEERGAVQEKSAPKHCXXXXXXXXXXXXXXHRTGNLKPTNKPPVRTMKSTNPEEDDFPALGATAATPIVKPVPAALTAPRATLKEDDFPSLSTVAVSSPMTPYSAQPKKTSSFQEEDFPALVSKIRPLKTTAGRNSAWSNHTAVAXXXXXXXXXXGPQPLXXXXXXXXRRKKKVGENGKAASNRSPPSSDDESGGLTQQEFRSVPTMLDISSLLTVKGGNSKAPTMTQKNTATPSTSVSSVSGMTQTVSAKSVETAAQKENVPEKTWNKPNSSVVTAATTTGLANGHPEKSPPTVTPHPNTDPPLEQEEEFPALMTKNPPPGFKSSFPIKVXXSATKPPPGFTGIPLNSNVVEPAPSPVNPPPKVSSSGYLVPDDFHQRNLELIQSIRKYLHNDEKFNEFKNYSAQFRQGVISAAQYHRSCKDLLGDDFNRIFNELLVLLPDTGKQQELLTAHGDCRAMEKQSNAAAELDCQVCPTCRQVLAPKDFNSHKTLHIRENEFPSLQSISRII... 922
185 0.000e+00gi|700381641|ref|XP_009930671.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 598 [Opisthocomus hoazin]  clstr ali  27  225..................................................................................................................HEKKYDIYFTDGDVYALYRKLLQHECSLCDVKPFSTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNEGVIGGEDYEEVDRYNRQGRSGRLGGRRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRVEDKEDGSGRGKKEDDSEALGSKRVPKSSNEAAEAAANGALSQDDFPAIXLAGPLQGPAQPSLSSSAAPTVSSGMSLTYTATAKKTTFQEEDFPALVSKMRPNNKTVTNITSAWNNGSSKNVVKAISNPAKKPSSLSSTKGSKKSVKLSQSDDEDGGSGLTTQEIRNTPTMTFMKVSKKKKMGAEKQRPSSPRPSQETSFARSSPEKLPEAEQTSNASSALPGPDRAAAVVNGHSEKSLAACSTPKEPPGLKKPAVTNKCPLPQEDFPALGSSGSGRMPPPPGFNTVVLLKSPPPPPGLSVPVSKPPPGF---------AVIPSTKISEPVTTSLKEPKSCHGSYLIPENFQRRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRELLGDNFKKIFNELLVLLPDTVKQQELLSAHNDFRIKEKQTDSGSDLDCYICPTCKQVLTQQDVLTHKALHIEDEEFPSLQAISRII... 1015
186 0.000e+00gi|115502933|sp|Q6PFK1.2|ZN598_DANRE RecName: Full=Zinc finger protein 598  clstr ali  27  24....................HKPSKSTRIKPTKPHHTPSNSMESESTCVLCCQDIDLFAVGKCDHPVCYRCSTKMRVLCEQKYCAVCREQLDKVVFLRKPEAFATLNIHH--YQCEKKYDIYFGDGKVHAQFRKILLNECPHCEPKVFSKFEELEQHMRKQHELFCCKLCLKHLKIFSYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGAQEYYSDYQYLSEHFRESHYLCEEGRCSTEQFTHAFRTEIDYKAHKAAAHSK--NRAEARQNRQIDIQFNYAPRQQRRNDVGGDDYEEVDRFNXXXXXXXXXXXXXXXNLRSWRYNREEEDREMAAAMRASMASHQEERSHAQERSMLKPRREEKLEPDETRNNRSTARPTNDTQARSMKSNPPAPVQSMIQKPSVSLKEDDFPSLSGSVVSSPMTPYTNQPRKHSSFQEEDFPALVSKIKPLKPQSSAASAWSQAGSKPVVAPNKPVPSASVPQPLTASSSRRKKMLTLTESHKDPPPSSSDDEDPHSGKTAQEIRTVPTMLDISTLLTVKGSSPQANPKASKKKKQTTASSLGSPSHTPKKPPETGLNKAPTAPKTNSIVNGVAEKPAEALSCTSFPENITSSKQPVTDQAPPSKESKKPPPGFKSAFPLRNSQSAXXXXXXXXXXXAVSKPPPGFTGVPLNSNVEDSSVSAVNRPTPAIGSYLIPDHFQQRNMDLIQSIKNFLQNDEKFNEFKNYSGQFRQGALPAVQYYKSCQELLGENFNRVFNELLVLLPDTRKQQELLTAHGDFKALEKQQQGSLDLDCQVCPTCKQVLALKDFNTHKTLHIGDDDFPSLQAISKII... 952
187 0.000e+00gi|852737779|ref|XP_012866703.1| PREDICTED: zinc finger protein 598, partial [Dipodomys ordii]  clstr ali  25  1...............................................................................RPHPCPFCSDRFPKVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCPQLPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYTYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSFAPRHSRRQQSRRGSWRYKREEEDREVAAAIRASVAAQQQEDPRRSEGREEGGRSKKEEATARAPEEPRGSRRLPRPQGEGPGPKETSANGPQEAFPAAGPSAVAGVPSALPLPTPKLKDEDFPSLCASASSCPAAGTPGTVGLALAYPGPARGRSTFQEEDFPALVXXXXXXXXXXXXLASAWNNSCSKKGAPPPPAVQAVGGGAHLPXXXXXXXXXXXXXAEERGGLAAPERXXXXXXXXXXXXXSTVKVGRKKKVGSEKLKAPSPPPLPPNRTPKPLGAEQAPEAPPGGTEGPPVGVVVNGHTEGMVAKSIPKEPPGLPRPVGPLPCSPRQDFPALXXXXXXXXXXXXXXFNTAVLLKGTLPPPGLVPPASKPPPGFSSLLPGSQTPCAPSPTTTAKAPR---LPPTTPQAYLVPENFRERNLQLIQSIKDFLQSDEAFSKFKSHSGEFRQGMVSAAQYYKSCRDLLGENFQKIFSELLVLLPDTAKQQELLCAHADFRSHEKPVGAKAKKDYCVCPTCQQVLAHGDVKNHQALHAADDDFPSLQAIARIIT.. 846
188 0.000e+00gi|831552080|ref|XP_012728574.1| PREDICTED: zinc finger protein 598 isoform X2 [Fundulus heteroclitus]  clstr ali  28  49....................................DPTTAKESEKTCVLCCQDIDIFALGKCDHPVCYRCSTKMRVLCDQKYCAVCREELDKVVFVKKLKTFQAL--PYQQFPCEKRYDIYFVDEMTHSQYRRLLLSECVRCEPKVFSRYEELEQHMRKQHELFCCKLCSKHLKIFSYERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCATEQFTHAFRSEIDYKAHKAAAHSK--SRAEARQNRHIDLQFNYAPRQQRRNEEDYEETRHNRGGRGRPQMGQKSWRYSREREEEDRQVEAALRASRAAGAAQRQSERAAAAQERSALKNCREERTEAEEPRQLAGQLKAVNKPPVKTMKSSNPRDEDDFPALGATAVAPIVKPGPPAPSAAVSSPMTPAYSGQPRKTSSFHEEDFPALVPKSGGSAWSNSTAAAKPNPQMPPSSRVPPPHSAAPSGPQLLAXXXXXXXXXXXVGEKGKVAASRSPCLSDGGGMTQQEFRSVPTMLDISSLLTVKPAVTSSSANPAPSADLPSSKASKKKKQRNADAPVASAPAAPGMAAPANAISVETAAQKENVPEKTWSKSLSTRDSPRGTXXXXXXXXXXXXXXFPALMTKKPPPGFKSSFPVKXXXXXSSAPKPPPGFTGIPLNSNVVEPAVSLPPKMPTNGYLVPDDFQQRNLELIKSIKKHLHNDEKFNQFKNYSAQFRQGVISAAQYHRSCKDLLGDNFNSIFNELLVLLPDTGKQQELLSAHADCKALEKQSGAGAGGDCQVCPTCRQVLAPKDFNSHKTLHITEEEFPSLQSISRII... 981
189 0.000e+00gi|665786398|ref|XP_008552183.1| PREDICTED: zinc finger protein 598 [Microplitis demolitor]  clstr ali  33  20..............................................TCVVCYKNVEIYSIGMCEHPVCYECSTRMRVLCRQNECPICRQDLPKVVFTRQIKPFRHLRKG---KLFDERYNIYFDDLEIQEEFTKLLAHVCSYCGKEVFSSFNSLKDHMRRKHERHYCDLCVENLKIFSFERRCYSRADLAQHRRKGDRDDKSHKGHPLCEFCDCRYMDNDELFRHLRRDHLFCHFCDADGLHQYYSSYHYLREHFRQEHYLCEEGTCAAEQFTSVFRTDIDLKAHKATAHGKHLGKHAAKQARTLELEFAFAPRENRHGMGSSSRDTRDRDNQVDDNHVSFDDESPVARQPDVQSTQEFPSLGNSQTVIPNFNLMRGNLTIRSSLKGPALAVTDENFPALGLDAAXXXXXXXXXTVNLSVYSNKTSAGGVQQRPKSAAPNVSINHNTNGSITTRVSGPNIRIRPSNLSMDSKEFPALGRAEPTTANTTNIGQWTKVTSSARANKVAPAPLLNSNTPSPPPMSNCDAFPSLPKSARTKKQXXXXXXXXXXXXXXXXXXXXXXWXXXXXXQTDNESSAQLSNDKVIDNQFESFSLNNKNDSNNDSHKSDKKKLIKDTAIXXXXXXXXXXXXXXXXXXXXXTLKKTNDAPRKRSELQIENLNKTTNELHIADDFTEFDDNSTKGFKSNPPPGFGTTAPPPESENNDNGLTFTNSSGESYSILPDKSTYTPPPDFQKRNQDLVARITKVL-DQESIEEFRYISGLFRQDLCSAEDYYKHCSDSMGVKFGSVFSEMLVLLPDIQKQRQLYDVHKN--------EGGNIILLEICPTCDQVVKIGDAKAHYSNHSLDSHFPALGRGSGSP... 900
190 0.000e+00gi|733910990|ref|XP_010718113.1| PREDICTED: zinc finger protein 598 [Meleagris gallopavo]  clstr ali  28  81.......................................................................................RSRQTKVVFGRKLTSFSTIALNKL--QHEKKYDIYFMDGEVYALYRKLLQHECFLCDLKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYTRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNEGVIGGEDYEEVDRYNGRLGGRGSQQNRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRGEDKEDSSSRGKKEDLRSEVPSSKRVPKSSSEATEAAANGALSQDDFPAIGSAAGPLQGSAQLAAVKLKEDFSGMSLTYTATAKKTAFQEEDFPALVSKMRPNNKTVTNITSAWNSGSGKNVVKAISNPQIAKKSYSLNSTKGNKKSNKLSQSDDEDGSSGLTTQEIRNTPTMFDVSSLLAASTSQTFTKVSKKKRMGVEKQRPSSPHPEAERTSNAASALHASDRSAAVVNGHSEKSLAICSTPKEPPGLKKPTVMNQCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKNPPPPPGLSVPVSKPPPGF---------AVIPSTSISEPVTTSLNEAKSSQGTYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAEYYKSCRELLGDNFKKIFNELLVLLPDTVKQQELLSAHNDFKIKEKQTDSNSDLDCCICPTCKQVLTQQDIVTHKALHIEDEEFPSLQAISRII... 896
191 0.000e+00gi|749775913|ref|XP_011143010.1| PREDICTED: zinc finger protein 598 [Harpegnathos saltator]  clstr ali  33  9...........................................NSNTCVVCYKNVEIYSIGMCEHPVCYECSTRMRVLCRQNECPICRQDLPKVVFTREIKPF-----RYLCNLLDNQYAIYFGSSDIQDKFNDLLANTCSICEKQVFGSFHSLKDHMRQRHELHYCDLCVENLKIFSQERRCYTRASLAQHRRKGDLDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHYLCEEGVCAEEKFTSVFRTDIDLKAHKASVHGKQLSKAAAKQARTLELEFTLAPRGENRMNRRGMLSASTSRNTREHYNNGRDYXXXRQPSVDVQSTDEFPTLGNAAPVVPTQTKGRGNVTIRSTVRNQPLAVTDENFPALGPDSAGPSISKTVNRPAQLSIDSDFPALGNSEPSTSTANSTQWSAPTNAAKSKKVAPPPLASSPPPIRSGEDFPXXXXXXXXXXXXVITVVPTWGQXXXXXXXXXXXXXXXXXXXXXXXXKTTTDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANTSVVKKDVEHSSARAGESRVSKENSQAAHGTSNENAPKSSRETSQTEHASKKDKKKNKSNADNGSSGNASANGMQKKRSELKIDSLNTTNNNIHKMEDFPALGSSSSRQLANFANXXXXXXXXXXXXXXXXXXKYNSLDRLHGSNGLTFTSSSGESYSILPPDHVYVPPPDFQKRNTCLVARLNEVLLHQDKIDKFRYVSGLFRGGTCDAEEYYTHCREVMGDAFENVFPELLVLLPDIAKQQELFKVHKREL-------GGKAKGLDVCATCSQVVKNGDLRTHMSSHTLENHFPALGKNSTPPLKN 926
192 0.000e+00gi|571558588|ref|XP_006564417.1| PREDICTED: zinc finger protein 598-like isoform X3 [Apis mellifera]  clstr ali  31  11.............................................NTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCCQNECPICRQDLPKVVFTKEIKPFRQL---HKGSLIDTRYNIYFDSSDIQNKFYDLLANVCYICEKLVFNNFNSLKDHMRHQHELHYCDLCVENLKIFSHERRCYTRSDLAQHRRKGDVDDKSHKGHPLCEFCDQRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHFLCEEGTCIEEKFTSVFRTDIDLKAHKASVHSKQLSKAAAKQARTLELEFTLAPRGENRMNRRGMLGPSTSRNSRDYSLREYQPISPNTSNVFIPNNEPTFIKRSVDVQSTEEFPTLGNTAPIVPTLNQSKGRGPEA----------GSTSISKTVNFSVSSTNATGSNTQPQKSTTSNVSIQVNHEPNGTVTTKVSGPNIRIRPAQLSMES-FPALGSAEPSTSSNTNSAHWKWTCSKSASTSIPKKVVSPPLNVPSWGQPQNSNNSNSIKTTTDLIKGKTRKKKVKQNYXXXXXXXXXXXXSKTNISSVVVKKECETPRNLYSMNRMDTVQSSSQSTRNTSNNEIISKNINVQSSKEMEQINKKEKKKHKNIDNETVVNTNIGNNTSNGVQRKRTEEEFPALSSSSSKPPGFTNXXXXXXXXXXXXXXXCIKYNSIDKLHNNNGLTFTNSSGESYSILPDNYNYLPPPEFQKRNKCLVAKVNEILQHDDQIEEFRYISGLFRQGTYNAQDYYMHCREVMGSAFENIFPELLVLLPDIEKEQELFKVHKKE-------SGNKIKGLEICTTCGQVLKNGDFRTHMTNHTLESHFPALGKNNGLSQK. 872
