current user: public

Query: [O] KOG2231 Predicted E3 ubiquitin ligase, from COG0312

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .
1 0.000e+00 ENSACAP00000013463 pep:novel scaffold:AnoCar1.0:scaffold_1335:38661:73032:-1 gene:ENSACAG00000013737 transcript:ENSACAT00000013  ali  10  201.KGNLQRHQRTHTGEKPYTCLECGQSFTRSSSLCSHQRTHMGEKPYNCLECGQSFTRSSSLH--------SHQRTHTGEKPYNCLECGQSFARSSGLRSHQRTHTGEKPYNCLECGQSFAHSSGLRSHQRTHTGEKPYNCLECG-QSFSDCSILRSHQRT-HTGEKPYKCLECGQSFTQ------RAGLRSHQRTHTGEKPYK-----CLECEQSFTHSSGLCIHQREKPFKCLECEQSFTCSSGLRIHQ-RTHTGEKPFKCLECPYNCLECGQSFSHNSNLYRHQRTHTGEKPYNCLECGQSFTQKGNLHSHQRTHTGEKQYKCLECGQSFTHSSGLRSHQRTHTGEKPYTCLECGQSFTHSSGLRSHERIHTGEKPYNCLECGQSFTQKGHLHSHQRTHTGEKQYKCLECGQSFTHSSGLRRHQRTHTGEKPYKCLECGHSFVQKSGLRSHQRT-HTGEKPYNCLECGHSFVQNSGLRKHQRTHTGEKPF....................................................................................................................................................................................................................................................................................................................................................................................... 693
2 0.000e+00gi|348551823|ref|XP_003461728.1| PREDICTED: zinc finger protein 208-like [Cavia porcellus]  clstr ali  12  176......................................................................................................................................................................PYTCDSHG---------SAADHL-----VHEGKNPFK-----CKECGKLFKKERFLLRHQR--HYECSECGKSFRKSTQLLQHQM-VHTGEKPYKCLE-------CGKAFSRGTHLSRHQRTHSGEKPYKCTECGQTFAYRSTMILHNRIHTGEKPFVCNECGKAFRDKAGFTRHYFIHTGEKPYQCSECGKAFNQRSYLTWHQQIHTGVKPFQCNECGRGFGERSALIHHYVTHTGEKPYMCLECGKAFHRGSYLKQHQRIHTGEKPYVCGECGKAFVHRS-TFILHKKAHTGETPYECKECGKAFSDRTDLIRHFSIHTGEKPSEC..................................................................................................................................................................................................................................................................................................................................................................................... 479
3 0.000e+00gi|338726943|ref|XP_003365405.1| PREDICTED: zinc finger protein 850-like [Equus caballus]  clstr ali  11  459.SSHLQRHERIHTGEKPYECKKCSKAFACSSYLQVHERTHTGEKPYECKTCSKAFTCSSHLRN--------HERIHTGEKLYECKTCSKAFTSSSNLQKHERIHTGEKPYECKTCSKAFTCSSHLLKHERIHTGEKPYECKKCSKA-FTCSSHLLKHER-IHTGEKPYECKTCSKAFTCS------SHLQRHERIHTGEKPYE-----CKTCSKAFICSSSLQLHERIKPYECKKCSKAFKPSSSLRVYQ-RSHTGQNPFECKICPYKCEKCSKAFASSRSLEIHGRIHTGEKPFECKTCSKAFTSFHYLRVHEKSHTGGKPYECKNCSKAFTSSRSLQIHGRIHTAEKPFECKICGKAFSYTSSLSTHKRTHTGEKPYECENCSKAFTCNSSLRRHERTHSAEKSYECKECNKAFTASKYLRVHLRSHTGEKAYECEESQKGFSSHAN.................................................................................................................................................................................................................................................................................................................................................................................................................................. 937
4 0.000e+00gi|111548668|ref|NP_001001411.2| zinc finger protein 676 [Homo sapiens]  clstr ali  12  114.............................................................................................................................................QCGKNVFHKCSNSNRH-KIRHTGEKGLKCKE------YVRSFCMLSHLSQHERIYTRENSYK-----CEENGKAFNWSSTLTIHTGEKPYKCEECGKAFSKFSILTKHKV-IHTGEKPYKCEE-------CGKAFNRSSILTKHKIIHTGEKPYKCEECGKGFSSVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHKRIHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSSILTKHKIIHTGEKPYKCEGCGKAFSKVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHKR-IHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEGKAFTWSSSFTKHKRI.................................................................................................................................................................................................................................................................................................................................................................... 470
5 0.000e+00gi|334328897|ref|XP_003341144.1| PREDICTED: zinc finger protein 709-like [Monodelphis domestica]  clstr ali  108.....................................................................................................................................................................................................................................................LSRYHEKIHTGEKPYEC-------QQCGKTFRSSSNLSVHQRIHIGEKLYQCDQCGKAFRISSSLKKHQRIHTGEKPYECNQCGKAFTRKTSLTYHERSHTGEKPYECNQCGKTFRSSSNLSDHQRIHIREKPYDCHQCGKAFRSRFSLRKHQRIHTEEKPFECNQCGKALRSILSLRYHEKIHTGEKPYECHQCGKGFTQKNDLAVHQR-IHTGEKPYECHQCGKTFRSNSDLARHQRIHTGRKLYECNQCGKTLTSRSS......................................................................................................................................................................................................................................................................................................................................................................... 360
6 0.000e+00gi|351694991|gb|EHA97909.1| Zinc finger protein 484, partial [Heterocephalus glaber]  clstr ali  218....................NQCKELLSPKQHLIQCEKIHSEE-----NLCVKDFTQKSSLLSCLSIYAEEQQK------------CSKQFTQKPQHTVPQRVFTGEKPFMPTEFGKDYSLRSNN---QKTHNEENYYKCSECIQKSFSCQQNLN--------GEKNYEYGQCGKNFSQN------SKLTVHKKV-----PTIGKHFECTECGKAFTRKSTLSMHQKEKPYVCTECGKAFIRKSHFITHE-RIHTGEKPYECSD-------CGKSFIKKPQLLVHQRIHTGENPFICSECGKVFTHKTNLIIHQKIHTGEKPYICTECGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFIWKSRLRIHQKCHSGERHYECSDCGKAFIQKSTLSMHQRIHKGEKPYVCTECGKAFFHKSHFITHERIHTGEKPYECSGCGKSFTKKSQLHVHQQ-IHTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPYKCSDCGKAFTRKSGLHMHQQSHTGERHYECSDCGKAFARKSTLIMHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 713
7 0.000e+00gi|326666924|ref|XP_003198420.1| PREDICTED: zinc finger protein 420-like [Danio rerio]  clstr ali  10  21..............................................................................................................................KHQVITTDEKPYSCTRC-RKSFSKKSNLDIHMR-VHTKEKPYTCKQCGKRFGYIQGFEN------HMRIHTGERPY-----TCQQCGKSFYHAGNFAAHQRERKYTCQHCGKSFSKTGNLAVH-MRIHTGEKPYSCS-------QCGKSFKQNHYLDIHMRIHTGENPYTCTECGKSFPYKGSLKHHMISHTEEKPFACAQCGKSFTTKASFMNHMDGHTGEKLFTCTQCGKNFNQSSHLNQHMRIHTGEKPFTCTQCGKSFSYSANLNQHMRIHTGEKPFTCTQCGKSFSNSANLNQHMRIHTGEKPFTCTQCGKSFSQSS-YLNQHMRIHTGEKPFTCSQCGKSFSQSPYLNQHMRIHTGEKPFTCSQCGKSFSQSSS......................................................................................................................................................................................................................................................................................................................................................................... 405
9 0.000e+00 ENSACAP00000009028 pep:novel scaffold:AnoCar1.0:scaffold_2197:3750:19406:-1 gene:ENSACAG00000009239 transcript:ENSACAT000000092  ali  11  1..............................................................................................................................................................................................................YKCIECGKSFSYSSTLQTHQREKPFTCLECGQSFTHSSYLRKHH-RIHIGEKPYKCLE-------CGQSFTRKGSLQTHQRTHTGEKPYKCLECGQSFTCSSGLHSHQRTHTGEKPHKCLECEQSFTHSSGLRRHQRTHTGEKPFKCLECEQSFTQSSDLHSHQRTHTGEKPFKCLECEQSFTDCSGLRRHQRIHTGEKPYTCLECGQSFTLSSGLRSHQRIHTGEKPYNCLECGQSFTRSSGLRSHQRT-HTGEKQYKCLECGQSFTHIVQYITHQRTHTGEKPYNCLECGHSFAHSSALRRHQRIHTGEKPYNCLECGQRFTQKGHLHSHQRTHTGEKPYNCLECGQSFTHSSGLRSHQRTHTGEKP.................................................................................................................................................................................................................................................................................................... 364
10 0.000e+00gi|300387739|gb|ADK09880.1| PR domain zinc finger protein 9 [Homo sapiens]  clstr ali  10  1......................................................................................CGQGFSVKSDVITHQRTHTGEKLYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGR-GFSWQSVLLTHQRT-HTGEKPYVCRECGRGFS------RQSVLLTHQRRHTGEKPY-----VCRECGRGFSRQSVLLTHQREKPYVCRECGRGFSWQSVLLTHQ-RTHTGEKPYVCRECGYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLSHQRTHTGEKPYVCRECGRGFRDKSNLLSHQRT-HTGEKPYVCRECGRGFSWQSVLLRHQRTHTGEKPYVC..................................................................................................................................................................................................................................................................................................................................................................................... 418
11 0.000e+00gi|334327305|ref|XP_001369982.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  13  269LKGQLNEHQKIHTGEKPYKCNECGKAFCRRSNLTEHQRIHTGEKPYGCNECGRAFCLSAALTK--------HQRIHTGEKPYECNICGKAFRLKAQLTQHQSIHTGEKPFECNECSKAFRQKGQLNEHQKIHSGEKPYQCNQCGKA-FCRRSNLTEHQR-IHTGEKPYECNECGRAFCLSTT------LTEHQRIHTGEKP-----HECIECGKAFRLKAQLNQHRREKPYKCNECGKAFCRRSNLTEHQ-KIHTGEKPYECTE-------CGKAFSQKVKLIQHQTIHTGEKPYECNECEKSFRLNTALTEHQRIHTGEKPYECSECRKAFRLKAQLNQHRRIHTGEKPYECDKCEKSFCWGTQLVEHKRIHSGMKPYECNECGVSFCLRREYTQHQRIHSTQKVY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 650
12 0.000e+00gi|297278060|ref|XP_001094037.2| PREDICTED: zinc finger protein 416-like [Macaca mulatta]  clstr ali  12  388...........HVGISHYKWSECRK---ESSHKQTHPRVCTGKRFYESSKCGKA--------CRCEYSLVQLQRVHPGERPYECSECGKTFSQTSHLNDHRRIHTGERPYVCDQCGKSFSQRATLIKHHRVHTGERPYECGKCG-KSFSQSSNLIEHCR-IHTGERPYECDECGKAF------GSKSTLVRHQRTHTGEKPYE-----CGECGKLFRQSFSLVVHQRIRPYECGQCGKSFSLKCGLIQHQL-IHSGARPFECDECGYVCGECGKAFMFKSKLVRHQRTHTGERPFECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPYKCKQCGKGFNRKWYLVRHQRVHTGMKPYECNACGKAFSQSSTLIRHYLIHTGEKPYKCLECGKAFKRRSYLMQHH-PIHTGEKPYECSQCRKAFTHRSTFIRHNRTHTGEKPFECK.................................................................................................................................................................................................................................................................................................................................................................................... 876
13 0.000e+00gi|327286140|ref|XP_003227789.1| PREDICTED: zinc finger protein 135-like [Anolis carolinensis]  clstr ali  31...........................................................................................................................................................................................................................................................RTHTGEKPYKCME-------CEKSFSHSGSLRIHQRTHTGEKPYKCLECGKSFSRSDKLRSHQRTHTGEKPYKCMECGKSFSHSDKLRSHQRTHTGEKPYKCMECGKSFSRSSSLRIHQGVHTGVKPYKCMECGEYFSHSTRLLIHQRKHTGEKPFKCMECGESFSHSTNLRSHQRTHTGEKPYKCIECGESFSRSGSL-RSHQRKHTGEKPYKCIECGESFSQSVSLRSHQRKHTGEKPYKCMECGESFSRSGSLRSHQRKHTGEKPYKCIECGESFRSGSLRSHQRKHTGEKPYKCIECEESFSSNGHLRSHQRTHTGEKPHKCMECGNSFSRSDKLRS................................................................................................................................................................................................................................................................................... 364
15 0.000e+00gi|327289876|ref|XP_003229650.1| PREDICTED: zinc finger protein 420-like [Anolis carolinensis]  clstr ali  11  4.....................................................................................................................................................................KTYKCIEYGNIFSQ------HGHLQLPERIHSEKKPY-----TCVECGKSFTLSQNLHLHQREKPYTCLECGKSFTRSDHLHKHQ-RTHTGEKPYQCL-------QCGKSFAHSGHLHLHERTHTGEKPYTCLKCGQSFTRSDHLNKHQQTHTGVKPYECLECGKSFTHSGNLHKHQRTHTGEKPYTCLECGKSFTESGSLRSHHRTHTGEKPYTCIECGKSFTKSGNLRSHQKTHTGEKLYTCLECGKSFARSGDLRSHQRIHTGEKPYKCQECGKTFAQSGGLCSHQKT-HSGERPYTCLKCGQSYTESGSLRSHQRTHTGEKPYKCLECGKSFTRNGGLHKHQRTHTGEKPYECTECGKSFLDRRYLQKHQKTHTGKKP................................................................................................................................................................................................................................................................................................................................ 369
16 0.000e+00gi|345806919|ref|XP_548983.3| PREDICTED: zinc finger protein 182 [Canis lupus familiaris]  clstr ali  10  293..........................................................................................FTRSSVGKKHLFFHTGVKPHGYRECGKALRRKKGLSLQERIKNGEKPFECTAC-RKTFSKKSHLIVHWRT-HTGEKPFGCTECGKAFSQ------KSQLIIHLRSHTGERPFE-----CPECGKAFREKSTVIIHYREKPYECNECGKAFTQKSNLIVHQ-KTHTGEKTYECT-------KCGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVHQRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECSECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQR-IHTGEKPYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHTGKKAHGKGHS.......................................................................................................................................................................................................................................................................................................................... 750
17 0.000e+00gi|326666981|ref|XP_003198440.1| PREDICTED: zinc finger protein 91-like [Danio rerio]  clstr ali  10  32...........................................................................................................................................................................................................KSCFTCTPCDKSLASKSKLKTHMREKPFTCTQCGKSFSQSSHLNKH-MRIHTGEKPFTCT-------QCGKSFSKSSSLYRHMKIHTGEKPFTCTHCGKSFNHSSFLNLHMRIHTGEKPLTCPQCGKSFSKSSSLYRHMKIHTGEKPFTCTQCGKSFSCSSSLNKHMRIHTGEKPFTCTQCGKSFSLSTSLTQHMRIHTGEKPFTCPQCRKSFSHSSSLHQHMRIHTGEKPFTCTQCGKSFS-KSSSLNLHMRIHTREKPFTCPQCGKSFIHSSHLNQHIMIHTGKKPFTCTQCGKSFSQSS.......................................................................................................................................................................................................................................................................................................................................................................... 328
18 0.000e+00gi|334329034|ref|XP_003341169.1| PREDICTED: zinc finger protein 184-like [Monodelphis domestica]  clstr ali  299....................................................................................................................................................................................................TIEKSFEQFSGLSKHCGKTFS--------------KYNKCKKPFSYHSDLIQYH-RTHSGEKPHKCNE-------CGKVFSNNSCLTVHQRIHTGEKPYKCNECGKAFSQKGNLNTHKIIHTGLKPFECNQCQKAFGNNSSLILHQRIHTGEKPFECNVCRKAFSQRGYLKQHERIHTGERPFECNECAKTFSNSYHLTRHQSIHTRVKPYLCNECGKAFSQQEYLKKHKRLHNGEKPFECNECGKAFSDNHQLTRHQ-SIHSREKPYVCKKCGQAFSNSSRLSEHQRNHARGKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 577
19 0.000e+00gi|344307375|ref|XP_003422357.1| PREDICTED: zinc finger protein 585A-like [Loxodonta africana]  clstr ali  166..........................................................................................................................................................................NQCGKIFSYKQAPS------QHQKIHTKEKPDEHAEF-----GKVFTQKLQFKVHTGEKLYICIECGKAFAQKRDYITHQ-KIHTREKSFKCDE-------CGKAFFHMSSLFRHQRIHTGKKPYKCSECGKGFFYSSDLSIHWKIHTGERHHECSDCGKAFMQKSTLKMHQKIHTGERSFICIECGQAFIQKTHLIAHRRIHTGEKPYVCNDCGKSFASKSQLQVHQRIHTREKSSICTECGKAFTYRSELITHQRIHTGEKPYECSYCGKAFAQKSALTVHQR-IHTGEKSYLCMKCGLAFIQKAHLIAHQIIHTGEKPYKCGYCEKSFTSKSQLHVHKRIHTGEKPYMCTRCGKAFASRSNLITHQKTHTGEKS................................................................................................................................................................................................................................................................................................................................ 554
20 0.000e+00gi|293343626|ref|XP_002725536.1| PREDICTED: zinc finger protein 53-like [Rattus norvegicus]  clstr ali  304..................................................................................................QHKSTRTGEEPCKSEDCERSLNVCSSIIQDDRLYTANKKHREEEYND-YFNCTYNLM--QQSLYLEEKPHKCGKCGKCFS------TSSRLIKHQRIHTGKKPYK-----CTICDKSYNQCANLKIHQREKPYKCKECGKSFRQTSVLKSHQ-KMHTGEKPYKC-------KQCDKSFAHSSSFRTHQKIHTSEEHCSCPECGREFHQLSHFRKHYRLHTGEKPYKCNECGRSFTHYASLRWHQKTHSPEIYYECKECGKSFIELSHLKRHYRIHTGEKPYKCEVCDKSFTVNSTLKTHQKIHTGEKPYKCRECDKSFTHNSHLRRHQSVHTGERPYKCKDCDKSFTECSTLKEHQK-LHTGEKTYKCGECSKSFSQHSYLRSHLRVHTGERPYVCKECGKSFTTCSTLRTHQKIHTGEKPYKCRECNKSFTQDSHLRTHHRVHTGERP................................................................................................................................................................................................................................................................................................................................ 733
21 0.000e+00 ENSACAP00000005990 pep:novel scaffold:AnoCar1.0:scaffold_3150:1691:3622:1 gene:ENSACAG00000006144 transcript:ENSACAT00000006124  ali  11  1.........................................................................................................GEKPYTCPECGQSFASSSGLRSHQRTHTGEKPYTCRGCG-KSFTRRDHLQQHERT-HTGEKPYTCLECGKSFNWSGK------LRKHQRVHTGEKPY-----TCLECGKSFTESGNLCKHQREKPYKCLECGQSFASSSGVHSHQW-IHTGEKP-------CTCLQCGKSFTESGSLRLHQRTHTGEKPYTCLECGKSFIRRDSLQQHERIHTGEKPYKCLECGKNFTQSGTLRLHQRTHIEEKPYTCLECGESFPKRHHLQQHERTHTGEKPYTCLECGKSFTWSGKLRKHQRTHTGEKPYTCLECGKSFTESGHLRKHQRTHTGEKPYKCLECGQNFTSNSGL-RSHQWTHTGEKPYTCLECGKSFTSSLGLRFHQQTHTGEKPYAC..................................................................................................................................................................................................................................................................................................................................................................................... 371
22 0.000e+00gi|327291914|ref|XP_003230665.1| PREDICTED: zinc finger protein 135-like [Anolis carolinensis]  clstr ali  10  10.............................................................................................................................................................................................................................LKTYQREKPYTCLECGQSFTERGCLCSHQ-RSHVGVKPYKCLE-------CGQSFTQIANLRSHQRTHTGEKPYKCLECGETFTQSGVLRSHQRTHTGEKPYKCLECGQSFTVLGRLRSHQRTHTGEKPFTCLECGQSFTQRANLRLHRRTHTGEKPYTCLECGQSFTVSGLLRSHQRTHTGEKPYTCLECGQSFSQSGNLRSHQRTHTGEKPYTCLECGQSFTQSANLRSHQRT-HTGEKPYKCLECGKSFTQSANLCSHQRTHTGEKPYTCLECGKSFTVMGYLRSHQRTHTGEKPYTCPECGQSFTQKGHLRSHQRTHTGEKSYKCLECGQTHSSGLRSHQRTHTGEKPYSCLECGQSFTHSSDLNKHQR................................................................................................................................................................................................................................................................................. 379
23 0.000e+00 ENSTGUP00000015988 pep:known chromosome:taeGut3.2.4:16_random:26580:73126:-1 gene:ENSTGUG00000015658 transcript:ENSTGUT00000016  ali  15  546.SSKLIRHQVIHTGERPYKCSKCGKRFSQSSSLITHQVIHTGERPYECSKCGKKFKSRSCLLRHQNSALIRHRRMHTGERPYECSKCGKSFTESSSLIRHRRIHTGERPYECSKCGKRFSQSSILTRHQRSHRGERPYECGECG-KGFRRKSHLRNHQR-IHTGERPYECSKCGKRF------QTSSYLIKHQRIHTGERPYE-----CSECGKRFSHSSALIRHQRERPYECSKCGKRFSQSSSLITHQMRIHTGERPYECGE-------CGKSFICSSKLIMHQRIH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 864
24 0.000e+00gi|327289509|ref|XP_003229467.1| PREDICTED: zinc finger protein 420-like [Anolis carolinensis]  clstr ali  12  66.........................................................................................................................................................LHLHQRT-HTGEKPYECLECGQSFT------RSAGLHLHQRIHTGEKPYE-----CLECGQSFTRKDHLQQHEREKPYKCLECGMSFTRRDSLQQHE-RNHTGEKPYECLE-------CGKSFTQNSDLRKHQRSHTGEKPYECLECGKSFIQSSDLRTHQRTHTGEKPYICLECGKSFTHSSSLYLHQRSHTGEKPYECLECGQSFTRSSGLHLHQRTHTGEKPYVCLECGQSFARSSGLHLHQRTHTGEKPYECLECGNSFSDTSGLRRHQRIHTGEKPFTCPECGQRFARSSGLHAHRRT-HTAEKPHKCLECGQSFTQLAYLHRHQRTHTGEKPFTCPECGQRFTHSSGLRAHQRTHTGEKPYECPECGQRFTHSSSLCTHQKTHSGKKPYTQECGQSFTQSSGLRSHQRTHTGEKPYTCLECGKSFPKSSNLRS................................................................................................................................................................................................................................................................................... 488
25 0.000e+00 ENSACAP00000000794 pep:novel scaffold:AnoCar1.0:scaffold_3922:3749:5485:-1 gene:ENSACAG00000000898 transcript:ENSACAT0000000081  ali  11  1...................................................................................................HQRIHTGEKPYTCLECGQSFTRSSSLCSHQRTHTGEKPFKCLECG-QSFTESGSLRTHQRT-HTGEKPYTCLECGKSFTE------RSSLRLHQRTHTGEKPY-----ACLECGKSFAQKGHLDSHQREKPYTCQECGMSFAQSSNLHSHQ-RTHTGEKPCKCLEKPYTCQECGQSFTKNSSLRLHEMTHTGEKPYTCQECGQSFTKHSSLRLHQMTHTGEKPYTCQECGKSFTQSSNLYSHQRTHTGEKPCKCLVCGQSFTKNSSLHLHEMIHTGEKPYTCQECGQSFTTNSSLRLHQMTHTGEKPYTCQECGKSFTKNSSLCRHQRTHTGEKPYTCLECGKSFTRSS-AVRLHQRTHTGEKPYTCLECGQSFTQSSGLRLHKRTHTGEKPYTCQECGRSFTESSKLRSHQWTHTGEKPYTCLECGQGFTKSSRLRSHQRTHTGEKPYTCLECGQSFTNSSG................................................................................................................................................................................................................................................................................................................. 473
26 0.000e+00gi|338710306|ref|XP_001917630.2| PREDICTED: zinc finger protein 850-like [Equus caballus]  clstr ali  15  616.KSRLTEHKRIHTGKKPHGCNVCGKTFFKKFKLTEHQRTHEGEKPHECGECGKAFLRRFQLTEHQKVCSICHQRTHTGEKPYECTECGKAFCRKAELIIHQRNERGEKPHGCTECGKGFSRKSQLILHQKTHTGEKPYICSECG-KGFIQKGNLLIHQRT-HTGEKPYGCSECGKAFSCGKSCSQKSGLIKHQRIHTGEKPYE-----CSDCGKAFTTKTMLIVHQRERPYGCNECGKAFSHMSCLVKHK-RVHTREKH................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 911
27 0.000e+00 ENSACAP00000005203 pep:novel scaffold:AnoCar1.0:scaffold_1072:58292:143271:-1 gene:ENSACAG00000005335 transcript:ENSACAT0000000  ali  14  241.SSALARHKRLHTWEKPYECTECGKRFGQSGDLQSHQRTHTGEKPYQCMECGKSFSRSGYLLTHQRTCMECHQRTHTGEKPYECMECGKSFSQSDKLHVHQRTHTGEKPYECTDCGKSFSQNGDLQSHQRIHTGERPYKCMECGE-SFNQSGHLRSHERT-HTGEKPHKCMECGESFSCGKSFVHSGDLRCHQRTHTGEKPYE-----CMECGKSFSHSRYLLTHQREKPFQCMECGKRFGRSGHLRSHQ-RTHAGEKPYKCME........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 541
28 0.000e+00gi|256418948|ref|NP_009084.2| zinc finger protein 208 [Homo sapiens]  clstr ali  10  150..................................................................................................................................................................................YANVFHKCSNSNRHKIRHTGKK-----HLQCKEYVRSFCMLSHLSQHKRENSYKCEEGGKAFNWSSTLTY-YKSAHTGEKPYRCKE-------CGKAFSKFSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHTGEKPNKCEECGKAFSKVSTLTTHKAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEV-IHTGEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 456
29 0.000e+00 ENSACAP00000007536 pep:novel scaffold:AnoCar1.0:scaffold_2669:9401:11044:-1 gene:ENSACAG00000007707 transcript:ENSACAT000000076  ali  1.......................................................................HLRTHTGEKPFKCPECGQSFTESSVLRSHQRTHTGEKPFKCSECGQSFAHNGSLHSHQRTHTGEKPYNCLECG-QSFTQKGHLDSHQRT-HTGEKPYNCLECGQSFAFS------SNLRSHQRTHTGEKPYN-----CLECGQSFARSSGLRSHQGEKPYKCLECGQSYTRSSGLRLHQ-RTHTGEKPYKCLECGYKCLECGQSFVCSSELRSHQRTHTGEKPYNCLECGQSFARSSNLRSHQRTHTGEKPYKCLECGQSYTCSSGLRSHQWTHTGEKPYKCLECGQSFVCSSGLRSHQRTHTGEEPYNCLECGQSFARKGSLHRHQRSHTGEKPYKCLECGQSFVCSSGLRSHQRTHTGEKPYNCLECGQSFVCSSGLRSHQRT-HTGEKPYNCLECGQSFPRKGSLHRHQRTHTGEKPYKCLECGQSFVCSSGLRSHQRTHTGEKPYKCLECGQSFAHSSGLRSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 486
30 0.000e+00gi|327289519|ref|XP_003229472.1| PREDICTED: zinc finger protein 184-like [Anolis carolinensis]  clstr ali  10  82........................................................................................................................................................................................................PLDSHLKQCPVCGKKWKYKSHLNIHFREKPYECMECGKTFSQSGQCYSHQKNEHTEERPYQCTE-------CGKSFSSSGHLHSHQITHTGEKPYTCMECGKSFARGNSLHSHQRIHTGEKPYQCIECGNSFSQASHLHLHERTHTGEKPYKCVECGKSFSGSGQLRSHERIHTGEKPYKCVECGKSFSQSGNLRAHQRTHIEEKPYQCTECGMSFSASAHLCSHQRTHTGEKPYKCTECGKSFSQSGNL-RSHQRIHIEEKPYKCMECGKSYSQSGHLRSHQRKHTGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 398
31 0.000e+00gi|359318799|ref|XP_855205.3| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 227 [Canis lupus familiaris]  clstr ali  11  206.........................................................................................AFMKKSPLNDHINIDTEQKPYIFNKCGKSFSQSSHLQTHQRIHTGEKSYRCDSCG-KGFSSSTGLIIHYRT-HTGEKPYKCEECGKCFSQS------SNFQCHQRVHTEEKPYK-----CEECGKGFGWSVNLRVHQREKPYKCEECGKGFTQAAHYHIHQ-RVHTGEKPYKCDEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYKCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEECDKSFSQAIDFRVHQRVHTGEKPYKCDVCGKGFSQSSGLQSHQR-VHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 691
33 0.000e+00 ENSACAP00000009886 pep:novel scaffold:AnoCar1.0:scaffold_1408:2819:4673:1 gene:ENSACAG00000010081 transcript:ENSACAT00000010089  ali  11  211VSGHLHTHQRTHTGEKPYKCLECGKSFTESGHLRTHQRTHTGVKPYTCLECGKSFTESGHL--------RTHQRTHTGKKPYTCLECRKNFTDSGSLRFHQRTHTGEKPYTCLECRKSFTSSSGLRSHQRTHTGEKPYKCLECG-QSFTSSSGLRSHQRT-HTGEKPYTCLECGQSFT------SSSGLRSHQRTHTGEKPYK-----CLECGQSFTSRSGLRSHQREKPYKCLECGQSFTSSSGLRSHQW-THTGEKPYKCLE-------CGQSFTSSSGLRSHQWTHTREKPYTCLECGKSFPSSSGLHSHQWTHT-EKPYTCLECGKSFTRSGCLHFHQRTHTGEKPYKCLECGKRFTESGKLRLHQSTHIEEKPYKCLECGKRFAESGKLRLHQRTHIGEK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 589
34 0.000e+00 ENSTGUP00000017752 pep:novel chromosome:taeGut3.2.4:LGE22_random:221844:298906:-1 gene:ENSTGUG00000017467 transcript:ENSTGUT000  ali  4.............................................................................................................................................................................................................................................................HDGEKPHKCSE-------CGKSFRWRSHLIVHQRIHTGERPYECGECGKSFSRSSSLIKHQRIHTGEKPYECSECGKSFSRSSHLIVHQRIHTGERPYECSKCGKSFSQSPSLIKHQRTHTGERPYECGECGKSFTHSSSLIKHQRSHTGERPYECSKCGKGFRTSSDLLVHERIHTEERPFRCPDCGKGFKHNSHLTK-HRRIHTGERPYECGKCGKGFRDRSGLIEHQVIHTGERPYECS.................................................................................................................................................................................................................................................................................................................................................................................... 237
35 0.000e+00gi|334313267|ref|XP_003339867.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  264...............................................................................................................................................................................AFREFSVVFQNSSHIEKQRMHTEEKSSVNNH-----CGKTFIHRANICGHQGEKLCGCKQCGKTFSQRSHLDVHQ-RVHPGEKP-------CECKQCGKTFSWSSKLAIHQKVHNGGKPYEYKQCGKTFTDSYNLAVHQRIHTVEKPYKCKQCGKTFTNISSLSVHQRIHTGEKPYECKHCGKTFINTYSLAVHQRIHTGEKPYECKQCGKAFRQSSKLAVHQRYHTGEKPYECNQCGKTFKNSYNLSVHQRIHTGEKPYKCKQCGMTFTNTSSLAIHQR-VHTGEKPYECKQCGKMFAKSYNLAVHQRTHTGEKPYKCKQCGKTFTNTSSLGVHQRVHTGEKPYECKQCGKAFRQSSKLAVHQRVHTGEKP................................................................................................................................................................................................................................................................................................................................ 625
36 0.000e+00gi|296234528|ref|XP_002762516.1| PREDICTED: zinc finger protein 845 [Callithrix jacchus]  clstr ali  11  196..........................................................................................FLHSSLPTQKQEGHIREKSFQCNENGKALHCSSLLRKHQTIHLEEKQYECDVCGKA-FNQKRYLERH-RRCHTGEKPFRCKECGKSFIQ------MSSLTCHRRLHTGEKPYK-----CNLCGKTFRQNSALVIHKGEKPYKCNECGKVFNQQSNLASHH-RLHTGEKPYKC-------KVCDKAFGCYSHLAQHTRIHTGEKPYKCNECGKTFGRNSALVIHKAIHTEEKPYKCNECGKVFKQQSSLARHHRLHTGEKPYKCNECGKTFSQMSSLTCHHRLHTGEKPYRCNECGKTFSQTSSLLCHRRLHTGEKPYKCKVCDKAFRRDSHLAQHTRIHTGEKPYKCNECGKAFSAQSTLI-HHQAIHGIGKLYKCNDCHKVFSNATTIANHWRIHNEERSYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 582
37 0.000e+00gi|334329026|ref|XP_001378875.2| PREDICTED: zinc finger protein 665-like [Monodelphis domestica]  clstr ali  14  321MQSHLISHQKIHTGEKPYECNECGKAFSSSTSLTYHRRIHTGEKPYKCNECGKAFIQSAHLT--------SHQKIHTGEKPYECRDCGKVFSSNSSLIYHQRIHTGEKPYVCNDCGQAFRVNTQLTSHQRIHTGEKPYECNECGKA-FVHSTHLTFHQR-IHTGEKPYECNECGKAFSSG------SSLTNHQRVHTGEKPYE-----CNECGKSFRHNSSFLYHQREKPYICSKCGKGFILRTQLTSHQKK-HTEEKLYEHDEY-------GKTF............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 572
39 0.000e+00gi|327289555|ref|XP_003229490.1| PREDICTED: zinc finger protein 420-like [Anolis carolinensis]  clstr ali  10  6.....................................................................................................................................................................................................................KEFFSRDHLQQHEGEKPYTCLECGQSFTRSSSLYLHQ-RSHTGEKPYVCLE-------CGQSFARSSGLDLHQRTHTGEKPYECLECGQSFTRSSGLRLHQRSHTGEKPYECLECGNTFSDSSGLRRHQRIHTGEKPFTCPECGQRFARRSTLHVHQRTHTVEKLHECLECGQSFTQLAYLHVHQRTHTGEKPFTCPECGLRFTHSSSLRAHERTHKGEKPYICLECGKSFTQSSSLYLHQRS-HTGEKPYVCLECGQSFTRSSGLRLHQRSHTGEKPYECLECGNTFSDSSGLRRHQRTHTGEKPYKCQECGQSFNQSSGLLLHQRTHTGEKPYECLECGQTQSSGLRSHQRTHTGEKPYKCQECGQSFPHSSGLRSHQK................................................................................................................................................................................................................................................................................. 383
40 0.000e+00gi|334328889|ref|XP_001375879.2| PREDICTED: zinc finger protein 28 homolog [Monodelphis domestica]  clstr ali  11  139................................................................................................................................................RAAFSQRGNLNEHKK-IHTGEKPFKCNECGKAFS------SNSSLTLHQRVHTGEKPFK-----CNECGKAFSQRGNLNEHKREKPFECDECGKAFNHRVSLIDHQ-RIHTGEKPFECNE-------CGKAFNQRGHLNEHKRIHTGEKPFECNECGKAFIHKGSLTEHQRIHAGEKPLECNECGKTFSHRTSLYSHLRIHTGEKPFECNDCGKAFSHNASLIYHQRIHTGEKPFECNECGKTFSHRRSLLHHQRVHTGEKPFQCNDCGKAFSQRGNLFYHQRIHTGEKPFECSECGKAFSHSTSLIYHHR-VHTGEKPFECNECGKAFSQRGQLNKHQRIHTGEKPCKCNECGKTFSQTGHLLRHQRVHTGEKPFACNKCGKSFSQRGSLVLHQRIHTREKP................................................................................................................................................................................................................................................................................................................................ 525
41 0.000e+00gi|334327269|ref|XP_001366181.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  138LRSQLALHQRIHSGEKPFECNKCGKAYRLSSQLTLHQRIHTGEKPYECKVCGKAFHLSGRLT--------VHQRIHTGEKPFGCNECGKAFLMSGQLTVHQRIHTGEKPCECKECGRAFRLQSQLTVHQRIHTGEKPYECNICGRA-FRRNLELTLHQ-IVHTGVKPYKCNECGKAFGH------RTKLTVHQRTHTGQKPYE-----CNECGKAFHQSGQLTLHQREKPCECKECGKAFRLQAQLTVHQ-RIHTGEKPFECNE-------CGKTFQWRSLLIVHQRIHTGEKPFECNECGKVFRLSSQLTSHQRIHTGEKPYECNECGKDFQWRSLLTVHQRIHTGEKPFECNECGKTFRLSGQLTAHQKIHTGKKPYECNECGKTFCRRSHLTGHKRSHSGEKHYECDRWGKAF................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 528