193 0.000e+00gi|525013441|ref|XP_005054318.1| PREDICTED: zinc finger protein 598 [Ficedula albicollis]  clstr ali  27  121.............................................................................LESRSRCRCC--SIPQVVFGRKLPSFSSIALQQL--QHEKKYDIYFMDAEVYALYRKLLQHECSLCDAKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSEGAQEYYSDYEYLREHFREKHFLCEEGRCSSEQFTHAFRTEIDYKAHKSACHSK--SRAEARQNRHIDLQFTYAPRHPRRGDGVVGAEDYEEVDRFNRQGRAGRLSSRRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRVEDKEEGSRGRKEDLRDPDVLSSKRVPKSSNDVTEAAANLSQDDFPAIGSAAGPLQGPAQPSLSSSAAPTISSGMSLTYTATARKAAFQEEDFPALVSKVKPTNKTVTHITSAWN-------NGSSKNVVKAMSNPCVNQPAKKPSLNTSKGSKKSNKLCESDDEDGGGGLTTQEIRSAPTMFDVSQSPSSPRPSQETPLPRPATEKPPEAEQPCKVFPAAHGPDRAMAVVNGHSEKPTAGCAAPKEPPGLKKPPVTNKCPLPQEDFPALGSSGSARMPPPPGFNSVVLLKNPPPPPGLSVPVSKPPPGF---------AVIPSSTISEPVTTALKEPKSCHGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRELLGENFKKIFKELLVLLPDTAKQQELLSAHNDFRIREKQSSSPAELDCYICPTCRQVLTQQDVLTHKALHIEDEEFPSLQAISRII... 943
194 0.000e+00gi|667245304|ref|XP_008580210.1| PREDICTED: zinc finger protein 598 [Galeopterus variegatus]  clstr ali  25  17....................................................................................PICRVE---VVFGRKLPAFATI--PLHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCELPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLAQHRMQGDLDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFRERHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHSRRQQSRRGSWRYKREEEDREVAAAIRASVATQQQEETRRSEDQEDGSRPKKEEAAAPGPMEPQGPRRLPRPQGEGPPKEDSTNGPVSQEISAPGPVPGATPSSTLPQPSPKLKEEDFPLXXXXXXXXXXXXXXGPVGLALAYPVPARGRNTFQEEDFPALVSSASKPSTAPTSLISAWHSSCSPTPEAQATGRGCQPSRKAGKGSRGSRKGGSTPAEEEPRSVPTVAAVSSLLGPASTQTSTRVGRKKKVGSEKPSAASPPPLPPDHTPKRPGAELAPEAP--ATRAEGPAVVIVNGHTEGPAPARSTPKEXXXXXXXXXXXXCPTPQEDFPALSGXXXXXXXXXXGFNTVLLLKGAXXXXXXGPSISKPPPGFSGLLPSPHPACVPTTT----TTTKAPRLTPPPRTYLVPENFRERNLWLIQSIKDFLQSDEAFSKFKSHSGKFRQGIISAAQYYKSCRDLLGENFQKIFNELLVLLPDTAKQQELLSAHVDFLSHEKPSAQQAGLDCCVCPTCQQVLTHNDISCHQALHAADDDFPSLQAIARIIT.. 841
195 0.000e+00gi|542245359|ref|XP_005459478.1| PREDICTED: zinc finger protein 598 [Oreochromis niloticus]  clstr ali  27  2....................................DSTTTKDAEKNCVLCCQEVEIFALGKCDHPVCYRCSTKMRVLCDQKYCAVCREELDKVVFVKKLQAFQSL--PYQQFHCEKKYDIYFVDEKIYAHYRHLLLPECLRCEPKVFSRFEELEQHMRKQHELFCCKLCTKHLKIFSHERKWYNRKELARHRAHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDADGSQEYYSDYQYLSEHFRESHYLCEEGRCATEQFTHAFRSEIDYKAHKAAAHSK--NRAEARQNRHIDLQFNYAPR---QQRRNEGMVTGEDYEEVRHNRGGRGRPHGGQKSWRYSRNEEDRQVEAALRASIAMRRQEERAAVQERSAPKXXXXXXXXXXXXLRHPTGHSKQASKLPVKTMKSQNPRDVEDDFPALGATAAAPVVKSAPAVTAPSHVPAYSAQPKKTSSFQEEDFPALVSRVRAPKPAAGTTSAWSNHTSAAKPNTXXXXXXGPQLLXXXXXXXXRRKKKVGENGKALSNYSPIHSDDESGGMTQQEFRSVPTMLDISSLLTVKASSSKSSNPAVTSSASNPTPNTDLPTPKTTVNPVSVETTAQKENVPEKTWNKPLSGPVTAALTSGLANGYAEQSPPTSKDNAPVTNHPNTEPNPPPGFKTSFPMKASAPAPSSTMPLPPPGLGMSAPKPPPGFTGIPLNSNVVESTPPPSNGYLVPEDFRERNLELIQSIRKYLNDDESFNQFKNYSAQFRQGVISAAQYHRSCKDLLGDGFNRIFNELLVLLPDTGKQQELLTAHGDCKALEKQSGAXAELDCRVCPTCRQVLAPKDFNSHKTLHITEEEFPSLQSISRII... 929
196 0.000e+00gi|663240372|ref|XP_008488795.1| PREDICTED: zinc finger protein 598 [Calypte anna]  clstr ali  28  210..................................................................................................................HEKKYDIYFMDGEVYALYRKLLQHECSLCDAKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCQFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEHLREHFRENHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYTPRHQRRSEEDYEEVERYNRQGRAGRLGGRGSQQSRRGSWRYKREEEDRDVAAAVRASVAAKRQEEKKRAEEDSSRGKKEDLKDSEVLSSKRVPKPPNDVTEAAANGALSQDDFPAIGSAAGPLPGSAQPSLSSSAAPPIPSGISLSYTATTKKAAFQEEDFPALVSRMRPNHRTVTNITSAWN-------NGSGKNVVKAMSSPCVNQAAKKPSLSSTKGSKKGNKLSHSDDEDGASGLTAQELRNTPTMASTSQTFTKVSKKKKTGVEKQRPLSPHLSQDSAFPRPTPSAPDRPVAVTNGHSEKPSAICSTPKEPPGLKKPTTTNKCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKSPPPPPGLSVPVSKPPPGFAVIPSTNISEPV---------TTSLKEPKLCQGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRELLGENFKKIFNELLVLLPDTVKQQELLSAHNDFRIKEKQXDSNSDLDCYICPTCKQVLTQQDIVTHKALHIEDEEFPSLQAISRII... 992
197 0.000e+00gi|953871415|ref|XP_014585629.1| PREDICTED: zinc finger protein 598 [Equus caballus]  clstr ali  26  90............................................................................................QVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCELPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHSRRNEGVVGGEDYEEVDRYNRQASGRGAQQSRRGSWRYKREEEDREVAAAIRASVAAXXXXXXXEARRSEDRERLKKEEAGARGTEEPRGPRRPPRTQGEGPVPKEATANGPVSQEAFPANSLASGATLPSTLPPPTSELKDYPVPTRGRSTFQEDDFPALVSSASKPSTAPTSLISAWNSSSSKKVAHPTLGAQAASGGSQPPRKAXXXXXXXXXXXXXXVEEEEDGEEDGHAGRTTQELRSVPTTVAVSSLLALASTQKPGATXXXXXXXXXXXXXXAEQAPTGRAEGPVAVIVNGHTEGPAPARNIPKEXXXXXXXXXXXXCPTPQEDFPALXXXXXXXXXXXXXFNTVVLLKGTXXXXXXGPAVSKPPPGFSSLLPSPHSACIPTTATTTKV------LTPAPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSEFKSHSGEFRQGMISAAQYYKSCRDLLGENFQKIFNELLVLLPDTTKQQELLSAHTDFCGRERPPGTKAKKDCCVCPACQQVLAHGDVSSHQALHAADDDFPSLQAITRILT.. 922
198 0.000e+00gi|186910223|ref|NP_001119543.1| zinc finger protein 598 [Xenopus tropicalis]  clstr ali  27  14..............................................SCVLCCQDLDIYAVGKCDHPICYRCSTKMRVLCEQKYCAVCREELDKVVFVNKLAPF--ISLPLQQLQYEKKYDIYFEDGKLFSQFRKLLQHECTLCPSMPFHAFADLEQHMRKNHELFCCKLCVRHLKNFTYERTWYTRRDLARHRIHGDPEDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSEGAQEYYSEYSFLREHFRESHFLCEEGRCSTEQFTHAFPTEIDYKAHKTACHSK--NRAEARQNRQIDIQFSYAPRHNRRGDDYEEVDRYNRQARSARGAARGAQQQNKRGSWRYKREEEDRXXXXXXXXXXXXXXQEEMGRKQAPENPDTTKSRQEHSRDIEEGSKGKSSSKPTTDMSGAESLMKSGPKDNGKTQNATNGVLSTDDFPAIGSAPLLSSYTASARSSNKFQEEDFPALVSKINPNKPLSSVGSAWATASSKTAPKATGSSNAAPSKVVKKAAPSGNGKGAGKKISKPSSISDDDDDSVGMTTQEFRSAPTMTSPTAQSCGKVSKKKRVGSEKQHLSSVAQPASDKPASLNSSLKENASEVERTPTPPANSILSDKSNTVANGLPEKKLPDRSSTFKEKKGPISVHQCPLPEEEFPALMNSSMIRMPPPGFVPVVTVAPLAPPPGLSSSVGKPPPPTALPSEPQNKATKQPPFCTRTYLVPENFQQRNIHLINSIKDFLDSDEKFNEFKSLSGKFRQGLISAAEYYQSCRQLLGDNFKLIFNELLVLLPDTGKQQELLSAHKEFHVEEXXDSKSLDLDYSVCPSCGQVLAPRDLASHKKLHLEDHDFPSLQATRRII... 906
199 0.000e+00gi|668446595|gb|KFB36581.1| AGAP007725-PA-like protein [Anopheles sinensis]  clstr ali  37  6...........................RQRPTGPEKSVSESETADSLCVVCFKPIVYFAVGECDHLCCYECSTRIRVLCQQNDCPICRRDLAKVIFSKTLMSYQQLDIKNRSGLYDKKYRICFTDTEVQQAFFDLLDNKCPRCDEKNFPKFELLREHVRKKHELFYCDICTEHLKVFSSERRCYNRQELALHRRKGDPDKVGHRGHPLCEYCDTRFLDKDELFRHLRRDHFFCHYCDADGRNFFYGDYATLRDHFRSDHFLCEEGECEQEQFTSVFRSEIDLRAHRASVHGKTMNRLANKQTRTLELEFSYAPRHGPPSGPNSGAGPGGGAAGHQREYEMLVEATHQASIQQHPATSEQDFPTLAGAAPNPMFRPNNVSIRQRVYGSAGLARTKENFPALGSGGGETTGPTSMNEGFSSKI-----------TASSLLKPSQPSGSAGTSMMIHVSNRPSGSANAGKKNQADFPALPGSSKGAGSTAHMDDRSSGGSMVNLNAMSAKNRALADDYXXXXMKKGPQPAQQASVPSVNSTKAFPTLGDAGKPAAIKSVPWAAGASGAGXXXXXXXXXXXXXXXXXMKQKEQPSSSSNTDTRNNNGNAGTKERNREPQKQQQQQHSKSNGQSSTGSLAXXXXXXXXXXXXVPAVADSFPALGNHSSPEFVFAAAPPPGFESVNVKRVPGPPPGFGNVTLNSVARNTNNMTFTNSTGDTYNILPS-HSYVSPSNFSKRNQNLVTHFQRALKDQAALAEFRTISQMFRDGQYNASAYYEHCKIALGDRFQEIFPELIALLQNIAKQQELYLVYCQDEKSRPKSSGKNASRLEVCQVCKQVLIQTDLTEHYQTHYMENNFPKLANNA...... 901
200 0.000e+00gi|632975510|ref|XP_007904269.1| PREDICTED: zinc finger protein 598 [Callorhinchus milii]  clstr ali  27  32.......................................HSHDK--SCVLCCQELEVYALGKCDHSVCYRCSTKMRVLCEQKYCAVCRLELDKVVFVKKLAPFATIMT--HQFHHEKKYDIYIADGRILAQFRQLLQHECPVCEARPLNSFEELEQHMRKQHEMFSCKLCAKHLQIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYDYLRDHFREKHYLCEEGRCSTEQFTHAFRTEIDYKAHKAACHSK--NRAEARQNRQIDLQFNYASRHQRRNEGLVSGEDYEEVDRFNRRGGAPQNRGQNRRGRWKYNREEEDRDVAAAVRASIAARRQEEKKQAASKEESETSKSTKDDKEIDDAYSTKAVTRPPSETIGNKETSKGPSKEESKTLCSTVPLPSLSASATSTATGLTPAYVSTTKKNTPFHEEDFPALVSKIKQNKPSP-SVSAWTNAPGKSVLKVVHPSSTVSNRAVKKPLPVNGNKASV----KNKLPSRSEEVEDDTGGLTAQEFRSTPTMLDISSLLTTSTQNISXXXXXXXXXXXXPSSSPPLTDPVVSKAQKENVPDPKQDNVLVTSVLNGHTDKLCLETPTSVRTLKEPPGFKPVH-DPCPLPEEDFPALGNPVLPRKPPPGFNSLLAVKSSAPVSKPPPGFTGVPLNSNISEPVIPAPKQPVSTLSRTYLIPENFQQRNIDLINSINQYLYNDEKFSKFRTQSGQFRQGQISAAEYYRSCRELLGENFKKILNELLVLLPDTGKQQELLTAHNDLRLQEKQTGVNSELDCQVCPTCQQVLTPKDFVLHKTLHFEDDEFPTLQSVSRII... 888