42 0.000e+00 ENSACAP00000010324 pep:novel scaffold:AnoCar1.0:scaffold_301:888390:890081:1 gene:ENSACAG00000010532 transcript:ENSACAT00000010  ali  1...........................................................................................................................HLTKHRRTHTGEKPYGCTECG-KSFGDSGSLTVHQRT-HTGEKPYKCLDCGKSFCQN------GHLRQHQRTHTGEKPY-----TCKECGKCFSQNGDLRQHEREKLYKCMECGKNFSESRSLAVHE-RIHTGEKPYQCTE-------CGRSFSVRGSLTKHQRTHTGEKPYRCMECGKNFTDSGSLAVHERTHTGEKPYQCTECGKRFGQKRHLKKHQITHTGEKLFKCKDCGKSFSDSGSLTIHQRMHTEEKPYKCKECGKSFSVSTYLIIHERSHTGEKPYTCTICGKNLSSSGSLTVHERTHTSEKPYKCMKCGKNFIRKEHLMNHER-IHTGEKPFECTECGRSFSDSGSLTKHQRTHTGEKPYKCTTCGKSFSQNGHLRQHERTHTGEKPYKCQECGKSFSQNGDLRQHKRTHTGERP................................................................................................................................................................................................................................................................................................................................ 406
43 0.000e+00gi|344299271|ref|XP_003421310.1| PREDICTED: zinc finger protein 268 [Loxodonta africana]  clstr ali  10  268........QQMCMTEKPFECSYCGIAFSCKSNLAVHQRTHSGEQSYKCNERRNEFSSK--------LYFVAHQRTHSGEKLHECSECGKAFSFNSQLVTHQRIHTNENPCECCEGGKVFSRKDHLISLQRTHLGQKSYGCNECG-KSFGLKSQLIIHQR-IHTGEKPYECCECQKAFN------TKSNFMVHQRTHTGEKPY-----GCGECGKAFTFKSQLIIHQGVKPYACIQCGKAFGLKSQLVAHQ-RSHTEMKPYVCRE-------CVKAFGSKSYLIIHMRTHTGEKPHECKECGKAFSFKSQLIVHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECSDCGKAFGLKSQLIIHLRTHTGEKPFECSECRKAFNTKSNLIVHQRTHTGEKPYGCGECGKAFTFKSQLIVHQGAHTGVKPYACIQCGKAFSLKSQLIVHQRS-HTGVKPYGCSDCGKAFRSKSYLIIHMRTHTGEKPHECS.................................................................................................................................................................................................................................................................................................................................................................................... 728
44 0.000e+00 ENSACAP00000010335 pep:novel scaffold:AnoCar1.0:scaffold_729:235083:254480:-1 gene:ENSACAG00000010538 transcript:ENSACAT0000001  ali  2...................................................................................................................................................................................................................................EKPYKCMECGESFSQSGSLRSHQ-RTHTGEKPYKCME-------CGESFSKSGSLHSHQRKHTGEKPYECMECGKSFSERSSLRSHQRTHTGEKPYKCIECGESFSQSGHLHSHQRKHTGEKPYKCMECGESFSQSSNLRTHQRKHTGEKPYKCMECGEIFSQSGTLRSHQRKHTGEKPYKCMECGEIFSEKSILRSHQRTHTGEKPYECMECGKSFKLQSDSLTVHERTHTGEKPYKCMECGESFSQSGSLRSHQRTHTGEKPYKCMECGESFSKSGSLQSHQRTHTGEKPYKCIECGESFSRSDSLRSHQRTHTGEKPYKCMEGKSFSHSGSLRSHQRTHTGEKPYKCMECGKSFSRSEHLRS................................................................................................................................................................................................................................................................................... 359
45 0.000e+00gi|326667299|ref|XP_002661787.2| PREDICTED: zinc finger protein 91-like, partial [Danio rerio]  clstr ali  12  63...........................................................................................................................................................................................................KNSFTCTQCGKSYGSKDYLKIHMREKPYTCTRCGKSFSQSSNLNQH-MRIHTGEKPFTCT-------QCGKSFNRSSSLNEHMMIHTGEKPFTCTQCGKSFGRNFDLKIHMMIHTGENPFRCTHCGKSFSQSSYLNQHMRIHTRENPFTCTQCGKSFHRSSSLNNHKTIHNREKPFTCTQCGKTFNNSSHLYEHMRIHTGEKPFTCTQCGKNFNQSSNLNQHMRIHTREKPFTCTQCGKSFSQKQNL-TIHMRIHTGEKPYTCTECGKSFPHTGSLKHHRRIHTGEKPYTCTRCGKSFSQSS.......................................................................................................................................................................................................................................................................................................................................................................... 387
46 0.000e+00gi|344299288|ref|XP_003421318.1| PREDICTED: zinc finger protein 605 [Loxodonta africana]  clstr ali  136.................................................................................................................................................................................................RTHDG-----IKYCDCNKCRQANSKESWLITHRGV--YLCMECGKVFNKRSQLIIHQ-RTHTGEKPYQCSE-------CGKAFSQKSLLTIHQRTHSGEKPYGCGECQKAFSRKSLLMLHQRTHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKPYGCSDCGKAFSQKIKLITHQRTHTGEKPYKCNECGKAFFWKSQLITHQRTHTGKKPYACSECKKAFSRNSLLIRHQRIHTGEKPYECNECGEAFIRKPQLIKHQIT-HTGEKNYQCSNCEEAFFKKSELIRHQKIHLGEKPYGCVECGKTFFGKSQLQTHQRTHTGEKPYECSECGKAFTQKSSLVSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 477
47 0.000e+00gi|344271560|ref|XP_003407605.1| PREDICTED: zinc finger protein 189-like [Loxodonta africana]  clstr ali  228......................................................................................................................................................................................................................................................................EEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNHCKQSFSQRRSLVKHQRIHTGEKPHKCTDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGERPHKCGECGKAF-RLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEHQRIHTGERPYQCKECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQRIHTREKTYP.............................................................................................................................................................................................................................................................................................................................. 513
49 0.000e+00 ENSACAP00000013928 pep:novel scaffold:AnoCar1.0:scaffold_3106:4153:5523:-1 gene:ENSACAG00000014210 transcript:ENSACAT0000001421  ali  10  3..............................................................................................................................................................................................................................KTHTAEKPYTRMECGKGFSCSSKLCLHQKK-HTGEKPYKCQE-------CGKSFTYSGSLCKHQRTHTGEKPYLCLECGKSFTENGSLRSHQRTHTGEKPYTCLECGQSFTASGKLRSHQRTHTGEKPYTCLECGQCFTASGNLRSHQRTHTGEKPYTCLECGQSFTENGSLRKHQRIHTGEKPYTCLECGKSFARRGNLDSHQRTHTGEKPYACLECGKSFTESGSL-RLHERTHTGEKPFKCLECGQSFTASGKLRLHQRTHTGEKPYTCLECGQSFTESGSLRKHQRTHTGEKPYSCLECGKGFTQREHLDSHQRIHTGEKPYTCLKGQSFARSGNLNAHQRTHTGEKPYTCQECGKSFTASGSLRK................................................................................................................................................................................................................................................................................... 364
50 0.000e+00gi|118151400|ref|NP_001071428.1| zinc finger protein 227 [Bos taurus]  clstr ali  239...................................................................................................................................................................GERPHPCRVCGEGFSHGAVLPVHSHLQTHQRIHPG-----GTVNKCPKSGDGFHQNS-FHPHHGEKSYRCDSCGKAFGSSTGLIIHY-RTHTGEKPYRCE-------ACGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHYHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYRCEACGKGFTRNTDLHIHFRVHTGEKPYTCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQR-VHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYTCEACGKGFSWRSNLHAHQRVHSGEKPYKCEACDKSFSQAIDFRVHQRVHTGEKP................................................................................................................................................................................................................................................................................................................................ 619
52 0.000e+00gi|109148587|ref|XP_001119225.1| PREDICTED: zinc finger protein 208, partial [Macaca mulatta]  clstr ali  12  70.............................................................................................................................................QCGKNVFHKCSNSKRH-KIRHTRQKLLKCKE------YVRSFCMRSHLCQHKRIYTRENSYK-----CEEDGKAFNWSSTLTIHTGEKPYKCEECGKAFSKASTLTKHKV-IHAGEKPYKCEE-------CGKAFNLSSDLVTHKRIHTGEKPYKCEECGKAFNWSSSLMVHKRIHTGEKPHKCEECGKAFQRSANLMVHKRIHTGEKPYKCEECGKAYGNFSTLTKHKVIHTGEKPYKCEECGKAFSWPSSLIEHKRSHAGEKPYKCEECGTAFYRSSKLSEHKRIHTGEKPYKCEECGKAFNRSSNLTEHKK-IHTREKPYKCEECGKAYGNFSTLTKHKVIHTGEKPYKCEECGKAFSCPSS......................................................................................................................................................................................................................................................................................................................................................................... 419
53 0.000e+00 ENSACAP00000003747 pep:novel scaffold:AnoCar1.0:scaffold_2390:6944:14963:1 gene:ENSACAG00000003852 transcript:ENSACAT0000000383  ali  11  1..................................................................................................................CGKSFSWRSHLLRHERTHTGEKPFECLECGQQTFARSSGLRLHQRT-HTGEKPFECLECGQSFTCGQSFTQSSGLRQHQRTHTGEKPFE-----CLECGQTFTHSSGLRSHQGEKPYTCMECGQTFTHSSGLRLHQ-RTHTGEKPFECLE-------CGQSFTHSSGLRQHQRTHTGEKPYKCLECGQTFARSSGLRRHQRTHTGEKPFECLECGQSFTHSSRLRLHQRTHTGEKPFECLECGQSFTHSSGLRQHQRTHTGEKPYTCLECGQTFTHSSGLRSHQNSHTGEKPYTCMECGQTFTHSSGLRSHQRTHTGEKPYKCLECGQSFTHSSNLPLHQR-IHTGEKPYNCLECGQSFTQKGQLHSHQRIHTGKKPYTCLECGQNFTHSSGLRSHQRIHTGEKPYNCLECGQSFAQKGSLHTHQRTHTGEKPYKCLECGQSFTHSSG................................................................................................................................................................................................................................................................................................................. 486
54 0.000e+00 ENSACAP00000003059 pep:novel scaffold:AnoCar1.0:scaffold_902:219090:221021:1 gene:ENSACAG00000003177 transcript:ENSACAT00000003  ali  11  1.........................................................................................................GMKPYECLECGKRFTQRAHLNTHQRIHTGEKPYTCLECG-KSFTDSGNLHKHQRT-HTGEKPYECLECGKSFHESR------SLHSHQRTHTGEKPYK-----CLACGKCFSQQGSLQFHERTKPYECLDCGKSFTRYDQLHLHQ-RTHTGEKPYECL-------QCGKSFPQRAHLHSHQRTHTGEKPYKCLACGKSFSQQGHLQLHERTHTGEKPYKCLECGKSFARSESLHSHQRTHTGEKPYKCMECGKSFARSGNLQLHQRIHTGEKPYECLECGKSFTHSGNLHAHQRTHTGEKRYMCLECGKSFTENGSLHKHQKIHTGEKPYECLECGKSFTRN-DHLHSHRSIHTGEKPYKCLSCEKSFSQQGHLQLHERTHTGMKPYEC..................................................................................................................................................................................................................................................................................................................................................................................... 371
55 0.000e+00gi|297277292|ref|XP_001108936.2| PREDICTED: zinc finger protein 229 [Macaca mulatta]  clstr ali  11  318...............................................................................KPCDCNKCRKDCIKNSVLH-----HNGENGLKSNEYGNGFRDDSDLPPHPRVPLKKK--------GKDLRQSSYLNRHQRIP-TGEKPYRCDICGKDFRY------KSVLLIHQGVHTGRRPYK-----CEECGKAFGRSSNLLVHQREKPYKCSECGKGFSYSSVLQVHQ-RLHTGEKPYICSE-------CGKGFCVKYALLKHQHVHSGEKPYTCVECGKGFSCSSNLSSHQKTHTGERPYQCDKCGKSFRHNSYLQAHQRVHMGQHLYECNVCGKSFIYNSGLLTHQRLHTGEKPYKC-ECGKGFGRRSDLHIHQRVHTGEKPYKCGECGKGFRRNSDVHNHQWVHTGERPYICDVCGRGFIYSSDLLNHQR-AHTGEKPYKCAECGKGFSYSSGLLIHHRVHTSEKPFRCQECGKGFRCTSSLHKHQRVHTGKKPYTCDWCGKGFSYGSNLRTHQRLHTGEKP................................................................................................................................................................................................................................................................................................................................ 777
56 0.000e+00gi|296477351|gb|DAA19466.1| zinc finger protein 347-like [Bos taurus]  clstr ali  10  109......................................................................................................................................................................................................ENPYK-----CDECGKAFSHSSHLRRHKKKKLFKCDICGKVFSRNSNLAVHQT-VHTDEKPYKCDE-------CGKAFRVKSSLLSHQTVHTGEKPYKCNDCGKAFRIKSSLLSHQTIHTGEKPYKCDECGKAFRVKSSLLSHKTIHTGEKPYKCDECGKAFHVKSILLSHQTVHTGEKLYKCDECGKAFRVKSSLLSHQTVHTGEKPYKCNDCGKAFRVKSSLLSHQTIHTGEKPYKCDECGKAFHVKSILLSHQ-TVHTGEKLYKCDECGKAFRVKLSLLSHQTLHTGQKPYKCCGKAFPVKSTLSKHQAI.................................................................................................................................................................................................................................................................................................................................................................... 413
57 0.000e+00gi|193591726|ref|XP_001944018.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum]  clstr ali  11  2......................................................................................................................FNKNGKLIKHLQTHARQKPYTCDVCD-KSFSQSGSLLVHQRT-HAEEKPYLCDICDRSFS------NKGELMAHYRTHPGEKPY-----QCDVCDKSFSVSSSLTKHRREKPYQCDVCDKSFSNNGDLKRHQ-RTHTGEKPYQCDV-------CDKSFSVKSSLTIHRRTHTGEKPYQCDVCDKSFSNNGALIIHRRTHTGEKPYQCDVCDKSFSVSSSLTIHRRTHTGEKPYQCDVCDKSFSNNGDLKRHQRTHTGEKSHQCDVCDKSFSVSSSLTKHRRTHTGEKPYQCDVCDKSFTVSSQLTMHRRTHTGEKPYQCDVCDKSFSHSGHLTN-HRRMHTGDKPYFCDVCDKSFINSGALIKHRRTHTREKPYICDVCDMSFSVSSS......................................................................................................................................................................................................................................................................................................................................................................... 371
58 0.000e+00gi|334349340|ref|XP_003342193.1| PREDICTED: zinc finger protein 268-like [Monodelphis domestica]  clstr ali  10  296.................................................................................YQCHNCEMTFNVKSELIRHEKSHAGEMLYTHNEVEEAFSHNSELTDHQKNQHGKKHYKCNDCGKA-FKKKLSFTHHQ-NFHSSTKLHECMQCGQAFR------RQSSLISHQKIHTRE--------TCNECSKTLSEKSSLTVSERKQPYECNQCGKTFTQNSHLVVHQ-RIHSGENLYGCN-------QCGKAFRCNSEFLKHQRIHTGEKPFACKQCGKTFSQRGNLSTHQGVHTGEKPYECHQCGRSFRMKSILSAHQRIHTGEKPYKCHQCGKSFRQSCTLTDHQRMHTGEKSYECNQCGMAFRRSSNLAQHQRIHSGEKPFVCNQCGKTFRCNSGLVQHKRIHTGEQPYECKQCGKRFRKSSNLVVHERT-HTGEKPYGCNQCGKTFPRPDRLAQHQRIHTGEKPYECNQCGKTFRQSFSFAEHKKIHTGEKPYACNQCGKAFRSNSDLRKHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 743
59 0.000e+00 ENSACAP00000000297 pep:novel scaffold:AnoCar1.0:scaffold_1979:6945:9062:1 gene:ENSACAG00000000323 transcript:ENSACAT00000000307  ali  11  1...........................................................................................................KAYKCIECGKSFSYSSTLQTHQRTHTGEKPFTCLECG-QSFTQKGSLQTHQRT-HTGEKPYKCWECGQSFIHS------SSLRVHQRTHTGEKPYK-----CLECGQSFTHSSYLRKHHREKPYKCLECGQSFTQKGSLQTHQ-RTHTGEKPYKCLE-------CEQSFTHSSGLHSHQRTHTGEKPYKCLECEQSFTQSSVLRIHQRTHTGEKPFKCLECEQSFTQSSGLHSHQRTHTGEKPYKCLECGQSFTQNSGLRTHQRTHTGEKPFKCLECEQSFTQSSGLHSHQRTHTGEKPFKCLECGQSFAHNGSLHSHQRTHTGEKPYKCVECGQSFTQSSGLHRHHRTHHTGEKPFKCLECEQSFSRSSGLHSHQRTHTGEKPFKCLECGQSFTHRSNLGRHQRTHTGEKPYKCVECGQSFTQNSGLRTHQRIHTGEKPYTCLECGQSFSRSSGLRSHQRTHTGEKPFKCLECEQSFTHRSN..................................................................................................................................................................................................................................................................................... 484