201 0.000e+00gi|766919059|ref|XP_011501913.1| PREDICTED: zinc finger protein 598 [Ceratosolen solmsi marchali]  clstr ali  33  14..............................................TCVVCYKNVEYYSIGMCEHPVCFECSTRMRVLCQQNECPICRQDLPKVVFTKEIKAFRFLKKGNLLDI---KYNIYFDNAEIQNKFLILLAHTCTICANQVFGSFTNLQDHMKRKHDLHYCQLCADNLKIFSYERRCYTRAELSKHQSKGDQDDKSHKGHPLCEFCDQRYMDVDELYRHLRRDHLFCHFCDADGFHQYYNSYDYLRKHFQTEHHLCEEGSCISEPLTSVFRTDIDLRAHKAKKHGKQLGKAAAKQARTLELEFTLAPRGDLRGRRGPPGATRGSRDHGGYHQPHQQPVFTRQPLVDVQSTQEFPRLGNVESSPCPAPGPGQSKTRGNLTICSTLRNYDENFPALGPESAAAPPSLPKSFNVSVSSTNKAARSTFAKPATTAAPSIHVNRRPNGMVMTRLSGSSSLRIKPGPSRDSDFPALGQGSTGSAADPSTRTWTKITCVKPTTTQVKKVAPAPLTTSPPPLRSGQDYPSLAKPTKGQGKGKETTAPNGSPSPWLQVHTTDSSDKFATITADATXXXXXXXXXXXXXXXXXXXXHNSLTNNESTSHVHDVNRKAEQRSPSKDTEQESSTVAPVTIPRKRSELKIENLNTKNNNLSTKVKTSDSTRANNFPVLSRSGNRPPGLGSPPPGFGGSXXXXXXXXXXSRLNGLTFTNSSGENYTIVPDEYTYQQPDNFQRRNQSLMAKFNDCLGPDEDFKAFRYLSRLYRSGIYNAATYYKQCRTVMGVGFKRLFPELLALLPDIDKQRELFEVHK----NEASADDVFMADLIECPKCGQILHKVDLHSHATSHSIENHFPVLGKNSPASN.. 852
202 0.000e+00gi|597768127|ref|XP_007247901.1| PREDICTED: zinc finger protein 598 [Astyanax mexicanus]  clstr ali  27  4.....................................STARKEPETTCVLCCQDIEIFAVGKCDHPVCYRCSTKMRVLCEQRYCAVCREELDKVIFVRKLKPFAAL--PHHEYQSEKKYDIYFSDGKIFAQFRRILLFECPHCESKVFSKFEELEQHMRKQHELFCCKLCAKHLKIFAYERKWYNRKDLARHRTQGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHFFCHFCDADGAQEYYSDYQYLSEHFRESHYLCEEGRCSTEQFTHAFRTEIDYKAHKAAAHSK--SRAEARQNRQIDIQFNYAPRQQRRNDGMVGGEDYEEVDRFNRQTRPXXXXXXXXXSHNVRSREEEDRDLVAALQASQALRRQEERRHAHERGNQKPRMKEEKMDTDELRSSRSAAKPPSXXXXXPLKGEDFPILGAGAAPPPPIQSPSLVQSGAAVSTPMTTSYMTSAKKHSSFQEEDFPALVSKIKPLKTQGNAATAWSQAGGKPAASNNKPTASDPPPTSSVPQALTSSRRKKKLTSSETAKAAPKVKSPVSSGKTSQEIRAIPTMLEISSLLTVKPGSQPNAKAGKKKKQAMTTPSGTSSHPDVSVPKGPVVPKTNTFMNGYKDKTTDTISYASPIEEPPAPKKQPVSVVTEEEDFPALTVKKPPPGFKGTFPLKSSQTXXXXXXXXXXXXVVSKPPPGFTGVPLNSNVVEPTLPVFNRPTLSTSGTYQMPENFKQRNMELIQSIKNFLQNDEKFNEFKNYSGQFRQGVMSAAQYHESCRDLLGESFGRVFNELLVLLPDTQKQQELLAAHADFKVLEKQQQGSKELDCQVCPTCKQVLALKDFNAHKTLHIGEDDFPSLQAISKII... 920
203 0.000e+00gi|817214838|ref|XP_012283611.1| PREDICTED: zinc finger protein 598 [Orussus abietinus]  clstr ali  36  14...............................................CVVCYKNVEIYSIGMCEHPVCYECSTRMRVLCQQNECPICRQDLPKVVFTREVKPFRHLKKG---DLLDTRYNIYFDSEDIREKFMQLLANKCRFCDAEHFENFYSLKDHMRRKHELHYCDLCVENLKIFSHERRCYTRPDLALHRRKGDVDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRHEHFLCEEGPCAEEKFTSVFRTDIDLRAHKAGIHGKQLGKAAAKQARTLELEFTLAPXXXXXXXXXXXXXPSGSRGPREYNNNSHAPGTNHQPSVDVLSTEEFPTLGNAVPIVPSSKGTRGNVTIRSTLRPQPLAVTDENFPALGPESTPGGISKVNLSVSSSNKLAAGRAPR-----APGNVSIRVDHKANGTVTTTRVSGPNIRIRPALSMDADFPAL-GPGTTAASAQWTRVTCTRPAAAAQARPKKSVAPSGEDFPSLLDPARAKRQPAMAATAWTGDDNXXXXXXXXXXXXXXXXXXXXXXXXKVGGANKTPKKEQDGPSRNKETEKAKESTKSTEEEKRKPKSEDPEEEPESINKDIDTLPRKRSELKIESPNSTSSPEVRLEEFPALGGGSSGPPGFS-------------XXXXXXXXXXXXXXXFFVKLNSVQRLPGDNGLTFTNSSGETYSILPDRFPYLLPPDFQKRNKSLEARVKDVLGEPEALDEFRRASGRFRQGICSPEEYYEHCRRAMGVNFETVFNELLVLLPDVEKQKELYRVHR-------KVNQGKTKGLEACANCGQVLKSGDFRSHVADHTMENHFPALGKA....... 834
204 0.000e+00gi|557282277|ref|XP_006024063.1| PREDICTED: zinc finger protein 598 [Alligator sinensis]  clstr ali  26  1..........................................................................MRALCGVRYCAVCRDELAQVVFGKKLSSFSTIVLNQL--QHEKKYDIYFADGKVYALYRKLLQHECPLCHVQPFNTIVELEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNESVVTGEDYEGVERYNRQGRPVRTSVRGGQQNRRRRGEEEDRDIAAAVRASIAAKRQEEKKRVEEKEDSSRGKKEELRDAETSNAKRVPKPSSEATVPKEAAANGPLSQDNFPAIGSAVGSPSLSSSAAPTVSTGLSLTYTVTAKKTAFQEEDFPALVSKVKPTNKTVSNITSAWNNGSNKNVVKAIGSSSSSSNQLA----KKAAPPNSSKGGKKSNKSPQSDDEDAGNGLTTQKIRNAPTMVDVSSLLAASTSQTFTXXXXXXXXXXXXQRPPSPPASEENSPPGSLEKVVEAKQMPNALANPDRSAAVMNGHSEKSVAVCNTPKEPPGLKKPAATNQCPLPQEDFPRMPPPGFNSVVLLKSPPPGLSVSVSKPPPGFPVIPSTNVSEPVTTSLKEPTPSQGTYLIPEHFQQRNIQLIQSIKEFLQSDERFNKFKTHSGQFRQGLMSAAQYYKSCRDLLGDNFRRIFNELLVLLPDTAKQQELLSAHNDFKVQEKQGSNKPRKDCCICPTCKQVLTHQDLATHKALHLEDEEFPSLQAISRII... 846
205 0.000e+00gi|755941693|ref|XP_011298530.1| PREDICTED: zinc finger protein 598 [Fopius arisanus]  clstr ali  33  8....................................MTVSTNTNNGACVVCYRNVNIYSIGMCEHPVCYECSTRMRVLCKQNECPICRQDLPKVVFTTVIKPFRHIRRGN---LLDTRYNIYFESPDILEKFTELLAHSCNLCDRQVFSSFNSLKDHMRKKHELHYCDLCVENLKIFSCERRYYSRPDLAHHRRKGDTDDKSHKGHPLCEFCDRRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHYLCEEGVCSEEKFTPVFRTDIDLKAHKATVHGKHLGKAATKQARTLELEFTLAPRGDPRNARRVPPMGVEQRDFHESGTPFFDPEASFMRQPDVQSTEEFPSLGNAPVPSNPTQTKTKGRGNRNSLAPRPLAVTDENFPALGPDSTPSSVSKTVNLSVYSSSRTQPSSSGPSRPQSSAPNSIQVNHKTDGSITTRVSGPTVRIRPNTFTRDSDFPALGRSDSNTMDSTASEWTKVSCVKPSSSSKKKVAPAPVLDHPASPVPSSEAFPSLPXXXXXXXXXXXXXXNDSAYASTWNRSTVIDNESNSSXXXXXXXXXXXXXXXXXXXASKSNVQSAQMQDKPSEALKQTSNQSSGAGRVDCHNQENQKSTKKKNNFPEPQSMTNSLENETSLNNTNNVRRTAEEFPALSRSSKTTPNXXXXXXXXXXXXXXFAVKLNSTEQSRADNGLTFTNSSGESFSIFPDSSTYVPPLDFPRRNKNLVAKIGEVLESKESMEEFRYLSGLFRQGTLSGEHYYKKCRSAMGDSFQDVFPEMLILLPDIGKQKELFDLHKKEV--------GGVKTLDVCSTCGQIVKTGDFKAHLSSHTLDCHFPALGQTTTV.... 878
206 0.000e+00gi|805753561|ref|XP_012135871.1| PREDICTED: zinc finger protein 598 isoform X1 [Megachile rotundata]  clstr ali  34  11.............................................NTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCCQNECPICRQDLPKVVFTKEIKPFRQL---HKGNLLDTRYNIHFDTPDIQSKFYDLLANSCNICEKPVFNNFNSLKDHMRHQHELHYCDLCVENLKIFSHERRCYTRSDLAQHRRKGDIDDKSHKGHPLCEFCDQRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHFLCEEGMCAEEKFTSVFRTDIDLKAHKASVHSKQLSKAAAKQARTLELEFTLAPRGENRMNRRGMLGASTSRSSRDYFVSNNEPTFVQQPSVDVQSTEEFPTLGNATPVVPTQSKGRGNVTIRSTIRPQPLAVTDENFPALGPESGSTSISKTVN--FXXXXXXXXXXXTQAQKGTTSNVSIQVNHEPNGTVTTKVSGPNIRIRPAQLSMESDFPALGSSEPSTSSNTNLAHWWTCSKSASTSVPKPKKIASGEDFPTLSKSSKSKKQSTITVVPSWSQAQSSNNSNNVKTTTDIXXXXXXXXXXXQNCNNNNVNGSETSSSRTNVSTVVVKKECETSKNSCANSKNNIDAVQSSSQSMQSTDNVSNSVNTSKNISVQSSKEIEQTNKNSTNRNVRHLEEFPALSGSSSKPPGFTNXXXXXXXXXXXXXXXCIKYNSMDKLNSSNGLTFTNSSGESYSILPSAYNYVPPPEFQKRNRCLVAKVNEVLMQHDQIEEFRYISGLFRQGTCNAQDYYTRCREAMGSAFENVFPELLVLLPDIEKQQELFKVHKKE-------SGNKIKGLEICATCGQVLKNGDFRTHMTSHTLENHFPALGKNVPH.... 904
207 0.000e+00gi|915662803|gb|KOC65197.1| Zinc finger protein 598 [Habropoda laboriosa]  clstr ali  36  11.............................................NTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCFQNECPICRQDLPKVVFTKNIKPF---CQLHKGSLLDTQYNIYFDTPDIRSKFYDLLANTCNICDKPILNNFNSLKNHMRHWHELHYCDLCVENLKIFSHERRCYTRADLAQHRRKGDIDDKSHKGHPLCEFCDQRYMDNDELFRHLRRYHLYCHFCDADGLHQYYNSYDYLRDHFRQEHFLCEEEMCVEEKFTSVFRTDIDLKAHKASVHSKQLSKAAAKQARTLELEFTLAPRGENRMNRRGEYQQTITPNASNVFVSNNEPTFVRQPSVDVQSTEEFPTLGNIAPIVPTQSKGRGNVTIRSTIRPQPLAVTDENFPALGPESGGTSISKTVNFSVSSS--NAPGSSTQSQKSTTSNVSIQVNHEPNGTVTTKVSGPNIRIRPAQLSMES-FPALGSTE-----------------PSTSSNTNSAHWKEVLQWTCS-------KSASTSVPKVKKVASPPLVPSPPPIQSGEDFPTLSKSSKSKKQSTITVV----PSWVHPQSTNNIKKECETSKNPSSMNNMDTVQSSSPSMQNMDNMNNTLSGSS-------------------------------SKPPGFANXXXXXXXXXXXXXXXCIKYNSMDKLNSSNGLTFTNSSGESYSIVPDNSKHNSAYNYVPPPEFPKRNKCLVAKVNEVLMQQDQIEEFRYISGLFRQGTCNAQKYYTHCCKVMGSAFENVFPELLVLLPDIEKQQELFKVHKKE-------SGNKIKGLEICAICGQVLKNGDFRTHMTSHTLENHFPALGKSSAPSQKN 772
208 0.000e+00gi|345486430|ref|XP_001603474.2| PREDICTED: zinc finger protein 598 isoform X1 [Nasonia vitripennis]  clstr ali  35  20............................................SNTCIVCYKNVEYYSIGMCEHPVCYECSTRMRVLCQQNECPICRQDLPKVVFTKEIKPFRFLRKGN---LVDSKYNIYFDNHEVREQFLRLLAHKCSVCDNQFFNSFNSLKEHMRRKHDLHYCDLCVENLKIFSHERRCYTKAELLRHRRKGDLDDKSHKGHPLCEFCEQRYMDNDELYRHLRRDHLFCHFCDADGLHQYYSSYDYLREHFRQEHHLCEEGGCADEQFTSVFRTDIDLKAHKASVHGRQLGKAAAKQARTLELEFTLAPRGDLRNRRGPPGAARSSRDYEGNNHSRNHHHRERQPLVDVQSTEEFPTLGNATPSVSSSLGPAKGRSNLTIRGSLRQGNYNENFPALGPEASSNPSKSASVSSSGSLSSSNKASTVVRQQSATPNLSIHVNHRPNGTVTTRLSGRNPAMSSGSQPRDLDFPALGRSVGNLAGQSATXXXWTKITCVKPAAMPKAKKVAPAPQLGPALNSGEDFPSLAKGSTTTAKPPSATWVQVQSSGTSNDSSIMTDATXXXXXXXXXXXXXXTASNGNASSSDSTSKSNPKSKDQDPSKKDKSKSNNKQNSEQTSSNNKINSTKVLNHVAETSAPAPAQRKRSELKIDSLNTTNTPKTASTMPDDFPALGRNLGRPPGLSSPPPGFTAAPPPGFLSRPNGLTFTNSSGESYAIVPDRYAYLPPANFQRRNQNLIAEFNNCFGGEESLKAFRYLSGLFRTGICDADQYYKQCRTVMGESFKRLFPELLALLPDIEKQRELFEVHRRETN-----AGARIKGLEACANCGQILRSSDLQAHATSHTLENHFPALGTGTATS... 902