60 0.000e+00 ENSACAP00000004738 pep:novel scaffold:AnoCar1.0:scaffold_1005:145766:160960:1 gene:ENSACAG00000004867 transcript:ENSACAT0000000  ali  1.................................................................................................................................................................................................................................MGKKAYKCTECGKSFSHQTPLRIHE-RAHTGEKPYTCQE-------CGKNFAQSGALNIHQRIHTGEKPYTCLECGRSFTHSGGLRSHQKIHTGEKPYTCLECGRSFAHSSVLRSHQKIHTGEKPYTCLECGRSFAHSGGLQIHRRTHTGEKPFQCPECGKSFTQHTHLRIHQRIHTGEKPFKCLECGKSFTDNRSLHTHKRTHTGEKPFKCLECGKSFARSG-YLRSHQRIHTGEKPYKCQDCGNTFADYGGLRSHRRTHTGEKPFQCPECGKSFTQNAQLHSHQRTHTGEKPYKCLECGKSFTESGNLRSHQRTHTGEKPYACL............................................................................................................................................................................................................................................................................................................................ 317
61 0.000e+00 ENSACAP00000002660 pep:novel scaffold:AnoCar1.0:scaffold_3453:4683:7594:-1 gene:ENSACAG00000002748 transcript:ENSACAT0000000272  ali  10  1.................................................................................................................................................KCFIERSSLAKHQRT-HTGEKPYKCVECGKSFSQS------GHLHTHQRTHTREKP-----HTCMECGKSFSKSGNLRTHQREKPYKCMECGKSFSRSGHLRIHQ-RMHTGERPHTCRE-------CGKRFSESGHLRIHQRTHTGEKPHTCMECGKSFSESGNLRTHQRIHTGEKPHKCMECGKSFSQSGDLRTHQRIHTGEKPHKCMECGKSFSQSGDLRTHQRIHTGEKPHKCVECGKSFIQSGDLRTHQRIHTGEKPHKCVECGKSFIQSGDLRTHQRTHTGEKPHTCMECGNSFSQSGHLRIHHQRMHIGEKPHKCMECGKSFSRSGDLRTHQRIHTGEKPHTCMECGKNFSNSSNLRTHQKIHTGEKPHKCMECGKSFSQSGDLRTHQKIHTGEKP................................................................................................................................................................................................................................................................................................................................ 413
62 0.000e+00gi|334313542|ref|XP_001362568.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  94..................................................................................................................................IHTEEKSSKSNQC-KKTLMRRANLAVHQR-IHSVEKPYECNQCGKTF------KERSKLSVHQRIHTGEKPYE-----CKQCGKTFCQSFSLTVHQREKPYECKQCGKMFSQSSNLAVHQ-RIHTGEKPHKC-------KQCGKTFSHSSHLAVHYRVHTGEKPYECNQCGKTFSRSSSLAVHQRIHTGEKPYECKQCGKTFIVGSSLTVHQRMHTGEEPYECKQCGKAFTNSSSLVTHQRIHTGEKPYECKHCGKTFSRSSYLAEHQRIHTGEKPYKCKQCGKTFSQNSHLAVHQRIHTGEKPYKCKQCEKTFSQSSSLAVHQR-IHTGEKPYECKQCGKTFSQSSHLAVHWRIHTGEKPYECKQCGKTFTNNSSLSVHQRTHTGEKPYECKQCGKTFSQSSNLAVHQRIHSVEKP................................................................................................................................................................................................................................................................................................................................ 492
63 0.000e+00 ENSACAP00000000735 pep:novel scaffold:AnoCar1.0:scaffold_1244:57018:110429:1 gene:ENSACAG00000000826 transcript:ENSACAT00000000  ali  10  1............................................PHQCMECGKSFSQSGEL--------RSHQKIHTGEKLHQCAECGKSFIRSGQLQSHQRTHTGEKPYQCMECGKSFSQSGALRSHQRIHTGEKPYQCIECG-KCFSRSDKLCSHQKT-HTGEKPYHCMECGKSFSQS------GALHSHQRTHTGEKP-----HQCMECGKRFIQKSNLRTHQREKPHQCTECGKSFRDSGSLHSHH-RTHTGEKPYQCIECGYKCLQCGKSFTQNGSLCSHQRTHTGEKPYTCLECGQSFTQRGHLSSHERTHTGEKPYTCLECGQSFTQRAHLCLHQRTHTGEKPYTCLECGQSFAQSGNLCLHRRTHTGEKPYQCLECGQSFNQRGHLRSHQRTHTGEKPYTCLVCGQNFAQRPHLRSHQRTHTGEKPHTCLECGKSFARSGNL-RSHQRIHTGEKPYKCLECGQSFTQRGHLHSHQRTHTWEKPYKCLECGQSFTQSGSLRSHQRIHTGEKAYTCLECGKSFITSGNLRSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 505
64 0.000e+00 ENSTGUP00000015974 pep:novel chromosome:taeGut3.2.4:Un:73338802:73350290:-1 gene:ENSTGUG00000015647 transcript:ENSTGUT000000162  ali  11  1......................................................................................CGKGFRDSTDLIMHQAMHTGDSPYKCSECGKSFMENSMLMVHQRTHTGERPFKCGECG-KSFRQSATLIVHQR-IHTGERPYECGECGKSFSQSTT------LIDHQRIHTGERPYK-----CRECGKSFRQSHHLTVHQRERPYKCGECGMRFCISSQLIVHQ-RIHTDERPYECGECGKSCGECGKGFRDSTDLIMHQAMHTGESPYKCSECGKSFMENSMLMVHQRIHTGERPYKCGECGKSFRQSPNLIVHQRIHTGERPYECGECGKSFSQSTNLIVHQRIHTGERPYACRECGKSFSQRCGLRAHQTTHTGERHYECSECGEKFQSRYRLLKHQRIHTDERPYECGECGKSFRRSSHLNRHQM-IHTGIRPFVCGECGKGFRDSTDLIMHQAMHTGESPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 419
65 0.000e+00gi|334313548|ref|XP_003339923.1| PREDICTED: zinc finger protein 709-like [Monodelphis domestica]  clstr ali  10  130.....................................................................................................................................................................................TFMQRANLFGHQRMHTEEKPYE-----CKHCGRIFSHRFALVGHQREKPYECKRCGRIFSHRSALVVHQ-RIHTGEKPYEC-------KQCGKTFTRSSGLASHQRMHTGEKPYECKQCGKTFSHTSSLTVHQRMHTGKKPYECKQCGKTFHYRSALAVHQRIHTGEKPYECKQCGKTFTQSSGLAYHQRMHTGEKPYECKQCGKTFSHTSSLTIHQRVHTGEKPYECKQCGKTFSYTSSFSVHQRIHTGEKPYECKQCGKTFSHTSILSVHQR-MHTGEKPYECKECGRSFSHSSDLVVHQRIHTGEKPYECKQCGKTFGHTSSLSVHQRMHTGEKPYECKKCGKTFSHASSLSVHQRVHTREKPYECKQCGKTFGHASSLSVHQRVHTREKP.................................................................................................................................................................................................................................................................................................... 513
66 0.000e+00 ENSACAP00000000430 pep:novel scaffold:AnoCar1.0:scaffold_1439:29813:31852:-1 gene:ENSACAG00000000530 transcript:ENSACAT00000000  ali  1.................................................................................................................................................................................................................................MKEKPYECLECGKSFTRRENLRSHQ-RTHTGEKPYICLEKPYTCLDCGKSFTHSGHLRSHQRIHTGEKPYRCLDCGKNFTESGSLRSHQRIHTGEKPYTCKECGRSFTTIGGLHSHKRTHTTEKPYKCQQCGQGFTSREILHSHQRTHTGEKPYTCLECGQSFTQRGTLRSHQRTHTGEKPYICLECGQSFTQSSGLRSHQRTHTGEKPYKCLECGKSFTQRGHLHSHQKT-HTGEKPYICLECGQSFTHSSGLRSHQRIHTGEKPYKCLECGQSFTESGGLRSHRRTHTGEKPYTCLECGRSFTQRGHLHSHQKTHTGEKP................................................................................................................................................................................................................................................................................................................................ 341
67 0.000e+00gi|334349334|ref|XP_001374758.2| PREDICTED: zinc finger protein 184-like [Monodelphis domestica]  clstr ali  12  327LRSSLSSHQRIHTGKKPFECNECEKAFRDKFHLIEHQRIHTGEKPFECKECGKTF--------HNKYQLSVHQSTHTGQKPFVCIECKKTFISKSQLNKHKRIHTGEKPFECDNCGKAFTRKDHLTEHQRIHTGEKPYECAECG-KNFSQRKSLTVHQR-IHTGEKPYKCNECGKSFSHRKSFIF------HLRIHTGEKPYE-----CNECGKAFHNKSHLTVHQREKPYECNECGKKFSLSSSLTKHQ-RIHTGEKPFECSE-------CGKNFSRKSSLILHQRIHTGEKPFECNECGRNFSQRSSLVSHQRTHTGEKPFECNECGKNFTRRSLLSKHKTIHTGENP..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 651
68 0.000e+00gi|334328851|ref|XP_001371354.2| PREDICTED: zinc finger protein 91-like [Monodelphis domestica]  clstr ali  11  293..........................................................................................................................................................................QECD---TYGKNLKQYSDLGEHDR-------SFCRQNLCNICSKSFS-SSDLKEHSEEKVYKCKECGKFFTNRKSHRSHQ-RIHTGEKPFEC-------HQCGKAFRWKSYLTVHKRIHTGEQPFECNQCGKAFRQSSHLTVHQVTHMGEKPFECHQCGKFFSLSEQLIEHKRIHTGEKPFECNQCGKAFSQISQLTRHEKIHSGERPFECDQCGKCFIRSEQLSSHKRIHTGEKPFECHECGKCFSQRGQLNTHKRIHTGKKPFECSQCGKAFSRSTYLTVHQR-VHTKAKSFECQECQKCFISSEQLTEHKRIHTEKKYFDCNQCGKTFTRSSHLTVHQRIHTGEKPFKCHQCGKSFSSGRLSTHKKIHTGEKPFECNQCGKTFSRSSNLSVHQRIHTGEKPFECPKCDKTFSQSRS...................................................................................................................................................................................................................................................................................... 698
69 0.000e+00gi|327290813|ref|XP_003230116.1| PREDICTED: zinc finger protein 850-like, partial [Anolis carolinensis]  clstr ali  11  1...........................................................................................................KAYKCIECGKSFSQHGKLKRHQRTHTGEKPYNCLECG-QSFADSSTLRKHQRT-HTGEKPYKCLECGQNFSHN------SQLHRHQRTHTGEKPYN-----CLECGQSFARSSVLRSHQREKPYKCLECGHSFADSSTLRKHQ-RTHTGEKPYNCLE-------CGQSFTQKGHLHTHQRTHTGEKPYKCLECGQSFAHSSGLRNHQRTHTGEKPYNCLECGQSFADSTGLRSHQRTHTGEKPYNCLECGQSFTQKGHFHTHQRTHTGEKPYNCMECGQSFTQKGHLHTHQRTHTGEKPYNCLECGQSFTQKGHLRTHQRTHTGEKPYKCLECGQSFTQKGNLHKHQRT-HTGEKPYKCLECGHSFARSSHLRRHQRTHTGEKPYKCLECGQSFTHSSGLRSHQRTHTGEKPYKCLECGQTFTHSSGLRSHQRTHTGDKSYTCLECGQSYTRSSSLRSHQRTHTGEKP.................................................................................................................................................................................................................................................................................................... 452
70 0.000e+00gi|297276666|ref|XP_002801214.1| PREDICTED: putative zinc finger protein 724-like [Macaca mulatta]  clstr ali  11  166..............................................................................EKPFKCKECGKSFCVLSHLTQHKRIHTTVSSYKLEECSKAFNVSSTLSQHKRIHTRQKHYKCEECGIA-FNKSSHLNTH-KIIHTREKSYKREECGKAFNIS------SHLTKHKIIHTGENAYK-----CKECGKAFNQSSTLTRHKGEKPYICEHCGRAFNQSSNLTKHK-RIHTGDKPYKCEE-------CGKAFNVSSTLTQHKRIHTGEKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCEECGKAFNTSSHLTTHKRIHTGEKPYKCEECGKAFNQFSQLTTHKIIHTGEKPYKCKECGKAFKRSSNLTEHRIIHTGEKPYKCEECGKAFNLSSHLTTHKKIHTGEKPYKCKECGKAFNQSSTLARHKI-IHAGEKPYKCEECGKAFYQYSNLTQHKIIHTGEKPYKCEGKAFNWSSTLTKHK...................................................................................................................................................................................................................................................................................................................................................................... 581
71 0.000e+00gi|298231518|ref|NP_001177231.1| predicted gene 14326 [Mus musculus]  clstr ali  59.SRSHGRHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQI--------HKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTGEKPYECNQCGKA-FVSSGDLQKHKRT-HTGEKPYECKQCGKAFSQS------SHLRIHKRTHTGEKPYEW-----NQCGKAFARSGDLQKHKREKPYECKQCGKAFAHSSHLHIHERR-HTGDKPYECKQCGYECKQCGKAFTVIYTLQMHKQTHTGEKPYECKQCGKAFSQSRHLRIHKRTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKSYECKQCGKAFAGSSHLRIHKRTHTGEKPYECNQCGKAFITRRVLQIHKRTHTGEKSYECKQCGKAFASSSDLQKHKRT-HSGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 554
72 0.000e+00 ENSACAP00000006998 pep:novel scaffold:AnoCar1.0:scaffold_1037:48505:55081:1 gene:ENSACAG00000007161 transcript:ENSACAT000000071  ali  1.................................................................................................................................................................................................................................MEEKPYICVECGKRFAHSSSLDIHQ-RTHTGEKPYKCQE-------CGQSFACNGNLHSHQRIHTGEKPYKCQECGQSFSTSGILRLHKRTHSGEKAYKCLECGQSFARSGTLRLHQRTHTGEKPYKCLECGQSFARKAHLQSHQRIHTGEKPYKCQECGQSFTESGSLHKHQRTHTGEKPYKCLECGHNFTQSSGLRSHQRIHTGEKPYKCLECGQSFS-DSSLLRSHQWTHTGEKPYKCLECEQSFAHSSALHKHQRIHTGEKPYKCLECGQSFAQSGNLSSHQRTHTGEKPYKCLECGHSFTQSSSLRSHQWTHTGEKP................................................................................................................................................................................................................................................................................................................................ 313
73 0.000e+00gi|345785499|ref|XP_854483.2| PREDICTED: zinc finger protein 268 [Canis lupus familiaris]  clstr ali  11  139..................................................CVKTFSMVKNLKRHH--------RIHTEGKPYECSECPKSFRYKSKLIIHQRTHTGEKPYRCPECQKAFSTKCHLTLHQRTHTGEKPYGCIEC-PKSFRTKYHLILHHRT-HTGEKPFECKECGKA------YREKTKLRLHYRTHTGEKPFE-----CTDCGKSFMQKSNLIIHQRDRPYGCRECEKTFCSKSQLVVHQ-RTHTGERLYECKE-------CGKAFNKNSHLLTHQRIHRGEKPYECSECGKAFVHTSQLIVHQRNHTGRKSYECKECGKAFNKKSHFITHQRIHTGEKPYECSECGKAFIDNSQLIVHRRTHTGEKPYECKECGKAFNKKSSLITHQRIHTGEKPYKCSECGKAFIDKSHLIVHQRTHTGEKPYECSECGKAFIRKAMLIVHQRTHTGSKKPHGCNECGKAFRQKSHLIIHQRCHTGEKPYGCVPCGQIFNQKSQLIRHQRRHTGEKPYQCTQCGKAFFEKSYLSVHQRSHSGQKP................................................................................................................................................................................................................................................................................................................................ 623
74 0.000e+00 ENSACAP00000000112 pep:novel scaffold:AnoCar1.0:scaffold_754:32223:46451:1 gene:ENSACAG00000000117 transcript:ENSACAT0000000011  ali  14  153VNGSLRSHQRTHTGEKPFKCLECGKSFTESRSLHRHQRTHTGEKPYTCLECGKSFAQRQTLDA--------HQRTHTGEKPFKCLECGQSFTESGSLHVHQRTHTGEKPYSCLECGKSFTESGSLWKHQRTHTGEKPYKCLECG-KSFTESSNLRSHQRT-HTGEKPYKCLECGKSFTQ------RVNLDSHQRIHTGEKPY-----TCLECGKSFTQRGNLHAHQREKPYKCLECEQSFTQSGYLRKHQ-RIHRGEKPYSCLE-------CGKSFAQRVNLDSHERTHTEEKPYTCLECGKSFTESESLWTHQRTHTGEKPYK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 451
75 0.000e+00 ENSACAP00000013865 pep:novel scaffold:AnoCar1.0:scaffold_1027:47711:68964:1 gene:ENSACAG00000014145 transcript:ENSACAT000000141  ali  11  223.SSTLRRHQRIHTGEKPYTCLECGHSFTDSSNLRSHQRIHTGEKPYNCLECGQSFADSSHL--------RSHKRIHTGEKPYNCLECGQSFARSANLHLHQRIHTGEKPYNCLECGQSFAQSSGLYSHQRTHTGDKPYTCLECG-QSFTHNSTLQTHQRT-HTGKKPFKCLECGQSFA------RSSSLQTHQRTHTGEKPFK-----CLECGQNFTQSGNLRSHQREKPYKCLDCGQSFVQSSGLRKHQ-RTHTGEKPFKCLE-------CEQSFARSEHLRSHQRTHSGEKPFKCLECGQSFTQSSGLYSHQRTHTGEKPYNCLECGQSFADSSHLRSHQRIHTGEKPYNCLECGQSFAHSSGLRNHQKTHTGEKPFKCLECGQTFAQSGNLRTHQRTHSGEKPFKCLECGQSFAQSRYLRSHQRTHTGEKPYKCLECGQSFAQSGNLRSHQRTHTGEKP..................................................................................................................................................................................................................................................................................................................................................................................................................... 658
76 0.000e+00 ENSACAP00000001741 pep:novel scaffold:AnoCar1.0:scaffold_1046:154907:172416:1 gene:ENSACAG00000001825 transcript:ENSACAT0000000  ali  12  1...............................................................................................................................HQRTHTVEKPYECLEC-KQSFTQLAYLHRHQRT-HTGEKPFKCSECGQSFTQS------SGLRAHQRTHTGEKPY-----TCLECGQSFAHSSGLCSHQKKKPYKCQECGQSFTQSSGLRSHQ-RTHTGEKPYTCLE-------CGKSFPKSSNLRSHQMTHTGEKPYTCLVCGKTFTQSSNLHRHQKTHTEEKPYTCLECGQSFTRKDHLQQHERIHTGEKPYKCLECGMSFTRRDSLQQHERNHTGEKPYECLECGKSFTQNSDLRKHQRSHTGEKPYECLECGKSFIQSSDLRTHQRTHTGEKPYICLECGKSFTHSSSLYLHQRS-HTGEKPYECLECGQSFTRSSGLHLHQRTHTGEKPYVCLECGQSFARSSGLHLHQRTHTGEKPYECLECGNSFSDTSGLRAHQRTHTGEKPYECPECGQRFTHSSSLCTHQKTHSGKKP.................................................................................................................................................................................................................................................................................................... 430
77 0.000e+00gi|334335549|ref|XP_003341785.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  118.......................................................DHYSSKENLQPLFINYHQKISTEEKSHKCSECGKTFGNKSALSQHQLVHTGEKPYECIECGKAFSRKAGFIQHQRIHTGEKTYQCVECG-KSFSWNGELTQHQR-IHTGEKPYECNECEKTFRQSTQ------LTQHQHVHTGEKPYK-----CNECGKAFRLSTQLTRHHGEKPYECNECGKAFRQGTQLTQHQC-IHTGEKPHKCNECGYECRKCGKTFSQKAEFTLHKCIHSGEKPFECNKCRKSFHRRALLIQHQRIHTREKLYECVECRKTFSWSGELVQHQCIHTGEKPYKCNECGKAFQESTQLSQHQHIHTGQKPYECNECGKTFRLSTMLNQHQRIHTGEKPYECITCGKTFQQSTQLARHQKIHTGERSYECGECEKAFSQKAELAIHKR-IHTGEKPYECNECGKAFRLSTLLNRHQRIHTGEKPYECS.................................................................................................................................................................................................................................................................................................................................................................................... 595