209 0.000e+00gi|972172007|ref|XP_015188275.1| PREDICTED: zinc finger protein 598 [Polistes dominula]  clstr ali  33  10...........................................NSNTCVVCYKNVEIYSIGMCEHPVCYECSTRMRVLCQQNECPICRQDLPKVVFTREIKPFRFLRKG---GLLDTRYDIYFDTVDIQEKFYELLVDICTICDKKVFSNFQNLKDHMRHQHELHYCDLCVENLKIFSCERRCYTRSDLAQHRRKGDADDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYEYLRDHFRLEHFLCEEGMCIDEQFTSVFRTDIDLKAHKTSVHGKQLSKAAAKQARTLELEFTLAPRGENRIRRGMTGPSTSKSTRDYGFRDHNSREYQQQPSVDVQSREEFPTLGNCSFVPNLNQPTRGNVTIRSTVRPQSLAVTDENFPALGPESTNANVSKTVNVSVSSANLVGSNVP-QSRKGSTPNVSIQVNREINGTVTTRVSGPNVRVRPAQLSVDSEFPVLGCNKPSTSTPNSAQWWTTCTKSSSSAATPKSKKTVRSLAPSPPPIQSGEDFPSLSKSSKQNKQSAIMVVPPRAQPPQSSGISNNNAKTTAESVKGKTKKKKAKHNSNVNETNNIKPNKESSGTTSDVAGSIQVLEPTNDTISICNDNLLKNSTKHNSNDKQNGRSSNDTSCNASSEVSNKSSNILRKRTELKIDSLNSTNNNNVHQMEDFPSLGSSSSKPPGFIDPPPGFESTTSPPPGFCIKVENYTYILPPDFQKRNKSLVAKMNEVLMEKDRIEEFRYISGLFRQGVCSAEEYYAHCCTVMGTAVEDVFPELLVLLPDIPKQQELFKVYHKELGNQ-------VKGLQICTTCNQVLKHSDFQTHMANHSLENHFPVLGKNNTAPNKN 933
210 0.000e+00gi|973183506|ref|XP_015215762.1| PREDICTED: zinc finger protein 598 [Lepisosteus oculatus]  clstr ali  27  12..............................................SCVLCCQELDIFAVGKCDHPVCYRCSTKMRVLCQQKYCAVCREELDKVIFVKKLEPFAAI--RSQQLQCEKKYDIYFSDSKIYAQFRKILQSECPQCPEPRFSKFEELEHHMRKQHELFCCKLCVKYLKIFTHERRWYNRKELARHRTQGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRTEHYFCHFCDSDGAQEYYSDYEYLREHFREKHYLCEEGRCSTEQFTHAFRTEIDYKAHKASSHSK--NRAEARLNRYIDLQFSYASRHQRRNEEDYEEAESYVRSLRPTRGGARGGQQNRRGSWRYNREEEDREIXXXXXXXXXXXXLEEKRQAQEREPPKPRKRNLRSTTKPPSEAPGPKEASKSVNGSAPLKGEDFPVLGATAAPMASIPSPSLSSVALTSPMT--TAYTAQPRKPSSFQEEDFPALVSKIKPHKPLGGTSSAWANAANKNLKKPAPGNNAKASSRAKPACSDDEDDKAGRTTQEIRSIPTMLDISSLLTGKTSSPPASKVGKRKKVGGERPTPXXPPAEEAAPAVAQKENVPDSKAPTPDVTAPVFPAAPKTNPLVNGHADKPPDSSGVVVPKEPPGLRKQVAPDPCPLPEEEEFPALMPKKPPPGFKTAFPMKGGQTGLPPPPPGLATPISKPPPGFTGISLNANLLEPAIPSVTEPVYSAGTYLVPENFQARNMELIKSIKKFLNNDEKFNEFKTYSGQFRQGLISAAQYHRSCRDLLGENFKRIFNELLVLLPDTGKQQELLSAHSDLRVLEKQGGSKPRKDCQICPTCRQVLAQEDFVAHKTLHAGDEDFPSLQAISRII... 892
211 0.000e+00gi|817066798|ref|XP_012255256.1| PREDICTED: zinc finger protein 598 [Athalia rosae]  clstr ali  35  11............................................DNTCVVCFKNVEIYSIGMCEHPVCHDCSTRMRVLCCQNECPICRQDLPKVVFTRQVKPFRHLKKGN---LLDKRYNIHFDDEEIQERFTMLLAHSCDTCERQVFSNFNSLKDHMRQHHKLHYCDLCVENLKIFSHERRCYTRSDLAQHRRKGDSDDKSHKGHPLCEFCDQRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDDLRDHFLQEHFLCEEGPCADEKFTRVFRSDIDLKAHKASIHGKQLGKAATKQARTLELEFTLAPRGDNRNNRRMPGSSTSRNSRDHNNSRSNEPTYVRQPSVDVQSTEEFPTLGNATPMIPNQAKGRGNVTIRSTVRSKTLDVTDENFPALGPESTPSSTSTISKTVNLSVSSSNKPGPSTLQRPQSSAPNVSINHKPNGVVTTRVSGPNIRIRPAQLSRDSDFPALGNPEPSTNLNTAQWTKVTCTKAPQNVVPKSKKVAPPPLAPSPPIASGRDFPSLSKPLKSKKQSTLSVVPSVPSWVQPQTSETNSAKATSDFXXXXXXXXXXXQXXXXXXXXXXXXXXXKCNISAPNVKKDASPKKPKKEKKKAKNTSNASSMEATSVSANSSDVNTDIGATLSATVQRKRSELKIDSLHSTSDRGTSFEDFPALGTVPSRPPGFTEPPPGFGTAPSPPPLTFTNSSGQSYSILPNNYEYVPPPDFSKRNINLVAKVSEELSIPEAIEDFRCLSVLFRQGSCDPQHYYSRCRDSIGTAFGTIFPELLVLLPDINKQQELFKVHKKELGSQ-------IKGLDACATCGQVVKSGDLRAHLTSHALENHFPVLGKAAPLQQSN 930
212 0.000e+00gi|729744757|ref|XP_010568767.1| PREDICTED: zinc finger protein 598 isoform X3 [Haliaeetus leucocephalus]  clstr ali  28  16..............................................SCVLCCGELEVVALGRCDHPICYRCSVRMRALCGVRYCAVCREELGQVVFGRKLTSFSTIALNQL--QHEKKYDIYFTDGDVYALYRKLLQHECSLCDVKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRSEGVIGGEDYEEVDRYNRQGRSGRLGGRGSQQNRRGS-----------------------WRYKSSAQLAAVKLKEEDFPSLSSSTA-----PTISSGMSLTYTATAKKTAFQEEDFPALVSKMRPNNKTVTNITSAWNNGSSKN------------VVKAISNPCVNQIAKKTSSLNSTKGSKKSNKLSQSDDEDNSSGLTTQEIRSTPTMFDVSSLLAASTSQTFTKVSKKKKMGIEKQRPSSPHLLQETSFPRSLTEKL--------PEAEQTPNASSALHTPDRSAAVMNGHLEKSLAICSTPKEPPGLKKPTVTNKCPLPQEDFPALGSSGSARMPPPPGFNTVVLLKSPPPPPGLSVPVSKPPPGF---------AVIPSTKISEPVTTSLKEPKSCHGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYKSCRELLGDNFKKIFNELLVLLPDTLKQQELLSAHNDFRIKEKQTDSNSDLDCCICPTCKQVLTQQDVVTHKALHIEDEEFPSLQAISRII... 788
213 0.000e+00gi|938071970|gb|KPP70136.1| zinc finger protein 598-like, partial [Scleropages formosus]  clstr ali  28  42..........................................ETERSCVLCCQDVDIFAVGKCDHPVCYQCSTKMRVLCDQKYCAVCREELDKVIFIKKLQPFATI--DSEQFQCEKKYDIYFTNGKIYAQFRKILQSECPQCEPKVFSKFEELEQHMRKQHELFCCKLCAKHLKIFTHERKWYSRKDLARHRTQGDPDDTSHRGHPLCKFCDDRYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYPYLRDHFRESHYLCEEGRCSTEQFTHAFRTEIDYKAHKAAAHSK--SRAEARQNRHIELQFNYTPRHQRRTDGIGGYEEVDRFNRQARAGRGASRMTHQNRRVSWRYNREEEDREVAAAVRASIAASRQEERRQALEREIPKARREEKMEMDDDRNLGSAAKPTEVLTPRDTGRSDFPVLGATSADTPLPPLASMSLSSATLSTPMTPAYSVQSWNPSSFQEEDFPALVSKIRPQKPVGNTLSAWSQCGNKNTAQATKAGPRPVPPSNTSASHLLASVSQYKKKSTQGNGAKAPSRIRTASGKTVQDIRSVPTMLDISSLLTSPSGPKVSKRKKQPTAAMSSTWPTAGEVSVAQKENVPEASLPPVQNSPKPTATPKSNLLFNGNTNKPLENPAVVSKEPPGLQKQADCNPCLLPPALIPRKPPPGFKNTFPVKATQNXXXXXXXXXXXXXSKPPPGFTGVPLNANTETAAPPPRTYLKPEKFQERNMDLIQSIKNFLQNDEKFNEFKTYSVQFRQGVISAAQYHKSCQELLGDNFRRIFNELLVLLPDTAKQQELLAAHGDLKALEKQAGSKPKKDCLICPACSQVLAQKDFAAHKTLHMADDDFPSLQAISKII... 927
214 0.000e+00gi|987920841|ref|XP_015436553.1| PREDICTED: zinc finger protein 598 [Dufourea novaeangliae]  clstr ali  34  11.............................................NTCVVCYKNVDVYSIGMCEHPVCYECSTRMRVLCCQNECPICRQDLPKVVFTREIKSFRYLRKG---ILVNTRYRIYFDTPDIQNKFYELLANSCNICEKPVFNHFNSLKDHMRRHHKLHYCDLCVENLKIFSHERRCYTRSELAMHRRKGDIDDKSHKGHPLCEFCDERYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRQEHYLCEEGMCSEEKFTSVFRTDIDLKAHKANVHSKQLSKAAAKQARILELEFILTRGDNRMNRRGMSGASTSRSSRDYGGRDNNESTFVRQPSVDVQSTEEFPTLGNTAPPTLHQTKGRGNLTIRSTIRPQPLAVTDENFPALGLESSGTSISKTVNFSVCS--GNASGLSAQPQKSTTSNVSIQVNHEPNGTVTTKVSGPNIRIRPAQLSMKSDFPALGSAEPSTSNTKQTQLRE----ASQWISTESKQAAFPPLAPSPLRIPSWGQPQSSNNSNNVKTTTDLXXXXXXXXXXXQNSITNGNDTSSSKTNASNVVKRESETAEASKNSCSIDTRNAVQSSSQSIQNTDNMSNSENSSKNINVHQSKETEQTNKKEKKKHKNSDNQTIVNTNTGKSTSNGVQRKRTSSSTKPPGFTNPPPGFGITTPPPPGFCIKYNNMDKLNSSNGLTFTNSSGESYSILPSAYNYVPPTDFQKRNKCLVAKVNEVLMQQDQIEEFRYISGLFRQGTYNAQEYYMHCREVMGSAFENVFPELLVLLPDITKQQELFKVHKKETGN-------KIRGLEICTTCNQVLKIGDFQMHMNGHTLENHFPVLGKSNT..... 890
215 0.000e+00gi|1009375596|gb|KYM99169.1| hypothetical protein ALC62_10138 [Cyphomyrmex costatus]  clstr ali  34  9...........................................NSNTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCLQNECPICRQDLPKVVFTREIKPFYSL---TNTNLLDTRYDIYFSSLDIQEKFTELLANTCSICEKIVFSSFNSLKDHMRQQHELHYCDLCVENLKIFSHERRCYTRSSLATHRRKGDIDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRQEHYLCEEGMCVEEKFTSVFRTDIDLKAHKASVHGKQLSKAAAKQARTLELEFTLAPRGENRMNRRGMLGASTSRNTRDYNSRDYGSRDYQQPSVDVQSTDEFPTLGGSAVPVVPTLSQPKSRGNRSTVRNQPLAVTDENFPALGPDSAGPSISKTVNFSVSSSSNASNSLSQCQKGSASSNVSIQVNHEPNGTVTTRVSGPNIRIRPAQLSIDSDFPALVPS--------------WGQNSQNTNNVQ-------------------------XXXXXXXXXXXXDQTKKNSRFASKESSRVTQDTNASGDNSKNSSAQNSKEPEHANKKDKRKNKNNVDGNSGVTTVINTETENVGNGSSNGEKQRKRSELKINTLNTTNNNIHQTEDFPALGSTSSRPPGFTNPPPGFSSPTLPP-------------PGFSIKYSSFDGLHDGNGLTFTNSSGESYSILPDNHAYVSPPDFQKRNTCLVAKLNAVLVEQSKIEEFRYVSGLFRGGTCDAQEYYTHCCEVMGSAFESVFPELLVLLPDIPKQQELFKVHKR-------KAGGKAKGLDMCATCGQVLKNGDFKMHMSSHTLENHFPALGKSNTSS... 803
216 0.000e+00gi|795225093|ref|XP_011888776.1| PREDICTED: zinc finger protein 598 isoform X6 [Cercocebus atys]  clstr ali  29  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYAPRHSRRNEVTGCLLAAGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDREEGGRPKKEEAAVXXXXXXXXXXXXXXTQGEGPGPKETSTNGPVSQEAFPVTGPATPCTLPPPSPK----LKDEDFPSLSASTSSCCST----------------------AAIPGPVGLALPYAIPARGRSAFQEEDFPALVSSVPKPGTTPTSLVSAWNSSSSSKKAPEAPASRAEGPVAVVVNGHTEGPAPARSAPKEPPGLPRPLGSFPCPT-----------------------------PQEDFPALXXXXXXXXXXXXXFSAVVKGTXXXXXXXXXXXXSKPPPGFSGLLPSPHPACVXXXXXXXXXXXXXXXX-XALQAYLVPENFRERNLQLIQSIRDFLQSDEAFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVFNELLVLLPDTAKQQELLSAHTDFCNREKPTTQQAGLDCRVCPTCQQVLAHGDASSHQALHAADDDFPSLQAIARIIT.. 806
217 0.000e+00gi|970880095|ref|XP_015109847.1| PREDICTED: zinc finger protein 598 [Diachasma alloeum]  clstr ali  33  19...............................................CIVCYKNVDLYSIGMCEHPVCYECSTRMRVLCKQNECPICRQELPKVVFTREIKPFRHI---HRGNLLDTRYNIYFENPEIQEKFTELLAHSCNICERQVFSSFNSLKEHMRRQHELHYCDLCVENLKIFSCERRCYSRADLAHHRRKGDTDDKSHKGHPLCEFCDRRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHYLCEEGACSEEKFTPVFRTDIDLKAHKASVHGKHLGKAAAKQARTLELEFTLAPRGDPRNSRRGPQMGPDQRDFHDPDPPSCDPEAPFMRQPDVQSTEEFPSLGNTPLPPDPHQTKSKGRGNRNSFVQRPLAVTDENFPALGPDSTPNSVSKTVNLSVYSSNRAQPSSSTGPQRPQSSAPSIQVNHKTDGSITTRVSGPTVRIRPSTFSRDSDFPALGRNEATSTSNSAQWTKVTCVKPXXXXXXXXVAPAPVLDPPPASLSTVSPSLPKSSKAKKSSISVVTNDSSSYASTWNRSSVVNENESNSTDAXXXXXXXXXXXXXXQTSSGNNSSGNESTAQSVQSVRDKPSEVANSQSSGLMSARVESQDRKKSDSSPEPSANPNPLENESLNNTNNVRRTLEDFPALGKTSKTRAGNPPPGFNTTTPPPPGFAVKLNSTEQPRTDNGLTFTNSSGESFSILPDSYSYVPPLDFPRRNKNLVARIGEVLESKESMEEFRHFSGLFRRGTLSGEHYYKRCRSAMGDAFRDVFPEMLVLLPDVAKQRELFDLHK--------KEVGGVKTLDVCSTCGQVVKTGDFKAHLSSHTLDSHFPALGEATNVMGGN 877
218 0.000e+00gi|751213616|ref|XP_011159625.1| PREDICTED: zinc finger protein 598 [Solenopsis invicta]  clstr ali  34  11.............................................NTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCRQNECPICRQDLPKVVFTREIKPFHSLTKTN---LLDTRYDIYFSSLDIQEKFTELLANTCSICEKMVFSSFNSLKEHMRQRHELHYCDLCVENLKIFSHERRCYTRSSLATHRRKGDVDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRREHYLCEEGVCAEEKFTSVFRTDIDLKAHKASVHGKQLSKQAAKQARTLELEFTLTPRGENRMNRKGMPGPSTSRSTREPYRDNNEPTFTRQPSVDVQSTDEFPTLGGSAAPTLPQPKSRGNVTIRSTLRNQPLAVTDENFPALGPDLAGPSISKTVNFSVSSSSNTTGSAAQCQKGSSSSNVSIQVNHEPNGTVTTRVSGPNIRIRPA-LSIDSDFPALGSSEPSTSTANSTQWQWTCSKSAPANTSKSKKVAPPPSISSAPPIRSGEDFPXXXXXXXXXXXXVITVVPSWGQNSQNTNNAQSSGTSNNIKTTSNNSCIASKENSQFTYNTIDAIGDNSTFKNSSVQNSKESEHTSKKDKRKNKNNANGSSGIATVINTESVSGSNGSSNGEKQRMRSELKIDSLNTTNNNIHRTEDFPALGSTSSRPPGFTNPPPGFASPTLPPPNGLTFTNSSGESYSILPDNHAYVSPPDFQKRNTCLVAKLNAVLVDQDKIEEFRYVSGLFRGGTCDAQEYYTHCCEVMGANFETVFPELLVLLPDIAKQQELFKVHRRE-------AGGKAKGLEICATCGQVLKNGDFKTHMSSHTLENHFPALGKSNAPPPKN 926
219 0.000e+00gi|975089741|ref|XP_015279603.1| PREDICTED: zinc finger protein 598 [Gekko japonicus]  clstr ali  28  17.........................................GSEGPCCVLCCGELEVVALGRCEHPICYRCSVRMRALCGVRYCAVCREELAQVVFGRKLTSFSTI--PLHQLQHEKKYDIYFTDAKVYALYRKLLQHECPLCEARPFATIVELEQHMRKQHELFCCKLCVKHLKIFTHERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSEGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYASRHQRRNEGVVGGEDYEEVDRYNRQTGPRGGQQNRRGSWRYKREEEDRDIAAAVRASVAAKRQEEKKRGEDKEDGGRARKEEAKEAEAGASKRVPNPPSEAPPGPKEAAAKAVLSQEDFPAFGSPAVVSSLSSAASITVPSAMSLSYTATAQKTSFQEEDFPALVSK-----VRPSNKTFSTLSSAWNNSSVKNAVRAVAPSSAGTGQPAKKLVPAGGSRGSKKAKPAALDVEDDSVGGLTSQEIRSTPTMVDVSSLLVAPNAQTFLKVGRKKKVGAEKQRASPPPVAPQELPPPVPSGEREPEAEAPPSAPTNAAVAERAAAVVNGYSEKPAPCKASKEPPGLRKPPAASQPLLPQE-DFPALGSSGSPRMPPPPGFNSVVLLNSPPPPPGLAAPLSKPAPTKEAKPCQGAYLILENFQQRNTQLIQSIKEFLHHDEQFNKFKTSSGQFRQGLISAAQYYRSCQELLGENFQKIFHELLVLLPDTAKQQELLAAHTDSKAKEKPAGPGPDLDCCVCPQCPQVLTPRDLAAHKALHLEDEEFPSLQAISRII... 887
220 0.000e+00gi|505785214|ref|XP_004604465.1| PREDICTED: zinc finger protein 598 [Sorex araneus]  clstr ali  27  31..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGRKLPAFASIALHQL--QHEKAYDIYFADGKVLALYRQLLQHECPRCELPPFSLFGDLEQHMRKQHELFCCKLCLRHLKIFTFERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSSEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRHIDLQFSYTPRHPRRAEGVVGGDDYEEVDRYNRQNGGRGAQQSRRGSWRYKREEEDREVAAAIRASVAAQQQLETRRSEDREEATLXXXXXXXXXXXXXXTQGEGPGPKEASPNGPMSQEAFPAAGPAFPSLCASTSSXXXXXXXXXXXXXXXXYPAPPRGRSAFQEEDFPALVPSAAKPSPAPTSLLSAWNNSKKGVQPSPGGPAA------RKAGKGCKGGRKGGSGPAEEEEPRSVPLVGAGPTLLAPGSTPHFTKVGKKKKVGSEKQSAASPPPPPSDQSWPLGAEHPPSAPTGRVEGSGAIVINGHTEAPALARSTPKEPPGLPRPVGPPLGPTPQEDFPVLGNPCPPRMPPPPGFSTGVILKNTXXXXXXXXXXXXSKPPPGFSGLLPSSQPTC----VPSSSTKAPRPPPEARAYLVPEHFRERNLQLIQSIRDFLQSDEAFSQFKSHSGEFRQGVISAAQYYKSCRDLLGENFQKIFQELLVLLPDTTKQQELLSAHADFCGRERPPGTKAKRACCVCPTCRQVLALGDVDSHRALHDADEDFPSLQAMARMIT.. 882
221 0.000e+00gi|759041097|ref|XP_011329357.1| PREDICTED: zinc finger protein 598 [Cerapachys biroi]  clstr ali  35  14..............................................TCVVCYKNVEIYSIGMCQHPVCYECSTRMRVLCRQNECPICRQDLPKVVFTREVKPFHSL---ARTNLLDTRYDIYFVSLDIQEKFTELLANTCSICEKMVFSSFNSLKDHMRHRHELHYCDLCVENLKIFSHERRCYTRASLAMHRRKGDIDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRQEHYLCEDGVCAQEKFTSVFRTDIDLKAHKASAHGKQLSKAAAKQARTLEFEFTLAPRGENRMNRRGMLGASTSRTHNARDHNNNEPVFTRQPSVDVQSTDEFPTLGGGAVSVVPTLAQTKSRGNRSTVRNQPLAVTDENFPALGPDPAGPGISKTSVSSTSNASGSNVGIPQGHKASTSSNVSIQVNHEPNGVVTTRVSGPNIRIRPAQLSIDSDFPALGSCEPSTSTTANSTQWWTCLKSAPVNTLRSKGVTPPLDFPSLAKSSKSKKQSVITVVPSWGQSSQNSGANSNARTTMEQTTXXXXXXXXXXQNGNGNSSGNESSSFKSNVNATVAKQEVVPTCPSGDSDDSRVASKRNSKETEHTSKKDKRKSRNNADENSKIDSLNTTNNNIHQAEEFPVLXXXXXXXXXXXXXXXXXXXXXXXXXXXRPPGFTNPPPGFTSPTSPPPLTFTNSSGESYSILPDNSSYVSPPDFQKRNACLVTKLNGVLVQQEKIDEFRYVSGLFRGGTCDAEEYYTHCRSVMGSAFESVFPELLVLLPDIAKQQELFKVHKR-------QVGGKTKGLEMCATCGQILKNGDFRTHMSSHTLENHFPALGKANAQLPRN 938
222 0.000e+00gi|1000747060|ref|XP_015596304.1| PREDICTED: zinc finger protein 598 [Cephus cinctus]  clstr ali  35  12.............................................NTCVVCYKNVEIFSIGKCDHPVCHECSTRMRVLCRQNECPICRQDLPKVVFTRNIKPFRHLRKGN---LLDARYNIYFDSEDLQEKFVMLLAHTCTMCERQVFSNFTSLKDHMRRTHELHYCELCVENLKIFSHERRCYTRSDLAQHRRKGDLDDKSHKGHPLCEFCDQRYMDNDELFRHLRKDHLYCHFCDADGLHQYYSSYDYLRDHFRLEHFLCEEGSCATEEFTSVFRTDIDLKAHKASTHGKQLGKAAAKQARTLEFEFTLAPRGDNRNHRRPPGSHSARNSRDYNSLAEQEPMFVRQPSVDVQSTQEFPTLGNASAPNVAQQKSRGNVTIRSTLRPQPLSVTDENFPALGPESTSTGTISKTVNLSVSSSNKPGPSRMQRQQGTSSNLSIRVNHKPNGTVTTRVSGPNIRIRPSTLSMDSDFPALGHAEPSTSTNTAQWTKVTCLKPAQNPTTKSKKVQSGEDFPSLLKPSKSKKQSTISVVPATPTWTQPQCSDNSEAKTTNDVMXXXXSGSKTNSNSMPAEKETSKKTNDTSKKTKTSSKNDNTNNKTRNTPSTSTDCQENSVRFGKTTETTKKDEEQXXXXXXXXXXXXXEDTTPSAXXXXXXXXXXXSLNSTINNINKPEDFPALGTNTSRPPGFTNPPPGFTSAPLPPPLTFTNSSGESYSILPNSYSYVPPPDFPKRNKNLVAKVTEVLGQQEQIDEFRYLSGLFRQGTCSAEDYYNHCRDAMGSAFGSVFSELLVLLPDIDKQQELFKVHKKE-------GAGKVKGLEMCATCGQVLKNGDLRAHLSSHTLENHFPVLGKAAPVQN.. 932
223 0.000e+00gi|158285115|ref|XP_308151.4| AGAP007725-PA [Anopheles gambiae str. PEST]  clstr ali  39  3.......................SKRQQTTTQEKNVSDVETTET--LCVVCFKPIVYFAIGECDHLCCYECSTRIRVLCQQNDCPICRRDLAKVIFSKTLTPYQQLDVKNRSGLYDKKYRICFTDAEVQHAYFDLLDYKCPRCDQKNFPKFELLREHVRKKHELFYCDICTEHLKVFSSERRCYNRQELALHRRKGDPDKVGHRGHPLCEYCDTRFLDKDELFRHLRKDHFFCHYCDADGRNYFYGDYASLRDHFRADHFLCEEGECEQEQFTSVFRTEIDLRAHRASVHGKSMNRLANKQTRTLELEFTYAPRSATGRSAGSGTSGETLQHELDNLELTNDQTSKLHPKKVIDATSEQDFPTLGGSAPNPVFRPNNVTIRQRVYGTAGLARTKENFPALGSGGGETTGPTSLNEGFSSKITASSLLKPSQPTSSAGTSMMIHVSNRPSGSSTGKSNGASVGSMIGKKNSSDFPALPGSSSKALTGSNKNDRSGNSSMVNLNAISAKHRALVDDYVSVSSVASKVTTISAKDLKKNASATVQGTVPSKPGTAGGGSQTTAGSSSSKKKPMPAPQLKDDTGFVNLNALTGKKSGEKMKQKDLSTVNSADTRNNNSESVSKGGGGGAKDRNKEQQQKQQQHSKSNGQSSAATQSSPTNNNNIPSSLNSSFPVRTPPGFENVNLKRMPGPPPGFGNVTLNSVARNANNMTFTNSTGESYNILP-TYSYVSPSNASKRNQVLVTHFQRALKSQDALMEFRTISQMFRDGQYEASAYYEHCRVALGDRFHEIFPELIALLPTISKQQELYLVYCQDENNRPKSFGKGKASLEVCQVCKQVLIQDDLTEHYQTHYMENNFPKLGKV....... 880
224 0.000e+00gi|925670837|gb|KOX68728.1| hypothetical protein WN51_06965 [Melipona quadrifasciata]  clstr ali  33  1....................................MSASNESTNNTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCCQNECPICRQDLPKVVFTKEIKPFRYL---HKGNLLDTRYNIYFDTSDIQNKFYDLLANVCFICERPVFSIFSSLKDHMRHHHELHYCDLCVENLKIFSHERRCYTRSDLAQHRRKGDIDDKSHKGHPLCEFCDQRYMDNDELFRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHFLCEEGMCAEEKFTSVFRTDIDLKAHKASVHSKQLSKAAAKQARTLELEFTLAPRGENRMNRRGEYQQTATSNFSNVFMPNNESTFAQKPSVDVQSTEEFPTLGNTAPIVPTQSKGRGNVTIRSTIRPQPLAVTDENFPALGPESGNTSISKTVN--FXXXXXXXXXXXAQSQKGTTSNLSIQVNHEPNGTVTTKVSGPNIRIRPAQLSMES-FPALGSAEPSTSSNTNSAHWWTCSKSASTSIPKAKKVASPPLIPSPPPIQSGEDFPTLSKSNNAKTTTDMTKGKTKKKKVRQXXXXXXXXXXXXXXSKTNVSTVVVKKEYETPRSPPSTNNTDVAQSTSQSMQNADISNSEDTSKDVNVQVLKKVEQNNKKEKKKHKNIDNEAAVNTDIDNNTTNGVQRKRTELKIDSLNSTNRNARHLEDFPALSGSSSKPPGFTNXNNSNGLTFTNSSGESYSILPSAYNYVPPPEFQKRNKCLVAKVNEVLIQDDQIKDFRYISGLFRQGTCNAQDYYTHCREVMGSAFENVFPELLVLLPDIEKQQELFKVHKKE-------SGNTIKGLEICATCGQVLKNGDFRTHMTSHTLENHFPVLGKNNVLPQKN 878