78 0.000e+00gi|301777778|ref|XP_002924282.1| PREDICTED: zinc finger protein 235-like [Ailuropoda melanoleuca]  clstr ali  10  245........................................................................................................................................................................................................PLTQQTYHCSECEKAFSDGPSLKVHQQKKRYWCHECGKGFSQSSNLQTHQ-RVHTGEKPYSCLECGYRCESCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRVHTGEKPYKCEVCGKGFSSASSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKCEECGKRFNWSLNLHNHQR-VHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCEACQKRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHGEKPFKCEECGKEFSWSAGLSAHQRVHTGEKPYTCQQCGKGFSQ......................................................................................................................................................................................................................................................................................... 682
79 0.000e+00gi|350592382|ref|XP_001928396.2| PREDICTED: zinc finger protein 605 isoform 1 [Sus scrofa]  clstr ali  200........................................................................................................................................................................................................................................CMECGKVFNKKSQLIIHQ-RTHTGEKPYGCHD-------CGKAFSQKSLLTIHQRTHSGEKPYGCGECQKAFSRKSLLILHQRTHTGEKPYGCSECGKAFSRKSQLKRHQITHTVEKPYGCSDCGKAFSQKLKLITHQRTHTGEKPYKCSDCGKAFFWKSQLITHQRIHTGKKPYACSECKKAFSRNSLLIRHQRIHTGEKPYECSECGEAFIRKPQLVKHQMT-HTGEKNYQCSNCEEAFFKKSELIRHQKIHLGEKPYGCIECGKTFFGKSQLLTHQRTHTGEKPYECSACGKAFTQKSSLISHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 505
80 0.000e+00gi|348553626|ref|XP_003462627.1| PREDICTED: zinc finger protein 268-like [Cavia porcellus]  clstr ali  10  119..................................................CDKGF--------HEETAFVRCKRTHAGNKNFECHECGKAYCRKSNLVEHLRIHTGERPYRCGECAKTFSAKSYLIAHQKTHTGEKPFECHECG-KSFGRKSQLILHQRT-HTGERPYECMACGKTFSE------KATLTIHQRTHTGEKPYK-----CGECGKTFRVKISLTQHQREKPYECRDCGKNFRAKKSLNQHQ-RIHTGEKPYECGE-------CGKFFRMKMTLNNHQRTHTGEKPYQCNECGKSFRVHSSLGIHQRIHTGEKPYECNECGNAFYVKARLIEHQRMHSGEKPYQCSECGKIFSMKKSLCQHQRTHTGDKPYECSKCGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQRTHMGAKPYKCSECGKSFFQLSSLLRHQ-TTHNGEKLYECSECGKAFSLNSALNIHQKIHTGER......................................................................................................................................................................................................................................................................................................................................................................................... 537
81 0.000e+00 ENSACAP00000001751 pep:novel scaffold:AnoCar1.0:scaffold_1052:59657:106649:-1 gene:ENSACAG00000001837 transcript:ENSACAT0000000  ali  10  1..............................................................................EKPYKCLKCGKRFTGSGSLRSHQRTHTGEKPYKCMECGKRFTGSGGLHSHQRIHTGEKPYKCLECG-QSFARSTSLRSHQ-ITHTGEKPYKCPECGQCFA------RNTNLRSHQRTHTGEKPYK-----CLECGRSYSHLTGLRSHIREKPYKCLECGQCFTDSSSLRSHQ-RTHTGERSYPCLE-------CGQSFADSSGLHRHQRIHTGEKPYKCLECGKSFTRRESLRAHQRIHTGEKPYKCLECGQSFAYNSGLRSHQRTHTGEKPYICLECGKRFTHSSNLREHRRIHTGEKPYKCLECEQRFTYSSGLHRHQRIHTGEKPYTCLECGKKFTHSSNLREHQRIHTGEKPYTCLECGQSFTHSSGLRSHQRT-HTGEKPYTCLECGKRFSHSSNLREHQRIHTGEKPYTCLECEQSFTQISNLRSHQKTHTGEKPYTCLDCGQSFTRSQHLRSHQWIHTGEKPYKCLECGQSFTHSSTLHKHQKTHTGEKP.................................................................................................................................................................................................................................................................................................... 479
84 0.000e+00gi|377835207|ref|XP_001487846.3| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 845 [Mus musculus]  clstr ali  95................................................................................................................................................................................................................................................SQTSRRNGRHKRSHTGEKPYKCNEKPYECNQCGKAFSCPSNFQNHKRTHTREKPYECNQCGKAFTRHGHLQSHERTHTGEKPYECNQCGKAFSWNYCLQIHKRTHTGEKPYECNQCGKAFTRHHHLQRHERTHTGEKPFECNQCGKTFACHRDLQRHERTHTGEKPYECDQCGKAFSWKSCLRIHKKTHTGAKPFECSQCGKAFASHGDLQRHERT-HTGEKPYDCKECGKAFSCHSGLQQHKRTHTGEKPYECNLCGKAFARQSNLQRHERTHTGEKPNECNHCGKAFSQYSGLLRHKRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 424
85 0.000e+00gi|327289568|ref|XP_003229496.1| PREDICTED: zinc finger protein 850-like, partial [Anolis carolinensis]  clstr ali  15  525VSSGLHSHQRTHTGEKPYKCLECGQSFAQTGHLRSHQRTHTGEKPYNCLECGQSFSDCSSL--------RSHQRTHTWEKPYKCLECGQSFSHNSHLHRHQRTHTGEKPYNCLECGQSFTLKENLQTHQRTHTGEKPYKCLECG-QSFARSSGLRSHQRT-HTGEKPYKCLECGQSFI------DCSTLRSHQRTHTGEKPYK-----CLECGQSFAHRGHLRSHQREKPYNCLECGQSFAVSSGLRSHQ-KTHTGEKPYKCLE-------CRQSFTQRGHLRSHQRTHTGEKPYKC.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 796
86 0.000e+00 ENSACAP00000000254 pep:novel scaffold:AnoCar1.0:scaffold_3893:3018:4454:-1 gene:ENSACAG00000000283 transcript:ENSACAT0000000026  ali  11  1.......................................................................................................................................KAYKCIECG-KSFSQHGKLKTHQRT-HTGEKPYNCLECGQSFTQ------KGNLNTHQRTHTGEKPYN-----CLECGQSFTQKGHLHSHQREKSYNCLECGQSFAHSSALHRHQ-RTHTGEKPYECLE-------CGQSFARSSGLRSHQRTHTGEKPYECLECGQSFARSSALRRHQRTHTGEKPYECLECGQSFAHSSALRSHQRTHTGEKPYECLECGQSFACSSALRRHQRIHTGEKPYECLECGQTFAQISTLHSHQRTHTGEKPYECLECGQSFARSSGLRSHQRTHTGEKPYKCLECGQSFAHSSALRSHQRT-HTGEKPFECLECGQSFACSSALRRHQRIHTGEKPYECLECGQSFTQRGNLRSHQRTHTGEKPFKCLECGQSCTHSSDLRSHQRTHTGEKPYECLECGQSFARSSGLRSHQRTHTGEKP.................................................................................................................................................................................................................................................................................................... 422
87 0.000e+00gi|334329038|ref|XP_003341170.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica]  clstr ali  10  237...........................................................................HHGVKGFQDGDCETSFGLSPNLISHQKSNAGEMSYKYREHGTTFTQNSPLGLHQKVPPGKKSYECNQCGKAFF-RNTDLSQHQK-IHSAEKAYKCSECGKAFSQSR------DLHRHQRIHTGEKPYK-----CNECGKAFSYSSSLIAHQREKPYECSQCGKAFRNHSNLAVHQ-RIHTGEKPYKCNE-------CGKAFSQSRDLLRHQNIHTGEKPYKCNECEKAFSQSRDLLRHQNIHTRGKPYKCNECDKSFSQSTSLLTHQSIHAGERPYKCNECGKAFSRSSNLRVHQRIHTGEKPYKCDECGKAFRQNFHFAAHVRIHTGEKPYKCNECGDAFRESVILNVHQRIHSEVRPYECRECGKTFCSKVGVTRHER-IHTGVKPYECHECGKAFLQKSYLTQHAQMHTGEKPFKCH.................................................................................................................................................................................................................................................................................................................................................................................... 638
88 0.000e+00gi|281346527|gb|EFB22111.1| hypothetical protein PANDA_021041 [Ailuropoda melanoleuca]  clstr ali  14  414VRGQLNLHQRIHTGEKPYECKECGKTFRQYAHLTRHQRLHTGEKPYECKECGKAFRVRQQLTL--------HQRIHTGEKPYDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECQKFFRRYSELISHQGIHIGEKPYDCKECG-KTFRLFSQLTQHQ-SIHFGEKPYKCKECEKTFRCGKTFRLFSQLTQHQSIHTGEKPY-----DCKECGKAFRLHSSLIQHQREKPYKCKECKKAFRQHSHLTYHQ-RIH..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 688
89 0.000e+00gi|162135938|ref|NP_938081.2| zinc finger protein 273 [Mus musculus]  clstr ali  14  204VRTTLSKHQRIHTGEKPYKCDECGKTFNVHSTLSKHQRIHTGEKPYKCEECGMAFNVRCILSK--------HQRTHTGEKPYKCKECGKAFNCSSSLHQHQQIHRGEKLYKCDDCGQAFSCSSYLYKHRRIHTGMKPYKCKECGKA-FYCSVNLIYHQR-IHTGEKPYKCNECGKAFS------ICSTFLKHQRIHSGEKPYK-----CKECEKAFNNCYNLIQHQREKPYKCKDCGKAFNYTSSLAQHE-RIHTGEKPYKCEE-------CGKAFNSSSNLKHHWRLHTGEKPYKCEQCGKAFKNCSGFTRHYRIHTRE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 498
90 0.000e+00gi|327284602|ref|XP_003227026.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis]  clstr ali  11  297............TSEKPYKCNVGGECFPQNVALVLHKTLDAGEKPYKCKEGGKCFVQSSSL--------VSHQRVYTGENPYSCTDCGKCVSSSSSLVRHKRLHTGEKPYQCQECGKCFAASSDLVSHKRLHTGEKPYQCQECG-KCFADRSALAKHKR-LHTGEKPYQCQECGKCFVYS------SQLLSHKRLHTGEKPY-----QCQECGKCFASSSCLVRHKREKPYQCQECGKCFASSSGLVKHK-RLHTGEKPYQCQE-------CGKCFADGSALVRHKRLHTGDKPYQCQECGKCYPCKSSLLRHQSIHTGEKPFQCQECGKCFTQSSSLLSHQRIHTGEKPYQCQECGKCFVYNSQLLSHKILHTGEKPYQCQECGKCFADRSALAKHNRLHTGEKPYQCQECGKCFADSSQLLRHKRLHTGENPYQCQECGKCFVYSSQLMRHKK-LHTGEKPYQCQECEKCFARSSYLVRHKKLHTGEKSYQC..................................................................................................................................................................................................................................................................................................................................................................................... 797
92 0.000e+00gi|21740198|emb|CAD39111.1| hypothetical protein [Homo sapiens]  clstr ali  168..........................................................................................FSLSPNLMACQEIPTEERPHPYDMGGQSFQHSVDLTGHEGVPTAESPLICNECG-KTFQGNPDLIQRQ-IVHTGEASFMCDDCGKTFSQN------SVLKNRHRSHMSEKAY-----QCSECGKAFRGHSDFSRHQSERPYMCNECGKAFSQNSSLKKHQ-KSHMSEKPYECNE-------CGKAFRRSSNLIQHQRIHSGEKPYVCSECGKAFRRSSNLIKHHRTHTGEKPFECGECGKAFSQSAHLRKHQRVHTGEKPYECNDCGKPFSRVSNLIKHHRVHTGEKPYKCSDCGKAFSQSSSLIQHRRIHTGEKPHVCNVCGKAFSYSSVLRKHQIIHTGEKPYRCSVCGKAFSHSSALI-QHQGVHTGDKPYACHECGKTFGRSSNLILHQRVHTGEKPYECTECGKTFSQSST......................................................................................................................................................................................................................................................................................................................................................................... 565
94 0.000e+00gi|291413771|ref|XP_002723140.1| PREDICTED: zinc finger protein 347-like [Oryctolagus cuniculus]  clstr ali  91..................................................................................................................................................................................................................................REKPFKCNECGKTFFQRSQFADHQ-RTHTGEKPYECKE-------CGKSFYYKSALNVHQGKHKEEKPHKCTECGKSFCYKSALIIHQVTHTGKKPYDCNECGKSLCVKLNLTKHQKIHTGEKPYECSECGKSFSMKSDLVVHQRTHTGEKPYGCNECEKSFYKKSALTKHQRTHTGEKPHECNECGKSFHMKSTLVIHQRTHTGEKPFKCNECEKSFYVKS-LLNIHQRNHTGKKPHVCNECGKAFSMKSNLTDHQRTHSKEKPYECFECHKTFRHKSTTHTGEKPYKCNECGKSFYMKSALSQHQRIHTGEKPYGCKECGKAFFQKSHLTKHQRTHTGEKPYECKECKKT................................................................................................................................................................................................................................................................................................. 439
95 0.000e+00gi|332205873|ref|NP_001193742.1| zinc finger protein 197 [Bos taurus]  clstr ali  12  369.............GKKLYKCDMCYKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLM--------HLRNHSGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPYKCNECG-KVFSQNAYLIDHQRRIHSGEKPYKCDECGKTFACGKVFIRSKSLLLHQRVHT-----EKKTFGCKKCGKIFTSKSSLIDHKREKPYKCTECGKAFTQSAYLFDHQ-RLHNGEKPYECNECGYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECNECGRAFSSNRNLIEHKRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHTGEKPYACNECGKGFTYNRNLIEHHQRIHTGEKPYKCSECGKDFSQNKNLVVHQRMHTGEKPYECE.................................................................................................................................................................................................................................................................................................................................................................................... 936
96 0.000e+00gi|338717222|ref|XP_001490144.3| PREDICTED: zinc finger protein 33B-like [Equus caballus]  clstr ali  178........EKTHMGETPFEFIQNQKYLSQNEDFFPYQKSKNVEQSFEYKESGKDF--------HEKAVVITYKQAHIGESPCEHKECDKTFCNCSTYMVHKITEKRENLYEFNEYGKTF-EKSCLLKH-RAHLKVKGYDCIE-RVGNFSRRSNLNVTQRT-HAQDKVYECNECGKAFCE------KSKLTKHQRIHTGEKPFE-----CNACGKCFSRKSLLTLHQREKPYRCNECGKSFSRNSHLIIHQ-RTHTGEKPYECKE-------CRKSFYHKSYLTVHQRIHTGEKPYECNQCGKTFISNSVLTIHQKIHTGEKPFECNQCGKFFSRNSYLTIHQRTHTGEKPYECKQCGKTFSRNSGLKVHQRIHTKEKPYECNECGKSFSEKSVLTVHQRIHTGEKPYKCNECGKTFYNKSDLTKHHRTHTGEKPYECKECGKFFSRNSYLTVHQRRTHTGEKPYGCNECGKAFSEKSVLTVHQRIHTGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 691
97 0.000e+00gi|359318825|ref|XP_541654.4| PREDICTED: zinc finger protein 585A [Canis lupus familiaris]  clstr ali  11  100.....................................................................................................................................GEKLWDHNQCG-KILSYKQAPSQHQK-IHTGEKPYECAEFGKIFTQ------KSQLRVHLKVHTGEKLY-----VCIDCGKAFVKKPEFITHQREKPYKCSECGKAFFQVSSLLRHQ-RIHTGEKLYECSE-------CGKGFSYNSDLSIHQKIHTGERHHECNDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTHLIAHRRIHTGEKPYECDNCGKSFISKSQLQVHQRIHTRMKPFICTECGKAFTYRSELIIHQRIHTGEKPYECGDCGKAFTQKSALTVHQRIHTGEKSYVCMKCGLAFIQKAHLIAHQI-IHTGEKPYKCGHCGKSFTSKSQLHVHKRIHTGEKPYMC..................................................................................................................................................................................................................................................................................................................................................................................... 470
98 0.000e+00 ENSACAP00000013694 pep:novel scaffold:AnoCar1.0:scaffold_1519:16232:22423:1 gene:ENSACAG00000013964 transcript:ENSACAT000000139  ali  12  187LKGNLHRHQRTHTGEKPYKCLECGQSFTLKGNLHRHQRTHTGEKPYKCLECGQSFARSSGL--------RSHQRTHTGEKPYNCLECGQSFTHSSGLRSHQRTHTGEKPYKCLECGQSFSHNSHLHRHQRTHTGEKPYNCLECG-QSFAHSSGLRSHQRT-HTGEKPYKCLDCGQSFAQS------GHLHSHQRTHTGEKPYN-----CLECGQSFSDCSSLRSHQREKPYKCLECGQSFTLKGNLQTHQ-RTHTGEKPYKCLE-------CGQSFSHNSHLHRHQRTHTGEKPYICLECGQSFAHSSALRSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 483
99 0.000e+00gi|338710389|ref|XP_001492137.3| PREDICTED: zinc finger protein 805 [Equus caballus]  clstr ali  11  201..........................................................................................................................................................................................................EENIFKCNECGKVFNKKHLLAGHEKIKPYECTECGKTFIKSTHLLQHHM-IHTGERPYECME-------CGKAFNRKSYLTQHQRIHSGEKPYKCSECGKAFTHRSNFVLHKRRHTGEKPYECFECGKVFKHKSYLMWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRIHTGEKPFVCTECGRAFTHCSTFILHKRAHTGEKPFECKECGKAFSTRKDLIR-HFSIHTGEKPFECMECGKAFNRRSGLTRHQRIHSGEKPYEC..................................................................................................................................................................................................................................................................................................................................................................................... 515
100 0.000e+00 ENSACAP00000017173 pep:novel scaffold:AnoCar1.0:scaffold_780:492530:493894:1 gene:ENSACAG00000017449 transcript:ENSACAT00000017  ali  1...............................................................................................................................................................................................HERTHSGEKPYK-----CLECGKSFAQNGSLNKHQREKPYTCLECGKSFTHSGNLHSHQ-RTHTGEKPYTCLE-------CGKSFSRSRNLHSHNRTHTGEKPYKCLECGKCFTDSRTLHKHQRTHTGEKPYACLECGKSFAQRAHLYLHHRTHTGEKPFSCLECGKSFSHSGTLHKHQRIHTGEKPYTCLECGKSFTHSATLHKHQRTHSGEKPYTCVECGKSYTDSGTLHKHQRTHTGEKPYVCLECGKGFTESGTLQKHQRT-HTGEKPYTCSECGKNFTESGSLQKHQRIHTGEKPYTCLECGKSFTESGSLHSHQRIHTGEKPYKCPECGKSFMRSGSLRLHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 346
102 0.000e+00gi|296213335|ref|XP_002753225.1| PREDICTED: zinc finger protein 268 [Callithrix jacchus]  clstr ali  13  721LKSQLIVHQRSHTGIKPHGCSECGKAFRSKSYLIIHMRTHTGEKPHECSECGKSFSFNSQL--------IVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKA-FIWKSLLIVHERTHHTREKPYECNECGKAFT------RNSQLTVHQRTHSGEKPY-----GCTECGKMFSQKSILSAHQREKPCKCTECGKAFCWKSQLIMHQ-RTHIRDKH................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 989
103 0.000e+00gi|332854455|ref|XP_528849.3| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 208 [Pan troglodytes]  clstr ali  15  722MFSILAKHKVIHTGEKLYKCEECGKAYKWPSTLRYHKKIHTGEKPYKCEECGKAFSTFSILTKHKV--------IHTGEKPYKCEECGKAFSWLSVFSKHKKIHTGEKLXKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECG-KGFSMFSILTKH-KVIHTGEKPYKCKECGKGFC------TFSILAKHKVIHTGEKPYK-----CEESGKAFSWFSVFSKHKKEKHYKXEECGKGFNQSSNLMEHK-RIHTGEKPYKCEE-------CDKDFNWSSHLTTHKRIHTGGK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 989
104 0.000e+00gi|194214453|ref|XP_001493339.2| PREDICTED: zinc finger protein 605 [Equus caballus]  clstr ali  201........................................................................................................................................................................................................................................CVECGKTFSKKSQLIVHQ-RTHTGEKPYGC-------GQCGKAFSQKSLLTIHQRTHSGEKPYGCGECQKAFSRKSLLVLHQRTHTGEKPYSCRECGKAFSRKSQLKRHQRTHTVEKPYGCSDCGKAFSQKLKLISHQRMHTGEKPYKCGDCGKAFFWKSQLITHQRTHTGKKPYACSECEKAFSRNSLLIRHQRIHTGEKPYECRECGEAFIRKPQLVKHQIT-HTGERNHHCGDCDEAFFKKSELIRHQKTHLGEKPYGCVECGKTFFGKSQLLTHQRTHTGEKPYECSECGKAFTQRSSLMSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 506
105 0.000e+00gi|297278013|ref|XP_001095505.2| PREDICTED: zinc finger protein 470-like [Macaca mulatta]  clstr ali  11  268.SAHLAQHQRIHTGEKPFECIECGKAFSQNAHLVQHQRVHTGEKPYQCKQCNKAFSQLAHLA--------QHQRVHTGEKPYECIECGKAFSDCSSLAHHRRIHTGKRPYECIDCGKAFSHRGSLTLHQRVHTGEKPYECKECGKA-FRQSTHLAHHQR-IHTGEKPYECKECSKTFSQN------AHLAQHQKIHTGEKPYE-----CKECGKAFSQIAHLVQHQREKPYECIECGKAFSDGSYLVQHQ-RLHTGKRPYECLE-------CGKAFRQRASLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFSQVAHLTLHKRIHTGERPYECKECGKAFRQSVHLAHHQRIHTGE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 656
106 0.000e+00gi|354467743|ref|XP_003496328.1| PREDICTED: zinc finger protein 12-like isoform 2 [Cricetulus griseus]  clstr ali  14  440LNSALMRHQRVHTGEKPYECNECGKLFSQLSYLTVHHRTHSGVKPYECSECGKTFYQNSALCR--------HRRIHRGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHTGEKAYECYECG-KCFSQMSYLTIHHR-IHSGEKPFECNECGKAFS------RMSYLTVHYRTHSGEKPYE-----CPECGKKFYHKSAFNSHQR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 645
107 0.000e+00 ENSACAP00000011087 pep:novel scaffold:AnoCar1.0:scaffold_808:199612:206419:-1 gene:ENSACAG00000011347 transcript:ENSACAT0000001  ali  12  1........................................................................................................TGQKQYTCLECGKSFTYNSVLRSHQRTHTGEKPYKCQECG-QSFTHYSSLRSHQRT-HTGEKPYKCLECGQSFTQN------SNLHRHQRTHTGEQPYK-----CLECGKSFTQSSHLRKHEREKRYKCLECGQSFTQDSGLHSHQ-RTHTGEKPYKCLE-------CGQSFTHDSSLRSHQRIHTGEKPYKCLECGKSFTQSSHLRKHERIHTGEKRYKCLECGQSFTQSSVLRSHQRTHTGEKPYKCLECGQSFTKNGSLRSHQRTHTGEKPYTCLTCGQSFTHNSSLRSHQRTHTGEKPYTCLECGRSFTHNSSLRSHLRTHTGEKPYKCLECGQSFSKNGSLHSHQR-IHTGEKPYTCLTCGQSFTQHAHLRSHQRTHTGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 372
108 0.000e+00gi|297716438|ref|XP_002834527.1| PREDICTED: zinc finger protein 227-like isoform 2 [Pongo abelii]  clstr ali  10  164...................................................GKQIDVKNNLHIHEDFMKKSHIKTDTEPKPCKGNEYGKIISDGSN----QKLPLGEKPHPCGECGRGFSYSPRLPLHQNVHTGEK----------CLSQSSHLQTHQR-IHPGEKLNRCHESGDCFNKSSFHSYQSN-------HTGEKSY-----RCDSCGKGFSSSTGLIIHYREKPYKCEECGKCFSQSSNFQCHQ-RVHTEEKPYKCEE-------CGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHKRVHTGEKPYRCDVCGKDFSYSSNLKLHQV-IHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKP................................................................................................................................................................................................................................................................................................................................ 631
111 0.000e+00gi|334324892|ref|XP_001374426.2| PREDICTED: zinc finger protein 268-like [Monodelphis domestica]  clstr ali  10  188.................................................................RTVPNSHQKIHAGENFILCSECGKAFFSKEQLITHQRTHPKKKPFECDECEKAFSRKGHLVCHQRTHTGEKPFECNECGKA-FSYKKSLVIHQRT-HRGEKPFGCNECGKAFSCGKTFIIRQSLIKHQRVHTGEKPF-----QCNECGKAYTCNSTLIVHQREKPFECNECGKAYTRKGHLVSHQ-RTHTREKPFECNECGFECNECGKTFMEKNSLIRHGRIHTGEKPFECNECGRTFSFKDSFIRHQSIHSGEKPFECNECGKAFKLKKSLISHQSIHSGEKPFECNECGKTFSMRNNFRRHQRTHTGEKLCQCNECGKAYTCKASLIVHQRIHTGEKPFECNKCGKTYIWKGHLVSHQRTHTGEKPFECNECGKAFSYKTSLVVHQRT-HRGEKPFKCNECGKTFIEKQNLIRHGRIHTGEKPFECS.................................................................................................................................................................................................................................................................................................................................................................................... 655
112 0.000e+00gi|327291828|ref|XP_003230622.1| PREDICTED: putative uncharacterized zinc finger protein 814-like [Anolis carolinensis]  clstr ali  15  340.SGNLRTHQRTHTGEKPHKCMECGKSFSESGHLRIHQRMHTGEKPHTCMECGKSFSESGHLRTHQRTCMECHQRMHTGEKPHKCMECGKSFSESGNLRTHQRTHTGEKPHTCRECGKSFSQSGHLRIHQRMHTGERPHTCMECG-KSFSESGNLRTHQRT-HTGEKPHKCMECGKSFS------RSGDLRNHQRMHTGERPYKCRPHKCVECGKSFSESGHLRIHQREKPHKCMECGKNFSNSSNLRTHQ-KIHTGEKPHK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 637
113 0.000e+00gi|377835891|ref|XP_003688938.1| PREDICTED: zinc finger protein 845-like [Mus musculus]  clstr ali  11  47..................................RHKRTHTGEKPYECNQCGKAFPTPSHLQY--------HKRTHTGEKPYGCNQCGKAFARPSHLQHHKRTHTGEKPYECNQCGKVFSHHSNLQHHKRTHTGEKPYGCNQCGKA-FAQLSSFQCHKRT-HTGEKPYECNHCGKAFA------RHSYLQCHKRTHTGEKPYE-----CNQCGKVFSQHSHLQCHKREKLYECNQCGKAFACHSNLQRHK-RTHTGEKPYECN-------QCGKVFSHHSNLQHHKRTHKGEKPYGCNQCGKAFALLSSFQCHKGTHTGEKPYECIQCGKAFARPSLLQFHKRTHTGEKPYECNQCGKAFARPNHLQYHKRTHTGEKPYECNQCGKAFAGHSNLQRHKRTHTGEKPYECNQCGKVFAGYSNLQCHKRTHTGEKPYECNQCGKVFSQLSNLQ-HHKRTHSGEKPYECNQCGKVFSRHSHLQCHKRTHTGEKPYECNQCGKAFAQLSILQRHKRTHTGEKPYECNQCGKAFARHSDLQFHKRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 533
114 0.000e+00gi|358422546|ref|XP_001788529.3| PREDICTED: zinc finger protein 429 [Bos taurus]  clstr ali  11  172........................................................................................................................................................................KCKICEKVFS------KSSNLSRHRRIHTGRKPFK-----CTECCTAFNCHSLLTQHQREKPYICKDCNKAFRRSSFLTQHQ-RIHTGEKPYKCTV-------CGKAFTYNSSLIKHQRIHAGEKPYKCTECSKAFTYNSLLIQHQQIHTGEKPYKCTECGKAFTYNSRLIEHQQIHAGEKPYKCTECSKAFIYNSLLIKHRRIHSGEKPYKCTECSKAFTYNSSLIQHRRIHTGEKPYKCTECSKAFIYNSLLIQHRRIHTGEKPYKCTECSKAFTYNSSLI-QHRRIHSGEKPHKCTECSKAFTYNSLLIQHRRIHTGEKPYKCTECSKAFTCNSA......................................................................................................................................................................................................................................................................................................................................................................... 493
115 0.000e+00 ENSACAP00000002752 pep:novel scaffold:AnoCar1.0:scaffold_4713:3001:4749:1 gene:ENSACAG00000002857 transcript:ENSACAT00000002821  ali  1................................................................................................LKTHQRIHTGEKPFKCPECGKSFTQKGSLQTHQRTHTGEKPYNCLECG-KSFAHSSALNVHQKT-HTGEKPYKCLQCGQSFTLS------SDLRSHQRTHTGEKPFK-----CLECGQSFARSGHLRSHQREKPFKCLECGKSFARSGHLRSHQ-RTHTGEKPFKCLD-------CGQSFTHSTSLRSHQRTHTGEKPFKCLECGQSFSQKGSLHIHQRTHTGEKPYKCLQCGQSFTQKGNLQSHQRTHTGEKHYNCLQCGQSFTHSTSLRSHQRTHTGEKLYKCLECGQSFTHSSNLRVHQRTHTGEKPYNCLQCGQSFTQKGNLQIHQRTHTGEKPYKCLECGHTFNNSGDLHKHQR-IHTGEKPYTCQECGQSFARSGALRFHQRTHTGEKPYTCQECGQSFTQSSGLRSHQRTHTGEKPYKCQECGMSFISNRNLRFHKRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 433
116 0.000e+00gi|358416997|ref|XP_003583535.1| PREDICTED: zinc finger protein 845-like [Bos taurus]  clstr ali  338..........................................................................................................................................................................................................KKNTYSCNECNITFLQDSELSRHQREKPYKCDVCGHCFKQHTHL-QHHRRVHTGEKPYKCDEKPYTCEVCGRGYTRKSHLGIHWRVHTGEKPYKCDVCGKAFSVNERLVVHRRVHTGEKPYKCDVCGKAFSVNVRLVVHRRVHTGEKPYKCDVCGKAFSVNVRLVVHQRVHTGEKPYTCEVCGCGYTQKSIFLIHQRIHTEEKPYKCDVCGKAFSVNSRLVVHQRVHTGEKPYKCNVCGKAFSRKARCTVHQ-TLHTGEKPYTCEVCGRGYTRKSILVIHWRMHTGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 680
117 0.000e+00 ENSACAP00000003225 pep:novel scaffold:AnoCar1.0:scaffold_3612:6215:8215:1 gene:ENSACAG00000003342 transcript:ENSACAT00000003308  ali  11  1..................................................CGKSFSQHGKL--------KTHQRTHTGEKPYKCLECAQSFARSSDLRTHQRTHTGEKPYKCLECAQSFARSSDLRTHQRTHTGEKPYKCFECG-QSFSQSSTLHSHQRT-HTGEKPYNCLECGKSFAFS------SNLRSHQRTHTGEKPYN-----CLECGQSFAHSSSLRLHQREKPYNCLECGQSFTQKGSLHTHQ-RTHTGEKPYNCLE-------CGQSFSCNSSLHTHQRTHTGEKPYRCLECAQSFARSSGLRSHQRTHTGEKPYKCLECGQSFTHKGGLCSHQRTHTGEKPYNCLECGQSFTQKGYLDSHQRTHTGEKPYNCLECGQSFTQKGYLDSHQRTHTGEKPYNCLECGQSFAFSSNLRSHQRTHTGEKPYNCLECGQSFAHSSSL-RLHQRTHTGEKPYNCLECGQSFTQKGSLHTHQRTHTGEKPYNCLECGQSFSCNSSLHTHQRTHTGEKPYKCLECGQRFSCNSNLHTHQRTHTWEKP................................................................................................................................................................................................................................................................................................................................ 471
118 0.000e+00 ENSACAP00000004061 pep:novel scaffold:AnoCar1.0:scaffold_1280:76393:149831:-1 gene:ENSACAG00000004158 transcript:ENSACAT0000000  ali  10  1...................................................................................................HERTHTGEKPYTCLKCGQSFTRSDHLNKHQQTHTGVKPYECLECG-KSFTHSGNLHKHQRT-HTGEKPYTCLECGKSFTES------GSLRSHHRTHTGEKPY-----TCIECGKSFTKSGNLRSHQKEKLYTCLECGKSFARSGDLRSHQ-RIHTGEKPYKCQE-------CGKTFAQSGGLHKHQRTHTGEKPYECTECGKSFLDRRYLQKHQKTHTGKKPYKCMECGKSFSESGSLHQHHRTHTGEKPYECLECGKSFTHSSCLHSHQRTHTGEKPYQCLDCGQSFTHNSGLHAHQRTHTGEKPYTCMECGQSFTQSSSLRSHQRIHTGEKPYTCLECGKSFTHTSSLRSHHRT-HTGEKPYQCLDCGQSFTENGSLRLHQRIHTGEKPCICLECGQSFTQSSSLRSHQRTHTGEKPYTCLECGKSFTQRVNLNSHQRTHTGEKPYTCLECGQTHSSGLRSHQRTHTGEKPYKCQECGQSFTHSSDLRLHLR................................................................................................................................................................................................................................................................................. 479
119 0.000e+00gi|295389583|ref|NP_001171303.1| zinc finger protein family member [Mus musculus]  clstr ali  15  339.SRHLQCHKRTHTGEKPYECNQCGKAFATSSHLQCHKRTHTGEKPYECNQCGKAFSCHSGLRH--------HKRTHTGEKPYECNQCGKAFSRPAYLQHHKRTHTGEKPYECNQCGKAFAKPSHLQCHKRTHTGEKPFECNQCGKA-FSCYNSLRYHKRT-HTGEKLYECNQCGKAFA------TSSHLQCHKRTHTGEKPYE-----CNQCGKAFATSSHLHCHKREKPFECNQCGKAFARPSHLQIHK-RTHTGEKPYECN-------QCGKAFATSSHLQCHKRTHTRE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 604
120 0.000e+00gi|354500992|ref|XP_003512578.1| PREDICTED: zinc finger protein 420-like [Cricetulus griseus]  clstr ali  10  170......................................................................................................................................................................................................................................YKNTEYDKSF--ESNTEITLKQTHMGEKPYKCGE-------CDKSFLSASYLRIHQRIHTGEKPYKCGECDKSFLSASYLRIHQRIHTGEKPYKCSECDKSFTTKDHLQSHQRIHTGEKPYKCSECDKSFTTKDHLQSHQRIHTGEKPYKCSECDKSFTTKDHLQSHQRIHTGEKPYKCSECDKSFTTKDHLQSHQRIHTGEKPFKCSQCSKCFITR-DHLRTHQRIHTGEKPYKCGQCDKCFTSASNLRTHLKRHTGEKPYKCSECDKSFKTSSNLRTHQRIHTGEKPYKCSQCHKSFTEKGTFRNHERIHTGEKP................................................................................................................................................................................................................................................................................................................................ 476
121 0.000e+00gi|335289826|ref|XP_003355995.1| PREDICTED: zinc finger protein 227 [Sus scrofa]  clstr ali  11  180.............GEKLHPCGDCGKGFSYSPVLPVPQRVHTGEKSFRCDSCGKGFSSSTGLII--------HYRTHTGEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYRCEECGKGFGWSVNLRVHQRVHRGEKPYRCEACG-KGFTQAAHYHIHQR-VHTGEKPYKCDVCGKGFSHN------SPLICHRRVHTGEKPY-----RCEACGKGFTRNTDLHIHFREKPYKCKECGKGFSQASNLQVHQN-VHTGEKRFKCE-------TCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEECDKSFSQAIDFRVHQRVHTGEKPYTCSICGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNL-RHHQRVHTGEKPHKCEECGKAFSLPSNLRVHLSVHTREKLFKCE.................................................................................................................................................................................................................................................................................................................................................................................... 674
122 0.000e+00 ENSACAP00000000900 pep:novel scaffold:AnoCar1.0:scaffold_2165:12417:20615:1 gene:ENSACAG00000000995 transcript:ENSACAT000000009  ali  1..........................................EKPYKCLECGQSFSHNSHLYR--------HQRTHTGEKPYNCLECGQSFARSSGLRSHQRTHTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKPYNCLECG-QSFAHSSGLRSHQRT-HTGEKPYKCLECGQSFSHN------SHLYRHQRTHTGEKPYN-----CLECGQSFAVSSGLRSHQREKPYKCLECGQSFTLKGNLQTHQ-RTHTGEKPYKCLECGYKCLECGQSFARSSGLRSHQRTHTGEKPYNCLECGQSFIDCSTLRSHQRTHTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKPYNCLECGQSFIDCSTLRSHQRTHTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKPYNCLECGQSFIDCSTLRSHQRTHTGEKPYKCLECGQSFACSSGLHSHQRT-HTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKPYNCLECGQSFIDCSTLRSHQRTHTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 507
123 0.000e+00gi|296477331|gb|DAA19446.1| repressor transcriptional factor-like [Bos taurus]  clstr ali  11  148.............................................................................................................................................................................................................................LVIHSGEKTYKCNKCGKVFSNSSNISKH-RKIHSGRKPFKCTECPNKCKECGKVFIYFSNLSQHQRIHIGEKPYKCAKCGKAFNQNSNLTRHQRTHTGEKPYKCKDCGKAFSRRYGLTQHQRIHTGERPYKCKECGKAFNKNSNLTQHKRIHTGVKPYKCKDCGKAFSQRYGFTQHQLIHTGEKAYKCTECGKEFSQYSTLTKHQRIHTGEKPYKCKECGKAFNKNSTLTKHQR-IHTGEKPYKCKDCGKAFSQRYGFTQHQLIHTGEKLYKCCGKAFSQSSTLTKHRRI.................................................................................................................................................................................................................................................................................................................................................................... 486
124 0.000e+00gi|334327551|ref|XP_003340918.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  106.....................................................NFSFKEFFVPPPDLSHIKHQRMHAEEKSRESNQRGKTFMYRSNLTGHQRIHTGEKSYECMHCGKTFSQRGQLAVHQRVHTGEKPYECKQCG-KTFSQRHHLVVHERM-HTGEKPYECKKCRKTFT------RNAHLAVHQRMHTGENPYE-----CKKCGKTFSQTSSLAGHEREKPYECKKCGKAFSQSSHLAVHQ-KIHTGEKPYECM-------QCGKTFSRRHHLAVHERVHTGEKPYECMQCGKTFPRNSHLAVHQRMHTGEKPYECKKCGNTFSRRDYLSVHQRMHTGEKPYECKKCGKTFSQSSHLTVHQRIHTGEKPYECMQCGNSFSWRGQLVVHQRMHTGEKPYESNQRGKTFKYRSNLTFHQRIHTGEKLYECMKCGKTFCQNSHLAVQQK-MHVEEKPYECKQFGKTFSKTNSLAEHQRRHTLEKPYLC..................................................................................................................................................................................................................................................................................................................................................................................... 528