225 0.000e+00gi|507659436|ref|XP_004705858.1| PREDICTED: zinc finger protein 598 [Echinops telfairi]  clstr ali  27  25..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELHQVVFGKKLPAFATISLQQL--QHEKRHDIYFTDSQVFALYRQLLQHECPRCPAPPFGLFGDLEQHMRRQHELFCCKLCLKHLKIFTHERKWYSRRDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYTYLREHFREKHFLCEEGRCNLEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSFTPRHPRRGDGVIGGEDYEEVDRYNRQGRARGAQQSRRGSWRYKREEEDRDVAAAIRASVAAQQQDEKHRKDAREEGARAKEEAVGRSSEPRGTRHPLRPQGEGSGAKEVAANGPVSQEASQTSGPASGALSAPPVAGSGPAGRTPAYPMATRDRGTFQEDDFPALVSSAARPYASHTSIISAWNSSRKGALXXXXXXXXXXXXSSARKSGKASSKGAPRGGPPPVEEETPQEPPSLPIVPPAASQLATVQASTKVGRKKKVGSEKSAALSSSPSARTGKAPDKALPEAEQLPEPAAVTLNGHVEGLALACGSTPKEXXXXXXXXXXXXCLIPQEDFPALXXXXXXXXXXXXXFNTAVLLKPVSPLPPPGTPMSKPPPGFAGLLPSPQLTCVPSTRT------KAPNPTVPPQAYLVPENFRERNLKLIQSIRDFLQSDEAFRKFKSHSGEFRQGVTSAAQYYQSCRDLLGESFLKIFNELLVLLPDTAKQQELLSAHADFRGHEPLPGTKAKKDCCVCPTCQQVLAHHDVQSHQALHAADDDFPSLQAIARVIT.. 878
226 0.000e+00gi|635030058|ref|XP_007980279.1| PREDICTED: zinc finger protein 598 isoform X3 [Chlorocebus sabaeus]  clstr ali  29  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFASI--PIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHYLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYAPRHSRRNEGVVGGEDYEEVDRY--------SRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDREEGGRPKKEEVAVXXXXXXXXXXXXXXTQGEGPGPKETSTNGPVSQEAFPVTGAATPCTLPPPSPK----LKDEDFPSLSASTSSCCSTAATPGPVGLALP----------YAIPARGRSAFQEEDFPALVSSVPKPGTTPTSLVSAWNXXXXXXXXXXXXXXXXXXSEKPGTTLPQPLPAS--------CPPGPMQAPEAPASRAEGPVAVVVNGHAEGPAPARSAPKEPPGLPRPLGSFPCSTPQEDFPALXXXXXXXXXXXXXFSAVVKGTXXXXXXXXXXXXSKPPPGFSGLLPSPHPACVPSPTTTATTTKPPRPP-PALQAYLVPENFRERNLQLIQSIRDFLQSDEAFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVFNELLVLLPDTAKQQELLSAHTDFCNREKPLGTKSKKDCRVCPTCQQVLAHGDASSHQALHAADDDFPSLQAIARIIT.. 831
227 0.000e+00gi|752860175|ref|XP_011250478.1| PREDICTED: zinc finger protein 598 [Camponotus floridanus]  clstr ali  34  9...........................................NSNTCVVCYKNVDIYSIGMCEHPVCFECSTRMRVLCRQNECPICRQDLPKVVFTQEIKPFNSL---TMTNLLDTRYDIYFTSLDIQEKFTELLANTCSICEKLVFSSFNSLKDHMRQRHELHYCDLCVENLKIFSHERRCYTRSNLATHRRKGDVDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHYLCEEGVCAEEKFTSVFRTDIDLKAHKASVHGKQLSKAAAKQARTLELEFTLAPRGENRMNRRRDYQQTSVPSGSNSFVSNNEPTFTRQPSVDVQSTDEFPTLGGNAATPVVPTLTQTKSRIRSTVRNQPLAVTDENFPALGLDSAGPGISKTVNFXXXXXXXXXXXXAQCQKASASSNVSIQVNHEPNGIVTTRVSGPNIRIRPAQLSIDSDFPALGSTEPSTSTANSTQWQWTCSKSTPANAPAKSKRQSGEDFPSLTPKSKSKKQSIITVVPSWGQNSQNSSNNAKTMDXXXXXXHCVISKENSQTTQGSNNVTSNDNSSKITSVQNSKESEHANKKDKRKSKSNVDGNSGIAVINTESESGSNAASNGEKQRKRSELKIDSLNTTNNNIHRSEDFPALGSTSNTSRPPGFTNPPPGFASSTLPPPGFTIKYNSIDKLHGSNGLTFTNSSGESYSILPDNNSYVSPPDFQKRNTCLVAKLNEVLIEQDKIEEFRYVSGLFRAGTCDAKEYYTHCREVMGTNFESVFPELLVLLPDIVKQQELFKVYKKEV-------GGRTKGLEMCATCGQILKNGDFRMHMSSHTLENHFPALGNKSNTPPP. 919
228 0.000e+00gi|731503738|ref|XP_010595806.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 598 [Loxodonta africana]  clstr ali  28  26..............................................SCVLCCGDLEVMALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFTTI--PIHQLQHEKKYDIYFADRKVFALYRQLLQHECPQCPTPPFGLFGDLEQHMRRQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSMEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHLRRGEGVIGGENYEEVDRYNRQAGIRGAQQSRRGSWRYKREEEDRDVAAAIRASVATQQQEERRRSEDCKEGSRAK---EEVVAQVSEEPHGVRHPPCTQG-----------EGPGSKEASTNGPMSQEAFPPSSPAVGVPPPSILPPVPKLK-DEDFPSLSACSAPATP-ASAGLALPYPVPARGRGTFQEEDFPALVSSASRPSTAPTSIISAWYSSKKALASSQAITKGSRKKKVGSEKPRATPPPPLDHTPKAPDKDGLP-----------GAEEVPTIPTGRAEGPAAVIINGHAEGPALACGAPKEPPRLPWSLGPLPCPTLQEDFPALXXXXXXXXXXXXXFNTVVLLKGATXXXXXXXXXXXSKPPPGFSGLFPSPQPSC----VPNTTTKAPRLSPPPRAYLVPENFRERNLKLIQSIKDFLQSNEAFSKFKSHSGEFRQGVISAAQYYKSCRDLLGESFQKIFNELLVLLPDTAKQQELLLAHADFHSHEKPPGQTAGLDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARVIT.. 832
229 0.000e+00gi|751449049|ref|XP_011178739.1| PREDICTED: zinc finger protein 598 [Bactrocera cucurbitae]  clstr ali  51  5.......................EKSADDAANNASKQPTSEETEHDGCVLCCKEVEIYSIGECDHPICYECSTRLRVLCEQNECPICRQVLSKVIFSFDKLPYRTLEAKNRSGYYSKKYKIGFYTAKIQQAFFNLLDHPCPKCNVPPFRRFKDLEYHVRKEHDLHFCDLCTEHLKIFTFERRCYTQAELGLHRTKGDRDNRSHRGHPLCEFCKKRYLDRDELFRHKRRDHYFCHFCD-DESNDFYRDYDALANHFRERHFLCEEGRCATEQFIGAFRTEIDYKAHFASAHGNTLNKQEAKKTRTVQLEIRPARPGLPDGGITNVRSRVPDDYNAPAESSTSQAAQQRSITIDRSNEEDFPSLAGTSGGPSMPLVPATFTRLR--SGASGLARTKENFPALGAGGGGEISDQRSQQSAPPISTVLRKAPAVSKGAISRSSGGNAASNGSTGMVLHVSNRPTASVNSKKSHALDFPALPASKKQPLRNPIDEDMLPSGAHIPFSNVSAKHRQLVDDYVSVANASSFQKIQTVQKEELEAKTRKAAEQASAPKLTSQDFPSLGLGAASRSNQVQANNWAK----AQKQERASDKRQRELENRKAKVAPAPLLPKENNNKQSVNATNKKQTQPTTTNNKVSTNATETSVKRGQSSTSPTSSLDNGTDNEGAPQMRPPPGFAQSSANTLPPPGFQTTDVTVNSIAKSPNNLTFTSSFGERYSIV-RTHPYIQPPEAVTRNQKLVSHFQDALKTPEAMEEFRHISQKFREGVYKTLPYYEHCQAALKDRFDDIFPELLVLLPDLNKQQELYLVHTQRLNKLSPEERKKTQKLDVCGICKQVLMSSDLQNHRKQHELKENFPVLGDVNSGS... 891
230 0.000e+00gi|47847410|dbj|BAD21377.1| mFLJ00086 protein [Mus musculus]  clstr ali  28  34..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFALI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCPHPPFSLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSFAPRHSRRQQNRRGSWRYKREEEDREVAAAIRASVAAQQQEETQRVEDREEGSRPKKEEAAARVPEEPRGHRRLPRAQGEGSGSKEASANGPQEAFPATGPGPVVALSNTLPPPSPELKEEDFPSLCASTSSCCTAVTPGSVGLALAYPGPPRGKNTFQEEDFPALVXXXXXXXXXXXXLISAWNSGC------SKKGNLPTPGSQAVVGGSQPPRKAGKGSRGGRKGGPAPVDEEDSGGLTVQGLRSVPTTVAVSSLLAPATNQSSAKVGKKKKVGSEKPGATSSPLLPPDHTPKPSGAEQVLEAPLSKAE----------VPLGPLPCPIPQEDFPALXXXXXXXXXXXXXFSTVVLLKGTXXXXXXXXXXSKPPPGFSSLLPSSHSACAPSPXXXXXXXXXXPGLAPTPQAYLVPENFRERNLQLIQSIKDFLQSDEAFSKFKSHSGEFRQGMISAAQYYKSCRDLLGESFQKIFSELLALLPDTAKQQELLSAHTDFCSREKPPNSRSKRDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARIIT.. 888
231 0.000e+00gi|34147169|ref|NP_898972.1| zinc finger protein 598 [Mus musculus]  clstr ali  27  26..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFALI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCPHPPFSLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSFAPRHSRRQQNRRGSWRYKREEEDREVAAAIRASVAAQQQEETQRVEDREEGSRPKKEEAAARVPEEPRGHRRLPRAQGEGSGSKEASANGPQEAFPATGPGPVVALSNTLPPPSPELKEEDFPSLCASTSSCCTAVTPGSVGLALAYPGPPRGKNTFQEEDFPALVXXXXXXXXXXXXLISAWNSGCSKKGNLPTPGSQAVVGGSQPPRKAGKGSRGGRKGGPAPVDEEDSGGLTVQGLRSVPTTVAVSSLLAPATNQSSAPGATSSPLLPPDHTPKPSGAEQVLEAPLSKAEVPVTIVVNGHSEGSALVRSAPKEXXXXXXXXXXXXCPIPQEDFPALXXXXXXXXXXXXXFSTVVLLKGTXXXXXXXXXXSKPPPGFSSLLPSSHSACAPSPXXXXXXXXXXPGLAPTPQAYLVPENFRERNLQLIQSIKDFLQSDEAFSKFKSHSGEFRQGMISAAQYYKSCRDLLGESFQKIFSELLALLPDTAKQQELLSAHTDFCSREKPPNSRSKRDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARIIT.. 908
232 0.000e+00gi|637361739|ref|XP_008120356.1| PREDICTED: zinc finger protein 598 [Anolis carolinensis]  clstr ali  27  24..............................................CCVLCCGELEVVALGRCDHPVCFRCSVRMRALCNGRYCAVCREELDQVVFGRKLTSFSTINL--SQLQHDKKYDIYFTDGKVYALYRKLLQHECPLCDARPFATVVDLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNEGVVSGEDYEEVDRYSRQMRGTRGQQNRRGSWRYKREEEDRDIAAAVRASVAAKRQEEKKRGEEKEESIRGKKEDAKDPDLNTSKRGPKPAPAPKEALPNAVLSQEDFPAIGTPVVGCLQSSSQPAPVKLDXXXXXXXXYTATAKRSAFQEEDFPALVSRVQPNPVSALTSAWSCSSGKNVARTVAAVNPSQPPRKAAPSGGAKGGKKTKRGGLTTQEIRAAPTMVDVSSLLATSSSQGFIRVGRKKKVGAEKLKAASPPTLQDAAPDLALGEKGPDAKLSPDLPPAATV-VNGHSEKAFLPSQASKEPPGLKKPPAPNQTLLPQEDFPALGNAGPPRMPPPPGFNSVVLLNPLPPPGLSGPLSK------------PPPGFVPIAPVPDTAPVPPKEPKPCQGPYLILENFQQRNIQLIQSIKEFLQDDEQFNKFKTYSGQFRQGQISAEQYYRSCQELLGENFRRIFSELLVLLPDTAKQQELLATHNEARAKAGKPRKNPRKDCCVCPTCQQVLTPQDMASHKALHLEEEEFPSLQAISRII... 871
233 0.000e+00gi|585688424|ref|XP_006893936.1| PREDICTED: zinc finger protein 598 [Elephantulus edwardii]  clstr ali  27  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PLHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCPAPPFGLFGDLEQHMRRQHELFCCKLCLKHLKIFTHERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDTEGAQDYYSDYTYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRHIDLQFSYAPRHQRRGEGVISGEDYEEVDRYNRQGRPRGAQQSRHGSWRYKREEEDRDVAAAIQASVATQQQEEKRRNEDHDDAETGGRVFEEPQSAWRPLRDHCEGPGTKEASSNGPMSQEAFSASGQATVVPPSLSSGQALTATGPVGLALAYPVPTRARGAFQEEDFPALVSSGSRFSAVSTSIISAWNSSKKVAQPASGTQVARAGLSAXXXXXXXXXXXXXXXQAPTEEQEVTLPEQHSSPAAAPSSHTVTKGGRKKKVGSEKPRATSPQSPERIPKAPDKVGPPGVQQHPASRVEVSATGLLNGHVEEVGMPHIAPKEXXXXXXXXXXXXXXASQEDFPAL-SPCPPRMLPPPGFNTVVLPKGAPPPPGLAPPVSKPPPGFSSLLPGSQPASVPSTTTKVPRPMPSPS-----QVYLVPENFRERNLQLIQSIKDFLQSDEAFQKFKSHSGEFRQGIISAAQYYKSCRDLLGESFQKIFKELLVLLPDTAKQQELLLAHADFRSHERPSTPTAGLDCCVCPTCHQVLAQGDLSSHQALHTADDDFPSLQAITRVIT.. 884
234 0.000e+00gi|951575329|ref|XP_014485601.1| PREDICTED: zinc finger protein 598 [Dinoponera quadriceps]  clstr ali  35  9...........................................NSNTCVVCYKNVEIYSIGMCEHPVCYECSTRMRVLCRQNECPICRQDLPKVVFTREIKPFRYLCKGNLI---DDQYAIYFGSPDIQEKFNDLLANTCSMCEKQVFGSFNSLKDHMRHQHELHYCDLCVENLKIFSHERRCYTRASLAQHRRKGDLDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLREHFRQEHYLCEEGVCAEEKFTSVFRTDIDLKAHKASVHGKQLSKAAAKQARTLELEFTLAPRGDNRINRRGHCNNSRDYQQQQPSSSFDPPFFVRQPSVDVQSTDEFPTLGNAAPVVVPTLTQSKGRGNRSTVRNQPLAVTDENFPALGPDSAGISKTVNFSVTSNAAGMAQCQK-------ASSNVSIQVNHEANGTVTTRVSGPNIRIRPAQLSIDSEFPALGNSEPSTSTANSTQWKQWTCSKSAPTSASKKVPPLSSSPIREDFPXXXXXXXXXXXXVITVVPTWGQNASTNNNAKTTTDLTKGRTKKKKVKQQTXXXXXXXXXXXXXXXXXASKRDAEQTRESKESSNACKTTEHASRKDKKKNKNNVAEPGGGDTNGVQRKRSELKIDSLNTTNNNIHKVEDFP-ALGSSSSRLSNXXXXXXXXXXXXXXXXXXKYNSLDRLHGSNGLTFTSSSGESYSILPPAHAYASPPDFQRRNTCLVARLNEVLLHQDKIDQFRYVSGLFRGGTCDAEEYYTHCREVMGSAFENVFPELLVLLPDIAKQQELFKVHKRELA-------GKAKGLEVCATCGQVAKNGDFRAHMSSHTLENHFPALGKSSTPPLKN 839
235 0.000e+00gi|831227778|ref|XP_012661304.1| PREDICTED: zinc finger protein 598 isoform X1 [Otolemur garnettii]  clstr ali  26  30..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PLHQLQHEKKYDIYFADGKVFALYRQLLQHECPRCELPPFSLFGDLEQHMRKQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFIYAPRHSRRQQSRRGSWRYKREEEDREVAAVIRASVAAQQQEETRRSEDREEGSRPKKEETAARGSEEPRGPRRMLRTQGEGPSARETSTNGPLSQETFATGASP---MSTLPSPAPKLKDEDFPXXXXXXXXXXXXXXXPGPVGLALVYPIPRDRNTFQEEDFPALVSSGSKPSAAATSLISAWNSNCSPSPAAQAAGGGSQPTRKAGKGSRGKKGGPPATEEEERGQELRSVHTIVSVSSPLGPASTQTSTQTSKIGKKKKVGSEKPSATSPQPLPLSCTPKSQAPDIPTSRAEGPVGIVNGHAEGLSLARSTPKEXXXXXXXXXXXXCPTPQDDFPALXXXXXXXXXXXXXFNTVVLVKXXXXXXXXXXXXSKPPPGFSGLLPSPHTACVPS----PTNTTKAPRLPPIPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSKFKSHSGEFRQGVISAAQYYKSCRDLLGENFQKIFNELLVLLPDTAKQQELLSAHTDFRSREKPPSRQVGLDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARIIT.. 907
236 0.000e+00gi|119605977|gb|EAW85571.1| zinc finger protein 598, isoform CRA_c [Homo sapiens]  clstr ali  26  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRHIDLQFSYAPRHSRRNEGEGCLLAAGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQEAFSVTGPAAPALPYAIPARGRSAFQEEDFPALVSSVPKPGTAPTSLVSAWNSSAQPPLSAQATGSGQPTRKAGKGSRGGRKGGPPFTQEEEEDGGPALQELLSTRPTGSVSSTLGLASIQPSKVGKKKKVKPGTTLPQPPPATCPPGALQAPEAPASRAEGPVAVVVNGHMEGPAPARSAPKEPPGLPRPLGSFPCPTPQEDFPALXXXXXXXXXXXXXFSAVVLLKGTXXXXXXXXXXXISKPPPGFSGLLPSPHPACVPSPATTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEAFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVFNELLVLLPDTAKQQELLSAHTDFCNREKPTTQQAGLDCRVCPTCQQVLAHGDASSHQALHAADDDFPSLQAIARIIT.. 935
237 0.000e+00gi|769850621|ref|XP_011636730.1| PREDICTED: zinc finger protein 598 isoform X2 [Pogonomyrmex barbatus]  clstr ali  33  11.............................................NTCVVCYKNVDIYSIGMCEHPVCYECSTRMRVLCRQNECPICRQDMPKVVFTRDIKSFHSL---TGTNLVDTRYDIYFSNLDIQEKFTELLANTCSICEKTVFSSFNSLKDHMRQRHELHYCDLCVENLKIFSHERRCYTRSSLATHRRKGDVDDKSHKGHPLCEFCDQRYMDNDELYRHLRRDHLYCHFCDADGLHQYYSSYDYLRDHFRQEHYLCEEGVCAEEKFTSVFRTDIDLKAHKASVHGKQLSKAAAKQARTLELEFTLAPRGENRINRRGMYQQGSIPSSSSSFASNNEPTFIKQPSVDVQSTDEFPTLGGNAAPPVIPTLTQPKSRIRSTVRNQPLAVTDENFPALGPDSAGPSISKTVNFSVSSSSNATGSSPQCQKASASSNVSIQVNHEPNGTVTTRVSGPNIRIRPAQLSIDSDFPALSSSEPSTSTANSTQWKQWTCSKSASANASKSKKIIPSSSISTPPIRSGEDFPSLFKSSKSKKQSVITVVPSWGQNSQNTNNTQNSSISNSTKTMDQTXXXXXXXXXXQAXXXXXXXXXXXXXXXXXISTVVKKDIELAHTDSDNSRIASKESSRAMHDINSDIGGDNKNSRNTTNNNIHRAEDFPVLSSASSRPPGFTNXXXXXXXXXXXXXXFSIKYNSFDGLHGGNGLTFTNSSGESYSILPSKHVYVSPPDFQKRNTCLVAKLNTVLVEQDKIEEFRYVSGLFRGGTCDAQKYYMHCREVMGANFESVFPELLILLPDIVKQQELFKVHKREM-------GGKTKGLEMCATCGQILKNGDFKTHMSSHTLENHFPALGKNNTPSPKN 885
238 0.000e+00gi|602666486|ref|XP_007438818.1| PREDICTED: zinc finger protein 598 isoform X1 [Python bivittatus]  clstr ali  27  11........................................SADGPGSCVLCCGELEVVALGRCEHPICYRCSVRMRALCGVRYCAVCREELAQVVFGKKLPPFSTIIL--SQLQHEKKYDIYFTDGKVYALYRKLLQHECPLCESRAFPTIVDLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRSEGVVSGEDYEEVDRYNRQSGPRGGQQNRRGSWRYKREEEDRDIAAAVRASVAAKRQEEKKRVEDKEDNSRAKKEDAKDPDATNSKRGLKPSSEAPVPKAALSQDDFPAIGSPAVNSVQSSSQLASSSAPPVVSAAMPLSYTATAQKTAFQEEDFPALVSKVRPGSKMVSTLASAWSGGSSKTATASSASQPTRXXXXXXXXXXXXXXXVMLSNDTQDSGGSVPTMVDVSSLLAASNSQTFVKVGKKKKVGTEKLRTASPPTLQEMPASLPSAEKAADAEHPSTVAASPNLPSNGHSEKSMLLCNASKEPPGLKKPPVGGQCLLPQEDFPALGNAGPPRMPPPPGFNSVVLLXXXXXXXXXXXXXXKPPPGFT---------PIPATSISENAPAPVKEPKLCQGPYLILENFQQRNIQLIQSIKEFLQEDEQFNKFKTYSGQFRQGLISAAQYYKSCQELLGENFKKIFNELLVLLPDTAKQQELLSAYNDLKVKAPQTEPASDLDCCVCPTCQQVLTQQDLVSHQALHLEEDEFPSLQAISRII... 885
239 0.000e+00gi|498936923|ref|XP_004520534.1| PREDICTED: zinc finger protein 598 [Ceratitis capitata]  clstr ali  50  2....................SSSEKSVNDTACDVNKQVTSEDTEHDSCVLCCKEVEIYSIGECDHPICYECSTRLRVLCEQNECPICRQVLSKVIFTFDKLPYRELEAKNRSGYYSKKYKIGFYTAKIQQAFFNLLDHPCPKCNVPPFRRFGDLEYHVRREHDLHYCDLCTEHLKIFTYERRCYTQAEIGLHRTKGDRDNRSHRGHPLCEFCKKRYLDRDELFRHKRRDHYFCHFCD-DESNDFYRDYDALANHFREHHFLCEEGRCATEQFIGAFRTEIDYKAHFASAHGSTLNKQEAKKTRTVQLEITLGRRPGLPDGGITNVRSRVPDDHYNDHSDTSSSQAAQQRSIDRSNEEDFPSLRGTSGGPSVSLVPATFTRLR--SGASGLARTKENFPALGASGGGETKTTQQSPAPISTVLRKAPAV----SKAVANRSAGGNGGPNGSMVLHVSNRPTSSVNPNSGAVSDFPALPASSKSTSRAALEEDMLPSGAHIPLTNVPAKQRQLVDDYVSVANASSFQKIQTVQREELEPKNRKAGELANAPKLTSQDFPSLGPASSGKSNQAQPNSWVKGQKLSDKRSKESNKQTVNATNKKQTQQPTAANKISTNSADNNTTXXXXXXXXXXXXXSNPENIKSQQNSNGKVKEKNNNVNKHPPKPEEHTTSPPPPGFGNVPFSTQPPPGFQSTNVTVNSVAKSPNNLTFTNSFGEKYSIV-RTHPYIQPPDAATRNQKLVSHFQDALKTTAAMEEFRQISQKFREGVYKTLPYYEHCQAALKDRFDDIFPELLVLLPDINKQQELYLVHSQNLNKLSPDERKKIQKLDVCAICKQVLMPNDLESHQKQHELKENFPTLGDVNNGS... 884
240 0.000e+00gi|586487067|ref|XP_006874016.1| PREDICTED: zinc finger protein 598 [Chrysochloris asiatica]  clstr ali  26  29..............................................SCVLCCGDLETTALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEPKYDIYFADEKVFALYRQLLQHECPQCPAPPFSLFGDLEQHMRRQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYTYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHPRRGEGVIGGEDYEEVDRYNRQAGARGAQQSRRGSWRYKREEEDRDTAVVIRALVATQQQDEKRRVEDREGGPRARRVSEELRSGQRPPRAQGEGLGPKEVSTNGPMNQEPFPVPGPAPSAPAPPVQSSLGAGSGPAGLALAYHVATRARGTFQDEDFPALVSSVGRPSTTPTSIISAWNSSRKVARXXXXXXXXXXXXXQSIRKAXXXXXXXXXXXXXXXXHTSPEHQGTSPELCSLPTSAPSSSSQALAPSQPVTKGNRKKKVGSEKPGAMSPPPLDRTPKAPPTSGTEGPAAMAINGHMEGLALAHSGAPKEPPGLLRPPPCLTPQEDFPALGGPGALRMPPPPGFNTVVLLKGAXXXXXXGLVPTVSKPPPGFSGLVSSTQPVCVSSTNT----KAPRLTPPPRAYLVPENFRERNLKLIQSIKNFLQSDEAFSKFKNHSGEFRQGVIPAVQYYKSCRDLLGESFQKIFPELLVLLPDTAKQQELLAAHTDFCSHEQPSGARSKKDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARVIT.. 902
241 0.000e+00gi|846997352|ref|XP_004652041.2| PREDICTED: zinc finger protein 598 [Jaculus jaculus]  clstr ali  26  80...........................................................LGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPQCPQPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSFVPRHSRRQQSRRGSWRYKREEEDREVAAAIRASVAAQQQEETRRTEDREEGGRPKKEETAARGPEELRGPRRLPRTQGEGSGPKEVLTNGPLSQEAFPATGSVAATPSTLLPPTPKLKDEDFPSLCASTSSCCTTAATGSVGLALAYPGPTKGKNTFQDEDFPALVSSAPKPTASAWNSSCSKKGAPPTSGALAAAGGSQPSRKAGKGNRSSRKGGPPPVDEEEGGGRSVPTTVAVSSLLGPVSTQSSTKGNKKKKVGSEKPGATSSPLPPSDCTQKTPGADQGPEASTSKAEVPAAIIVNGHSEGPALARSTPKEXXXXXXXXXXXXCPTPQEDFPALXXXXXXXXXXXXXFNTVVLLKGTXXXXXXXXXXXXSKPPPGFSSFLPSSQPACVPSSTT--TMKTPRLPPTPRAYLVPENFRERNLQLIQSIKDFLQSDEAFSRFKSQSGEFRQGMISAAQYYKSCWDLLGENFQKIFSELLVLLPDTAKQQELLSAHTDFRGREKAPGAKSKKDCCVCPTCQQVLAHDDVSSHQALHAADDDFPSLQAIARIIT.. 937