125 0.000e+00gi|334327367|ref|XP_003340885.1| PREDICTED: zinc finger protein 585B-like [Monodelphis domestica]  clstr ali  14  504VKSHLATHQRIHSGEKPYKCEYCGKHFRQRGRLVAHQSIHTSGKPYECKQCGKAFIEKDSLAK--------HQRIHTGEKPYECQHCGKAFRERGNLNDHQRIHTGEKPYECKQCGKAFTDRGSLVKHQRIHTGEKPYECKHCGKA-FTQRSHLATHQR-IHTGEKPYECKQCGKAFI------KRDSLVDHERIHTGEKPYE-----CKQCGKAFTQRSHLATHQR-------------------------IHTGKKP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 716
126 0.000e+00gi|334349666|ref|XP_003342236.1| PREDICTED: zinc finger protein 845-like, partial [Monodelphis domestica]  clstr ali  13..............................................................................................................................................................................................................................................SYLQKSSTDSDSQRIHVGENPCECNVCGYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCHDCGKAFNQNSYLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHKRIHTGEKPFQCHDCGKAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFKCDDCGKAFNQSSHLLQHQR-IHTGEKAFQCHDCGKAFNQSSHLLQHQRIHTGEKPFQCH.................................................................................................................................................................................................................................................................................................................................................................................... 289
127 0.000e+00gi|354500911|ref|XP_003512540.1| PREDICTED: zinc finger protein 850-like [Cricetulus griseus]  clstr ali  11  75....................................ERSQTGEKTSVYTQCVKTFAHDTHLQRHET--------THTGEKPYECNHCGKVFARRSNLQMHEMTHTGEKPFECDQCGKAFAHHQSLLLHKRTHTGEKPYECNQCGKA-FAHHQSLRLHKRT-HTGEKPFECNQCGKAFSCSKAFAHRNDLQRHKRTHTGEKPYE-----CNQCGKAFARHSTLQRHKREKPNKCNQCGKAFARHSALQSHK-RTHTGEKPYECNEKPHECIQCGKAFARHSALQMHKRTHTGEKPYKCNQCGKAFARQSALQMHNRIHTREKPYECNQCGKDFARLSHLQMHEMTHTGEKPYECNQCGKAFARHHSLRQHKRTHTGEKPYECNQCGKAFARHHSLRQHKRTHTGEKPYECNQCGKAFARHHSLRQHKRTHTGEKPYECNQCGKAFSFPSHLQMHERT-HTGEKPYECNQCGKAFARHSTLQRHKRTHTGEKPNECN.................................................................................................................................................................................................................................................................................................................................................................................... 563
128 0.000e+00gi|296477334|gb|DAA19449.1| zinc finger protein 347-like [Bos taurus]  clstr ali  10  108............................................................................................................................................................................................................................DLKAH-REKSYKCDECGKAFRVKSTLLSHQT-VHTGEKPYKCDE-------CGKAFRLKSILLSHQTVHTGEKPYKCDECGKAFRLKSFLLTHQTVHTGEKPYKCDECGKAFRAKSTLLSHQTIHTGEKPYKCNECGKDFSQPSQFISHKRLHTGEKPYKCDECGKDFHVKSILLRHQTVHTGEKPYKCDECGKAFRVKSILLSHQTVHTGEKPYKCDECGKAFTDSSNLRRHQK-IHTGQKLFKCDICYKVFSEREQLAGHQSVHSGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 371
129 0.000e+00gi|327287646|ref|XP_003228539.1| PREDICTED: zinc finger protein 658-like, partial [Anolis carolinensis]  clstr ali  10  25...........................................KPYTCLECGKDFTQSSSL--------RSHQRTHTGEKPYMCLECGKSFAQRIHLDTHQRTHTGEKPFNCLECGKSFTYSGHLRKHQRTHTGEKPYTCLECG-QSFTESGSLRKHQRT-HTGEKPYTCLECEKSFTES------GHLRKHQRTHTGEKPY-----TCLECGQSFTASGNLRSHQREKPYTCLECGKTFTESGSLRSHE-RTHIGEKPYTCLECPYSCLECGKGFTQRGHLDSHQRTHTGEKPYTCLECGKGFTQRGHLDSHQRTHTGEKPYTCLECGKGFTQRGHLDSHQRTHTGEKPYTCLECGKSFTESGNLRKHQRTHTGEKPYTCLECGQSFAQSGNLNAHQQTHIGEKPFTCLECGQSFTSSGNLRSHQRTHTGEKPYTCLECGQSFTQSSNL-RSHQWTHTGEKPYTCLECGQSFTESGSLRKHQRTHTGEKPYTCQECGKSFTYSGSLHLHQRTHTGEKPYSCLLCGQSFTASGSLRSHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 530
130 0.000e+00 ENSACAP00000015266 pep:novel scaffold:AnoCar1.0:scaffold_4111:2275:4200:-1 gene:ENSACAG00000015540 transcript:ENSACAT0000001557  ali  11  1.......................................................................................................................................KSYKCIECG-KSFSYSSTLQTHQRT-HTGEKPFTCLECGQSFT------RKGSLQTHQRTHTGEK-----AFTCLECGQSFAHSSGLHSHQREKPYKCLECGQSFTCSSGLRRHQ-RIHTGEKPYNCLE-------CGQSFTQKGSLQTHQRTHTGEKPYKCWECGQSFIHSTSLRVHQRTHTGEKPYKCLECEQSFTDRSGLRRHQRTHTGEKPYTCLECGQSFTRKGSLQTHQRTHTGEKPYKCLECGQSFTHSSGLRIHQRTHTGEKPYKCLECEQSFTCSSGLRIHQRTHTGEKPFKCLECEQSFTRSSDLRSHQRT-HTGEKPFKCLECGQSFSQSSDLRSHQRTHTGEKPFKCLECEQSFTRSSGLRSHQRIHTGEKPYNCLECGQSFTQKGNLHSHQRTHTGEKQYKCLECGQSFTHSSGLRSHQRTHTGEKP.................................................................................................................................................................................................................................................................................................... 422
131 0.000e+00gi|359321066|ref|XP_003431845.2| PREDICTED: zinc finger protein 250 [Canis lupus familiaris]  clstr ali  11  376.RSVLIQHHNVHTGEKPYECGECGKAFSHRSTLMNHERIHTEEKPYGCYACGKAFVQHSHLTQHQRVCGECHERIHTGERPFRCAQCGKAFSLKATLIVHLRTHTGERPYECSRCGKAFSQYSVLIQHQRIHTGERPYECGECGRA-FNQHGHLIQHQKVIHTGAKPYQCTECGKAFKQS------SILLRHQLIHTEEKPY-----QCSECGKAFRQSTQLTAHHREKPYKCGECGKAFGRSSRLRQHQ-KFHTGEKPYECGE-------CGKAFCRRFTLNEHCRIHSGERPYTCLQCGQRFIRGSSLLKHQRLHTGEKPFECRECGKAFSRKSNLTLHQKTHTKEKPFACTECGKAFRRSYTLNEHYRLHSGERPYRCRACGRACSRLSALIQHQKVH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 830
132 0.000e+00gi|326666995|ref|XP_003198446.1| PREDICTED: zinc finger protein 658-like [Danio rerio]  clstr ali  11  1.................................................................................................................................................................................................MSHTGEKPF-----LCTECGKSFSCSSHLNQHMREKPFTCTQCGKSFSQSSHLNKH-MRIHTGEKPFTCT-------QCGKSFSQLSNLHQHMRIHTGEKPFTCAQCGQSFAKKHNLNIHMRIHAGEKPYTCTECGQSFPYKTTFNSHRRIHTGEKPYRCTECGKSFTHKSTFNNHRRIHTGEKPYTCTECGKSFTHKNTLDNHKRTHTGEKPYRCTDCGKRFPYKSTFNNHMRTHTGEKPFACAQCGKSFRAKASLMN-HMRIHTGEKPFTCTQCGKSFNRSSHLNIHMRIHTGEKPFTCTQCGKSFSQSS.......................................................................................................................................................................................................................................................................................................................................................................... 302
133 0.000e+00gi|344309097|ref|XP_003423213.1| PREDICTED: zinc finger protein 43-like [Loxodonta africana]  clstr ali  10  248.................................................................................................................ECGKAFLDLSSYNHDRRSHSGCCTCQCKECGEAC-NCPSHLTTPMRTL--NEKPQKCKD------------SLSCLVLHEKFLNGDKPY-----VCKECGKAFRCSSNLTKHTGERPYECKECGKDFRHASSLTTH-IRTHSGEKPYECRE-------CGKAFSCSSHLISHIKTHSGERPYECKECGKAFSQSSSLTKHVRTHSGEKPYQCQECGKAFSCSSVLTTHKRTHSGERPYKCKECGKAFRCSSDLTTHKRTHSGERPYECKECGKAFSQSSHLTTHIKTHNGQRPYECKQCGKAFSWPSDLTTHIRTHSGVRPYECKQCGKAFSQASSLTTHKRT-HSGVRPYNCKECGKAFSQASSLTTHMRTHSGVRPYSCK.................................................................................................................................................................................................................................................................................................................................................................................... 605
134 0.000e+00gi|345785369|ref|XP_003432674.1| PREDICTED: putative uncharacterized zinc finger protein 814-like [Canis lupus familiaris]  clstr ali  12  113.....TEHQATLCGQNHYQIGACEKQWYFGANL-QHQKQHTGEK------CFRSSMGRASFVKDNEFCVSG--------KPFSC---GEVVRDSSRLLQHQATHAREKSCRRTEYG------ASSRGRKAQHNWGK-------GTQDFTCTHALVHPQRDL-SRERCFMCSECGKSFSKSY------SLSDHWRVHTGEKPYE-----CGECGKSFRQSSSLIQHRRARPHECAECGKLFSNKSNLIKH-RRIHTGERPYECSE-------CGKSFSESSALLQHRSVHTGERPYECSECGKFFTYHSSLIKHQRVHSGSRPYECSECGKSFTQNSSLIEHRRVHSGERPYKCSECEKSFSQSSALLQHRRVHTGERPYECSECGKFFTYSSSLLKHQRVHTGSRPYECSECGKSFTQNSSLIKHRRIHTGERPYRCHECGKSFSHSSSLIKHGKRIHSGEKPYECSECGKSFRQFSNLIRHRSVHTGERPYGCS.................................................................................................................................................................................................................................................................................................................................................................................... 558
135 0.000e+00gi|344307371|ref|XP_003422355.1| PREDICTED: zinc finger protein 850-like [Loxodonta africana]  clstr ali  10  86..............................................................................................................................................................................................IHQRINTDEKP-----LECKECGKDFNFVSVLIRHQREKPYECKECGKTFGSGANLAYHQ-RIHTGEKPYECKE-------CGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGLIRHQIIHSGEKPYECKECGKSFSFESALTRHQRIHTGEKPYECKDCGKSFGSGSNLTQHQRIHTGEKPYECKECGKAFNSGSDLSQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECRKAFS-SGSDLTQHQRIHTGEKPYECKECGKAFGSGSKLIQHQIIHTGEKPYECKECGKSFSSGSALNRHQRIHTGEKPYKCKECGKAFSNGSNLTQHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 432
136 0.000e+00gi|24307913|ref|NP_006621.1| zinc finger protein 234 [Homo sapiens]  clstr ali  13  411MKIHYQVHLVVHTGEKPYKCEVCGKAFRQSSYLKIHLKAHSVQKPFKCEECGQGFNQSSRLQI--------HQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFSQASHLLTHQRVHSGEKPFKCEECG-KSFSRSAHLQAHQK-VHTGEKPYKCGECGKGFKWSL------NLDMHQRVHTGEKPY-----TCGECGKHFSQASSLQLHQGEKPYKCDVCGKVFSRSSQLQYH-RRVHTGEKPYKCE-------ICGKRFSWRSNLVSHHKIH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 674
139 0.000e+00gi|334347876|ref|XP_001368177.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  163..........................FSQNSEIAVHQIIQCGEKSYECKQCGKIFTHKCHLA--------SHQRIHTREKPLEHKQCRRSFTWKGHLAAHQIINTGEKPYGCLQCGKAFTDGRSLTVHQRIHTGEKPYECKHCG-KTFTERCSLVVHQR-IHTGEKPFECKHCGKAFRQ------RSNLAVHQRIHTGEKPY-----GCKHCGKAFTNSGSLIVHQREKPYGCKQCGKAFTESRSLTVHQ-RIHTGEKPYECKEKPFECKHCGKAFGERSNLARHQRIHTGEKPYGCKHCGKAFTNSGSLTVHQKIHTGEKPFECKHCGKTFTDSRSITVHHRIHTGEKPYGCKQCGKAFTDSGSLNVHQRIHTGEKPYECKHCGKTFTERRSLVVHQRIHTGEKPYKCKHCGKAFRQRSNLVVHQRIHTGEKPYGCKHCGKAFTNSGSLIVHQR-IHTGEKPYGCQQCGKAFTESRSLTVHQRIHTGEKPYECKH................................................................................................................................................................................................................................................................................................................................................................................... 634
140 0.000e+00gi|327266427|ref|XP_003218007.1| PREDICTED: zinc finger protein 84-like [Anolis carolinensis]  clstr ali  11  302LSANLAAHQRKHLGQKPYECPDCGKSFSFTSHLERHQRIHTGERPYQCNDCGKSFSRSSHLYR--------HQRIHTGEKPYKCPNCGKGFGQSSSLVKHQRIHTGERPYQCPECGKKFSWCSALIKHKRIHTGEKPYCCDECGKA-FSVSSHLERHQR-VHSPDRPHKCTECGKTYGCGKSFSWSSHLERHQRIHTGEKPY-----ACSDCGKSFSVSSHLDRHRREKPYRCNECGKSFSVSSTLLQHQ-RTHSSGKPHKCKE-------CGKRFVASAQLLTHQRTHRGEKPYECTVCGKSFGFVSHLERHQRVHTGEKPYQCPECGKCFSRSSHRNRHQRTH.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 678
141 0.000e+00gi|359322983|ref|XP_003433456.2| PREDICTED: zinc finger protein 268 [Canis lupus familiaris]  clstr ali  13  747LKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECNECGKSFSFNSQL--------IVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPYGCSDCGKAFSSKSYLIIHMRTHSGEKPYECNKCGKA-FIWKSLLIVHER-IHAGESPYKCSQCEKSFSCEKAFIRKSQLIVHQRTHSGEKPY-----GCNECGKTFSQKSILSAHQREKPCKCTECGKAFCWKSQLIMHQ-RTHADEKH................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 1015
143 0.000e+00gi|358417024|ref|XP_001787884.3| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 160 [Bos taurus]  clstr ali  828..............................................................................................................KSNKCRNTFDQMSGFSLDKSTCTGER--TCSEYGKVS-NHCSELTQ-QDTVQNAQEENKCKICEKVFS------KSSNLSRHRRIHTGRKPFK-----CTECSRAFNCHSLLTQHQREKSYICKECNKAFHRSSFLIEHQ-RIHTGEKPYKCIV-------CGKAFTSNSDLIEHQRIHTLEKPYKCTECSKAFTYNSDLTEHQRIHTGEKPYKCTECSKAFTYNSLLIQHRRIHTGEKPYKCTECSKAFTYNSDRIEHQRIHTGEKPYICKECNKAFRRSSFLTQHQRIHTGEKPYKCTVCGKAFTYKSLLTKHQRIHTGEKPYKCTECSKAFTYNSSLIQHQR-IHAGEKPYKCTECSKAFICNSDLIEHQRIHTGEKPYICK.................................................................................................................................................................................................................................................................................................................................................................................... 1192
144 0.000e+00gi|332255892|ref|XP_003277060.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 554-like [Nomascus leucogenys]  clstr ali  15  589.SSTFRRHTITHTGEKPYKCKECGEAFSYSSTFRRHMISHTGEKPHKCKECGEAFSYSSAFRRHMITCKQCHERIHTGEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTGEKPYECQQCG-KTFNWPISLRKHMRT-HTREKPYECKQCGKAFSCGKAFYCHISLQKHMRRHTAEKLYECKPYECKECGKVFKWPSSLPIHMREKPYQCKHCGKAFNCSSSLRRH-VRIHTTEKRYKCNVGHPPANE----FMCSASEKSHQ..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 935
145 0.000e+00gi|291410057|ref|XP_002721320.1| PREDICTED: zinc finger protein 717-like [Oryctolagus cuniculus]  clstr ali  230.....................................................................................................................................................................................................................KAYHENSNLSMHQREKFYE-------YIRQSHLVINQ-RLHIEKKPYTC-------KLCGKSFSSKSCHTTHHSTHIQENPNVCNECGETTYKKSDLITHQKIHTWKKPHECSECGKAFFQKSYLIAHQRIHTGEKPHECNDCGKAFGHKSDLIKHQRIHTGEKPYECNDCGKAFGRKSYLIRHQKIHTGEKPYECNDCGKAFGNKSHLISHQRIHTGEKPHICNDCEKAFGNKSQLITHQR-IHTGEKPYKCNDCGKAFGQKSTLIIHQRIHTGEKPYECNHCGKAFGQKSALIKHQRIHTGEKPYECNDCGKAFVRKSQLRMHQSIHTGEKP................................................................................................................................................................................................................................................................................................................................ 558
146 0.000e+00 ENSACAP00000000115 pep:novel scaffold:AnoCar1.0:scaffold_754:269896:271455:1 gene:ENSACAG00000000122 transcript:ENSACAT00000000  ali  1.......................................................................................................................................................................................................................................................QQYERTNTGEKPYECLE-------CGNSFTHSSGLRKHQRTHTGEKPYTCLVCAKSFTESGSLHSHQRTHTGEKPYSCLECAKSFTESGSLRSHQRTHTGEKPYTCQECGQSFTQRGNLRSHQRIHTGEKPYECLKCGMSFTQNCHLQRHQMTHTGEKPYECLECGNSFTRSSDLCKHQRTHTGEKPYMCLECGKSFTESGSL-RSHQRIHTGEKPYKCLECGLSFTNSSGLRSHQRSHTGEKPYIC..................................................................................................................................................................................................................................................................................................................................................................................... 239