242 0.000e+00gi|884784371|ref|XP_012983482.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 598 [Melopsittacus undulatus]  clstr ali  27  62...............................................CVLCCGELDVVALGRCDHPICYRCSVRMRALCGVRYCAVCREELAQVVFGRKLTSFSTIALNQL--QHEKKYDIYFTDGDVYALYRKLLQHKCSLCDVKPFNTFADLEQHMRKQHELFCCKLCVKHLKIFTYERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRQNRRGSWRYKRXVAQCGGSEYKIQRRREEEDRDIAAAVRASVAAKRQEERKRVEDKEDNSSRGRKEDVRDSEVLSSKRVPKSSIDATEAAANGALSRDDFPAIGSAAGPLQGSSQPAVVKLKPSLSSSAAPTISSGMSLTYTTTAKKAAFQEEDFPALVSKMRPNNKTVTNITSAWNNGSS-----KSVVKAISNPCVNQTAKKPSSSLNSTKGSKKSNKLPQSDDEDSGSGLTTQEIRNTPTMVAASTSQTFTKVSKKKKVGVEKQSPSSPRLSQDTAFPKASTEKLPEAEQTSSASSSALPNPDRPTAVVNGHSEKPLVVCSTPKEPPGLKKPTVTNKCPLPQSARMPPPPGFNTVVLLKNPPPPPGLSVPVSKPPPGFAVIPSTNITDPVTTSLKEPKPRHGSYLIPENFQQRNIQLIQSIKEFLQSDEKFNKFKTHSGQFRQGLISAAQYYRSCRELLGENFRKIFKELLVLLPDTAKQQELLSAHNDFRLKEKQSSSKPKKDCSICPTCQQVLTPQDVGTHKALHMEDEEFPSLQAISRII... 936
243 0.000e+00gi|634844881|ref|XP_007937851.1| PREDICTED: zinc finger protein 598 [Orycteropus afer afer]  clstr ali  27  25..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKRYDIYFADGKVFALYRQLLQHECPRCPAPPFAAFGDLEQHMRRQHELFCCKLCLRHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAHDYYSDYTYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYTPRHPRRGEGVVGGEDYEEVDRYNRQGRASRAQQSRRGSWRYKREEEDRDMAAAIRASVATQQQEVQRRSEDREEGGGRATEEVQGSEEPQGARRPPRTQGEGPGPKENSANGPMSQEAFPSSGPAVSLSSCPTLAAPGPAGLALAYPVPAGGRRAFREEDFPALVSAAARPSAAPTNIISAWNS--------SKKVARPSVGTQAAGGGQSTRKAXXXXXXXXXXXXQPPPEEEEVASQELRSSPEAPVPSKGGRKKKVGAEKPETSSXXXXXXXXXXXXXDSPPGAEQVPTAPAGVVTNGHVEGPALAHGAPKEPPGLPR---PLPCPTPQEDFPALXXXXXXXXXXXXXFNTKAXXXXXXXXXXXXXXXSKPPPGFSGLVPSPQPACVPSTTTKAPRLTPPP-----ARAYLVPENFRERNLTLIQSIKDFLQSDEAFSEFRTHSGEFRQGLISAARYYKSCRDLLGESFLRIFSELLALLPDTAKQQELLAAHAGFCSQERPPGARSKKDCCVCPTCQQVLAHGDVSSHQALHAADDDFPSLQAIARVIT.. 879
244 0.000e+00gi|966001439|ref|XP_014959344.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 598 isoform X1 [Ovis aries]  clstr ali  27  133..............................................SCVLCCGDLEATALGRCDHRCAXRCSTKMRVLCEQRYCAVCREELRQVVFGRTLPAFATI--PLHQLQHEKKYDIYFTDGRVFALYRXELQHECPRCERPPXSLFGNLEQHMRKQHELFCCKLCLRHLQIFTHERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYXYLREHFREKHFLCXEGRCSTEQFTHAFRTEIDLKAHRTACHXR--SRAEARQNRSDLQFRYPPRHPRGSGGERGPRHDRYNRQGRTGRASGRGAQQSRRGSWRYKREEEDREVAGAIRASVATQQQQQETRRTEDREEGGRPKKEERGPEEARGPRRPARTPGEGPGPKEASANGPISQEAFSTTGPAAGATLPNALPPPGPVGLALAYPVPARGRTTFQEEDFPALVPSASKPSSAPTSLISAWNSGASPAPGSQSTSGASQPPRKSXXXXXXXXXXXPLPAEEVEEDGRAGLTAQELRSVPTTVAVSSLLAGAATQTFTKVSKKKKMGSEKSGTASPPPPDREGPPGAELAPTAAPGRAENGHSEGPAPARSTPKEXXXXXXXXXXXXXXTPQEDFPALCGSCPPRMPPPPGFNAVVLLKGTPPPPGLAPPVSKPPPGFSGLPSSPHTACVPSTTTTT----KAPRPTPVPRAYLVPENFRERNLQLIQSIRDFLQSDEAFSKFKSYSGEFRQGVISAAQYYKSCRDLLGENFEKIFNELLVLLPDTAKQQELLLAHTDFRGREKPPGTKAKKDCCVCPTCQQVLAHGDVGSHQALHAADDDFPSLQALARILT.. 996
245 0.000e+00gi|507631456|ref|XP_004627935.1| PREDICTED: zinc finger protein 598 [Octodon degus]  clstr ali  28  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVFALYRQLLQHECPQCPQPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRMACHSR--SRAEARQNRQIDLQFSFTPRHSRRQQSRRGSWRYKREEEDREVAAAIRASVATQQQDETRKSEDHEEGSRPKKEEGAARGSEEPHGPRHLPRTQGEGPGPKEASGNGPVSQEASQGPGSLPPGPSTLLPPTPKLKDEDFPSLHASTSSCCPVTASGPIGLALVYPGATRGRNTFQEEDFPALVSSVVKPSTTAPSLISAWNSSAVPTPGAQATSGGGQPPKKPGKGSKGCRKADSVPVEEEEGGGLTVQELRAIPTTVAVSTLLGSASTYTSTKVSKKKKVGSDKPGAVPSPPVPPERTPNHPGASVSRAEGPVPVINGHTEGPASVRSTPKEXXXXXXXXXXXXYPTPQEDFPALXXXXXXXXXXXXXFNTVVLLKGAXXXXXXXXXXSKPPPGFSSFLPGPHPACVPSPTTTTV---KAPRLTPIPRSYIIPANFQDRNLKLIQSIMVFLHSDKAFSKFKSHSGEFRKGMISAAQYYRSCRDLLGENFQKIFSELVLLLPDIAKQHELLSAHTDFCSREKPNTQRMGLDCCVCPTCQQVLGHDDVSSHQASHAREDDFPSLQAIARIIT.. 908
246 0.000e+00gi|795225059|ref|XP_011888737.1| PREDICTED: zinc finger protein 598 isoform X1 [Cercocebus atys]  clstr ali  26  28..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYAPRHSRRNEVTGCLLAAGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDREEGGRPKKEEAAVXXXXXXXXXXXXXXTQGEGPGPKETSTNGPVSQEAFPVTGPATPCTLPPPSPRGRSAFQEEDFPALVSSVPKPGTTPTSLVSAWNSSAQPPPSAQATGSGQPTRKAGKGSRGGRKGGPPLTQEEEGGSPAAQELLSTCPTGSISSPPVSIQPSKVGKKKKVGSEKPGTTLPQPLPASCPPGPMQAPEAPASRAEGPVAVVVNGHTEGPAPARSAPKEPPGLPRPLGSFPCPTPQEDFPALXXXXXXXXXXXXXFSAVVKGTXXXXXXXXXXXXSKPPPGFSGLLPSPHPACVXXXXXXXXXXXXXXXX-XALQAYLVPENFRERNLQLIQSIRDFLQSDEAFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVFNELLVLLPDTAKQQELLSAHTDFCNREKPTTQQAGLDCRVCPTCQQVLAHGDASSHQALHAADDDFPSLQAIARIIT.. 906
247 0.000e+00gi|947221176|ref|XP_014442518.1| PREDICTED: zinc finger protein 598 [Tupaia chinensis]  clstr ali  27  26..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFASI--PIQQLQHEKRYDIYFTDGTVFALYRQLLQHECPQCELPPFSLFGDLEQHMRRRHELFCCKLCLEHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSR--SRAEARQNRQIDLQFSYAPRHSRRSEGRRGSWRYKREEEDREVAAALRASVATQQQEEARRSEDREEASKPKKEEAAVRGPEEPRGPRRLPRTQAEGPGPKEPSTNGPTSQEAFPNSATGAAPPSILLPLTPKLKEEDFPSLSASTPSSCSAGAPGPGGLALPYSASARSRRTFHEEDFPALVSSAVKPSSTPAGVNSAWSSSCSQKVAQPTTGAQAASGGGPPTKKAGKGSRGGRKGGPPTAEEEGLRSQPALATVSSLGLAPAQTSKVGKKKKVGSEKPGATVPLPVPLDCTPSPPKAEQEEAPTSRAEGPAAVVNGHTEGLALARSAPKEPPGLARPMGPLPCPTPQEDFPALXXXXXXXXXXXXXFNTKGTXXXXXXXXXXXXXISKPPPGFSGLLPGPHSACTPS----PPPATKAPRPTPVAHAYLVPENFRERNLQLTQSIKDFLHSDEAFGEFKSRSGEFRQGVISAAQYYRTCRDLLGQDFQKIFRELLVLLPDTAKQQELLSAHTDFRSQEGPPGPRSKRDCCVCPTCQQVLAHGDAGSHQALHAADDDFPSLQAIARVLT.. 891
248 0.000e+00gi|641800460|ref|XP_008163080.1| PREDICTED: zinc finger protein 598 [Chrysemys picta bellii]  clstr ali  27  16...............................................CVLCCGELEVVALGRCDHPICYRCSVRMRALCGVRYCAVCREELGQVVFGRKLASFSTI--PINQLQHEKKYDIYFADGKVFALYRKLLQHECPLCDVRPFNTVVDLEQHMRKQHELFCCKLCVKHLKIFTHERKWYSRKDLARHRIHGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQEYYSDYEYLREHFREKHFLCEEGQCSTEQFTHAFRTEIDYKAHKTACHSK--NRAEARQNRQIDLQFNYAPRHQRRNEGIVGGEDYEEVDRYNRQGRPRGGQQNRRGSWRYKREEEDRDIAAAVRASVAAKRQEEKKQFEDKEDGSRGKKEELRDPEVSNTKRVPKPSPKEAAANGALSQDDFPAIGSAAGPLPRSAQPSLSSSAAPTIASGVSLTYTVAAKKTAFQEEDFPALVSKMRPNARTVSNITSAWS----NSSNKSAVKAVTSLSSSSNHLAKKPAPSNSNKGSRKSGKLSLSDDEDSGSGLTTQEIRNTPTMFDVSSSTSQTFTKVSKKKKMGVEKQRASSPQLPEETLPPASALENLAEAEQTPSAPANLHLPDRSAAVTNGHVEKSVAICSASKEPPGLKKPPVTNQCPLSQEDFPPPPGFISVALLKSPPPPPGLSVPVSKPPPGFTVIPSTNVSDPATTSLNEPKPCRGSYLIPENFQQRNIQLIQSIKEFLQSDERFNQFKTHSGQFRQGLISAAEYYQSCRELLGENFTKIFNELLVLLPDAAKQQELLSAHNDFRIKEKQGASASALDCCICPTCQQVLTQQDMASHKALHIEDEEFPSLQAISRLI... 883
249 0.000e+00gi|617624623|ref|XP_007528151.1| PREDICTED: zinc finger protein 598 [Erinaceus europaeus]  clstr ali  28  16..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATI--PLQQLQHEKKYDIYFADGKVLALYRQLLQHECPRCELPPFGLFGDLEQHMRKQHELFCCKLCLKHLKIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDTDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRMACHSR--SRAEARQNRQIDLQFSYTPRHSRRGDGRRGSWRYKREEEDREVAAAIRASVAALQQPELRRGEDGEEGGRPKKEEAGQRRPEEPRGSRRVPRTQGEGPGPKDTSTNGPISLEALPVTGLAGVAPLPSTHLPPPVKLKDEDFPSLCASSSSAAPAPGPVGLSLAYPVPARGKTAFQEDDFPALVSSASKPSLAPTSLLSAWNSGAGKKVAQPSPGPPTAMGGS----QXXXXXXXXXXXXXXXXPAPVEEEESRGAPTSGSSSGSLLPLASQPFTKVGKKKKSSEKPGATAPPTPPDKDEEAPPAPNSQAESSATVIVNGHTEGPVLARTTPKEXXXXXXXXXXXXXXXXQEDFPALGSPCPPRMPPPPGFNTVAXXXXXXXXXXXXXXVSKPPPGFSSLVPSAHPVCVPSTIGTTPTSTKAPRPTPELQAYLVPENFRERNLQLTQSIRDFVESDERFSEFKSRSGEFRQGVISAAQYYQSCRDLLGDNFQKIFSELLALLPDTAKQQELLTAHTDFRIREQPPSTKAKRDCRVCATCQQVLARGDVSSHQALHAADDDFPSLQAIARVIT.. 880
250 0.000e+00gi|359079551|ref|XP_003587855.1| PREDICTED: zinc finger protein 598 [Bos taurus]  clstr ali  27  29..............................................SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKTLPAFATI--PLHQLQHEKKYDIYFMDGRVFALYRQLLQHECPRCERPPFSLFGDLEQHMRKQHELFCCKLCLRHLQIFTHERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDADGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSR--SRAEARQNRQIDLQFSYAPRHSRRSEGVIGGEDYEELDRYNRQGRTGRASQSRRGSWRYKREEEDREVAAAIRASVATXXXXXXXETRRSEDWEEGGRPKKEEPEEARGPRRPARTPGEGPGPKEASTNGPVSQEAFSITGPAAGATLPNTLPPPGPVGLALAYPVPARGRTTFQEEDFPALVPSASKPSSAPTSLISAWNSGASKKVAHPAPGSQSTSGGSQPPRKSXXXXXXXXXXXXXXTEEAEEDGRAGLTAQELRSVPTTVAVSSLLAGATTGSEKSGAASPPPTDKEGPPGAELAPTAPPGRAEGPAAVIVNGHSEGPAPVRSTPKEXXXXXXXXXXXXXXTPQEDFPALCGXXXXXXXXXXGFNAVVLLKGTPPPPGLAPPVSKPPPGFSGLPSSPHPACVPSTTTTT----KAPRPTPVPRAYLVPENFRERNLQLIQSIRDFLQSDDAFSKFKSYSGEFRQGAISAAQYYKSCRDLLGENFEKIFNELLVLLPDTAKQQELLLAHTDFRGREKPPGTKAKKDCCVCPTCQQVLAHGDVGSHQALHAADDDFPSLQALTRILT.. 905
251 0.000e+00gi|