147 0.000e+00gi|334328855|ref|XP_001371711.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  156............................................................................................................................................NECEE-LFICDSNIQDH--RIHFEERTYRYGECGKAFLQGK------HLNEHPRIHPIEK-----LHKCNECGKAFSYSSSLTFHQREKPHECHECGEAFRWSSQLTYHQ-RIHTGEKPYQCNE-------CGKTFIQRTQLTSHQRIHTGGKPYECNECGKAFRYSSSLTYHQRIHTGEKPFECNECGQAFRSNTQLNSHQRIHTGEKPYQCNECGKTFIQSTQLTFHQRIHTGEKPYECNECGKAFIQSTHLTYHQRIHTGEKPYECNECGKAFSSSSSLTYHQRIHTGEKPFQCHECGQAF-RSNSHLTSHQRIHTGEKPYECHECGQAFRSNTQLISHQRIHTGERPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 491
148 0.000e+00gi|334313558|ref|XP_003339928.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  14  372IRSTLAHHQRIHTGEKPYECKQCGKAFCSRTTLAQHQRIHTGEKPYECKQCGKTFIQSSHLA--------VHKRIHTGEKPYECKQCGKTFIKSSQLAVHKRIHTGEKPHECNQCGKTFSQTSGLNCHQRIHTGEKPYECKQCG-KTFNHPSALAVHLR-LHTGEKPFECKQCGKKFSYS------SGLTSHQRIHTGEKPYE-----CKQCGKTFSRNSDLAVHQRERPYKCQQCEKTFT.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 596
150 0.000e+00gi|334328877|ref|XP_001373653.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  285.............................................................................................................................................................................GRSFSQNSECGS------HQIIHSEEKPYK-----CKHCGKSFTRRDSLASHQKEKPYKCKHCGKAFTQKSNLSVHE-RIHSEEKPYEC-------KHCGKAFKQRSVLVSHQTIHTGEKPYECKHCGKAFTRSDSLAAHQRIHTGEKPYECKQCGKAFTQRGHLAIHQRIHTGEKAYECKHCEKAFTLRGHLVRHQRTHTGEKPHECKQCGKTFADRASLSAHQRIHTGEKLYECKQCGKDFIRRGRFAAHQRIHIGEKPYECKQCGKAFTLKEHLATHQR-IHTVEKPYECQQCGKTFTLRGYLVRHQRIHSEEKPYECKH................................................................................................................................................................................................................................................................................................................................................................................... 591
151 0.000e+00gi|334349338|ref|XP_003342192.1| PREDICTED: zinc finger protein 347-like [Monodelphis domestica]  clstr ali  11  356.....................................................AFSHNSELTDHHKIQN--------GKKHYECNDCGKAFKKQLSLIHHQKFHTSMKLHKCMQCGQAFRRQSLLLSHQKIHTRKTSNEYPEHS-KTFSEKSSLIVYERS-HTEEQSYECNQCGKTFRQ------RSHLIVHERIHTGEKPYE-----CNQCGKSFSRSFCLASHQREKPYECKQCGKTFRQRGSLNTHQT-THTGEKPYAC-------HQCGRSFRLNSHLSAHQRIHTGEKPYKCNQCGKSFRQSSTLTDHQRIHTGEKSYECNQCGMAFRKSSRLAQHQRIHSGEKPFVCNQCGKTFRCNSGLAQHKRIHTGEQPYACKQCGKRFRQRGNLVVHERTHTGEKPYECNQCGKTFPRPDRLAQHQRIHTGEKPYKCNQCGKTFRQYFS-FAEHKKIHTGEKPYACNQCGKAFRCNSDLRKHHRIHTGEKPFVCK.................................................................................................................................................................................................................................................................................................................................................................................... 771
152 0.000e+00gi|348582594|ref|XP_003477061.1| PREDICTED: zinc finger protein 197-like [Cavia porcellus]  clstr ali  12  365.............................................................................GKKFYKCDICCKHFNKLSHLLNHQRIHTGEKPYKCKECGKAFIQRSSLRMHLRNHSGEKPYKCNECGKA-FSQSAYLLNHQR-IHTGEKPYKCKECGKGF------YRHSGLIIHLRRHSGERPFK-----CNECGKVFSQNGYLTDHQREEPYKCNKCQKAFILKKSLILHQ-RIHSGEKPYKCDECGYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKIFSAKSNLIDHKRMHSREKPYKCTQCGKAFTQSAYLFDHQRLHNGEKPYECNECGKIFILKKSLILHQRLHNGEKPYECQECGKTFIMSKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEHKR-IHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 792
153 0.000e+00gi|358417000|ref|XP_003583536.1| PREDICTED: zinc finger protein 836-like [Bos taurus]  clstr ali  11  699........................................................................................................................................................DLRAHR------EKPYKCDECGKAF------LVKSILLSHQTVHTGEKPYK-----CDDCGKAFHAKSSLLRHQGQKPYKCDECGKVFRAKSKLLTHQT-IHTGQKPYKCDE-------CGKAFHTKSALLTHQTIHTGEKPYKCDECGKAFRVKSMLLSHQTIHTGQKPYKCDECGKAFRVKSSLLRHQTIHTGERPYKCDECGKLFRAKSKLLTHQTSHTGQKPYKCDDCGKAFHAKSALLTHQTIHTREKPYKCDECGRAFHAKSKLLTHQTIHTGEKPYKCDECGKAFRLKSFLLSHQ-TVHTGEKPYKCDECGKAFADSSYFRKHQKIHTGQKLFKCH.................................................................................................................................................................................................................................................................................................................................................................................... 1019
154 0.000e+00gi|296233665|ref|XP_002762149.1| PREDICTED: zinc finger protein 790-like [Callithrix jacchus]  clstr ali  11  364LRSSLTGHKRIHTGEKPFKCKECGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTR--------HQRIHTGEKPYECSECRKAFSQRSHLIKHQRIHTGEKPYECKECGKAFTRGSHLTQHQRIHTGKKSHECKECGKA-FIRGSNLAQHQ-NVHVGRKPYECEKCGKAYIWS------SHLARHQRIHAGRKPYE-----CKQCGKTFTWASYLAQHEKRKSYECKECGKTFLHGSEFNRHQ-KIHTGERNYECKE-------CGKTFFRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECGKSFIWGSQLTRHRRIHTGE-PYGCKKSSHIFSHHSYFAE-QKIHNGANLCEWTDYGNAFCHDSNFAQHQNIYTFQKSYEFKDFEKAFSSSSHFIS........................................................................................................................................................................................................................................................................................................................................................................................................................................................... 761
157 0.000e+00gi|348554924|ref|XP_003463274.1| PREDICTED: zinc finger protein 850-like [Cavia porcellus]  clstr ali  11  459...SLTQHQRIHTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCSECGKAFSQRGHFMEHQKICDECHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECSECGKAFSQHSNLTQHQKTHTGEKPYDCAECG-KSFSYWSSLAQHLK-IHTGEKPYKCSECGKAFSYC------SSLTQHRRIHTREKPF-----ACSECGKAFSYLSNLNQHQKEKAYECKECGKAFIRSSSLAKHE-RIHTGEKPYQCHE-------CGKTFSYGSSLIQHRKIHTGERPYKCSECGRAFNQNIHLTQHKRIHSGAKPYACPECGKAFRHCSSLAQHQKTHAEEKPYRCGKCDKAFSQSAHLAQHQRVHSGEKPHECAGCGKAFRFRSALSKHQRLHPG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 887
158 0.000e+00 ENSACAP00000008488 pep:novel scaffold:AnoCar1.0:scaffold_1406:67649:74081:1 gene:ENSACAG00000008685 transcript:ENSACAT000000086  ali  11  1........................................................................................................................HSSGLRSHQRTHTGEKPYTCLECG-KNFTESGSLRSHLR-IHTGEKPYKCLECGKSFTES------GSLRSHQRIHTGEKPYK-----CLECGKSFTLSSGLRSHQREKPYTCLECGQSFTHWDYLQQH-LRTHTGEKPYTCLE-------CGKNFAQSADLHKHHRTHTGERPYTCLECGQSFSQSGTLRSHQRTHTGERPYTCLECGKSFTHSTSLRSHQRIHTGEKPNTCLECGKGFIHSASLRSHQRTHTGEKPYTCLECGKSFAHSAHLRSHQRVHTGEKPYTCLECGKNFTQSADLHKHQRIHTGERPYTCLECAKSFTENGNLLRHLRT-HTGEKPYVCLECGYSFAHSSGLRSHLRTHTGEKPYKCLECGKSFTLSSGLRSHQRIHTGEKPYKCLECGKSFNLSSILRSHQRIHTGEKPYTCLECGQSFTQCSSLHSHRRTHAGEK..................................................................................................................................................................................................................................................................................................... 436
159 0.000e+00gi|148669906|gb|EDL01853.1| mCG58995, isoform CRA_c [Mus musculus]  clstr ali  10  64..............................................................................................................................RHETSHPGEKPSQYTHCGKA-FVYRSHPQRHER-IHTGEKPYGCNHCGKAFAH------HSNLQRHERIHTGEKPYE-----CNQCGKAFVTHSDLQIHKREKPYECNHCGKAFAYHSNLQRHE-RIHTGEKPYECN-------QCGKAFAYHSNLQRHERIHTGEKPYECNKCGKAFAWHSHLQRHEITHTGEKPYECNQCGKAFAHDSNLHIHKRKHAGEKPYECNQCGKAFPCYNLLQIHKRTHTGEKPYECNQCGKTFAYHSYLQMHERIHTGEKPYECNHCGKAFSQHSSLRVHKRTHTGEKPYECNQCGEAFVYHS-HLQIHKTMHTGEKPFQCNQCDKAFVYNNHLLVHKRIHTGEKPYECNHCGKAFSQLSGLHVHKRTHTGEKPYKCNECGKAFARNSHLQRHKRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 466
160 0.000e+00gi|327287358|ref|XP_003228396.1| PREDICTED: zinc finger protein 729-like [Anolis carolinensis]  clstr ali  13  697LKGELLSHQGTHPGDKPYKCCECGKGFD--GSLE--QGTHTGEKPYKCMKCGGSFSRSGSLR--------SHQRTHTGEKPYKCMECGGSFSRSGSLRSHQRTHTGEKPYKCMECGKSFSRSCSLRYHQRTHTGEKPYKCIECG-KSFSRSDSLRSHQKT-HTGEKPHKCVECGKSFSHS------SHLRTHQRTHTGEKPYK-----CIECGESFSRSDSLRSHQKEKPHKCVECGKSFSHSSHLRTHQ-RTHTREKPHE.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 935
161 0.000e+00gi|334327293|ref|XP_003340856.1| PREDICTED: zinc finger protein 709-like [Monodelphis domestica]  clstr ali  195.............................................................................................................................................................................................................................................KTFSQSYNFAVHQ-RIHSGEKPYKCN-------QCGKACSRSSHFAVHQRSHTEEKPYERKKCGKAFSERSSLAVHQRIHTGEKPYECKQCGKTFTRNYNLAVHQRSHTGEKPYECKQCGKTFSQRSHLAVHQRLHTGEKPYKCNQCGKAFSMSSHLAVHQRIHTGEKPYECKQCGKTFTRTSSLAVHQGMHNGEKPYECKQCGKTFNQRYHLDVHQR-MHTGEKPYECKQCGEKFSRSSHLAIHQRMHTGEKPYECKQCGRTFNQKSHLAVHQITHTGEKPYECKQCGKTFSQSSSLAVHQRMHTGEKP................................................................................................................................................................................................................................................................................................................................ 495
163 0.000e+00 ENSACAP00000014000 pep:novel scaffold:AnoCar1.0:scaffold_1467:80269:82714:-1 gene:ENSACAG00000014269 transcript:ENSACAT00000014  ali  1....................................................................................................................................................................................................TGEKPY-----QCMECGKSFSRRDSLRSHQGEKTYQCMECGKSFSRRDSLRSHQ-RTHTGEKPYTCME-------CGKSFRHSGGLRSHQRTHTGQKPYTCMECGKSFSHSGGLRSHQRTHTGEKPYQCMECGKSFIQSGVLHSHQRIHTGEKPYQCTECGKSFRRSEYLRSHQRTHTGEKPYQCMECGKSFSKSGHLRSHQSTHTGEKPYQCMECGKSFSRRDNLCFHQRSHTGEKPYQCMECGKSFSQSG-MLSSHLRIHTGEKPYTCIECGKSFSQSGTLRSHQRTHTGEKPYQCIECGKSFRHSAGLRCHQRTHTGEKPYQCTECGKSFIRSGDLRFHQKIHTGEKP................................................................................................................................................................................................................................................................................................................................ 343
164 0.000e+00 ENSACAP00000000114 pep:novel scaffold:AnoCar1.0:scaffold_754:230484:246323:-1 gene:ENSACAG00000000121 transcript:ENSACAT0000000  ali  4..............................................................................................................................................................................................................................RTHTAEKPYEFLECGKSFAQSNGSLRKHQRTHTGEKPYTCLE-------CGKSFASSGNLDVHQRTHTGEKPYTCLECGQSFTERGSLRKHQRTHTGEKPYSCLKCGKCFTGSGSLHSHQRIHTGEKPFTCLECGKSFAQSGTLRSHQRIHTGEKPYTCLECGQSFTKSGTLRSHQRTHTGEKPYTCLECGESFTENGSLHVHQRTHTGEKPYSCLECGKCFTESGSLHSHQR-FHTGEKPYTCLECGKCFTESGSLHSHQRTHTGEKPYTCLECGKCFTESGSLHSHQRTHTGEKPYSCLECGKCFAQSGSLRSHERTHTGEKPYTCLECGQSFTKSGSLRS.............................................................................................................................................................................................................................................................................................................. 338
165 0.000e+00gi|327287800|ref|XP_003228616.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis]  clstr ali  1.................................................................................................................................................................................................................................MEEKAYKCIECGKSFSQHEKLKTHQS-THTGEKPY-------NYLECGQRFAHSSALRKHQRTHTGEKPYKCLECGQSFTERGSLRIHQRIHTGEKPYKCLECGQSFARSGNLRSHQRTHTGEKPYTCLECGQSFTDSGNLRKHQRTHTGEKPYTCLECGQSFTQRGSLRIHQRIHTGEKPYKCLECGQSFARSGSLRSHQRTHTEEKPYKCLECGQSFTEGGSLRKHQRT-HTGEKPYTCLECGQSFTEGGSLRKHQRIHTGEKPYTCLECGQTFTERGHLHIHQRTHTGEKPYTCLECGQSFARSGNLRSHQRTHTGEKPYKCLECGQSFTHSSTLRSHQRTHTGEKP.................................................................................................................................................................................................................................................................................................... 341
166 0.000e+00gi|338710406|ref|XP_001502610.3| PREDICTED: zinc finger protein 850-like [Equus caballus]  clstr ali  10  212.........................................................................RFHVLGKPFTYGESGKDFLATSGLLQQQAI-----P--------VFSNTDTLLR-QRVSTGKGLGECNKFG-KSFNCKYKLGQHQ-QIHTGERSYACGECGKYFT------TSSTLHHHQRVHTGERPYE-----CTECRKSFTYKSHLIRHQRVRPYECNECGKSFSQKSILIQHQ-RVHTGERPYECS-------GCGKFFSQKSALVHHERVHTGERPYECSECGKTFTFSSRLRYHQRVHTGERPYECSECGKAFTFSFRLRDHQRVHTGGGPYECVECGKSFSAKTVLIQHQRVHTGERPYECSECGKSFSQSSKLVQHQRIHTGVRPYECIECGKSFSVKFVLIQHQRIHSGERPYECSQCGKSFSQKSVLIQHQR-IHTGERPYDCSECWKSFSRKAQLIQHRTVHNGEQPYEC..................................................................................................................................................................................................................................................................................................................................................................................... 628
167 0.000e+00gi|327288963|ref|XP_003229194.1| PREDICTED: zinc finger protein 658-like [Anolis carolinensis]  clstr ali  11  141.SDTLRSHQRTHTGEKPYHCMECGKSFIQSGVLHSHQRVHTGEKPHKCMECGKSFSQSENLRSHLRTCIECHQRTHTGEKPYQCMECGKSFSNSGALHSHQRSHTGEKPYQCTECGKSFSRRDNLCFHQRTHTGEKPYQCMQCE-KSFSQSGKLSSHLR-IHTGEKPYTCIECGKSFSQS------GALRSHQRMHTGEKLY-----QCMECGKSFNQRGNLRSHQREKPYQCIECGKSFRHSGGLRSHQ-RTHTGEKPYQCIE-------CGKSFRHSAGLRCHQRTHTGEKPYQCIECGKSFSQSGKLRSHQRTHTGEKPYTCMECGENFSRVGNLRSHQRTHTGEKPYQCTECGKSFSRKDFLCLHQRLHTGEKPYQCIDCGKSFRQSGGLRSHQRLHTGEKPYQCIECGKSFRHSGGLRCHQRTHTGEKPYQCMECGKSFIQSGKLHSHQRIHTRLE...................................................................................................................................................................................................................................................................................................................................................................................................................... 603
168 0.000e+00gi|327289566|ref|XP_003229495.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis]  clstr ali  12  239.SSGLRIHQRTHTGEKPYKCLECGQSFTQSSGLRIHQRTHTGEKPYKCLDCGQSFALSSGLRIHQRICLECHLRTHTGEKPYTCLECGQSFAQSRTLRSHQRTHTGEKPYTCLECGKSFSWRSHLLQHERTHTGEKPFKCLECG-QSFTHRSGLRRHQRT-HTGEKPYKCLECGQSFTCGQTFTQKGHLDSHQRTHTGEKPYK-----CLECGQSFTHSSGLRRHQREKPYKCLECGQSFTHSSGLRRHQ-RTHTGEKPFECLE-------CGQSFTQSSGLRLHQRTHTGEKPFECLECGQTFARSSGLRLHQRTHTGEKPFECLECGQTFTRSSGLRSHQNSHTGEKPYTCLECGQSFTQSSGLRSHQRTHTGEKPYKCLECGQSFTQSSALRRHQRTHTGEKPYKCLECEQSFTRSSGLRRHQNSHTGEKPYTCLECGQSFSRSGAL-RLHQTTHTVEKP.................................................................................................................................................................................................................................................................................................................................................................................................................... 730
169 0.000e+00gi|350585284|ref|XP_003127261.3| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 226 [Sus scrofa]  clstr ali  14  461LSSNLQAHQRVHTGEKPYKCDECGKSFRRNSHYQVHLVVHTGEKPYKCEVCGKGFSQSSYLQI--------HQKAHSIEKPYKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEDCGKGFSRRADLKIHCRIHTGEKPYNCEECG-KVFRQASNLLAHQR-VHSGEKPFKCEECGKSF------GRSSHLQAHQKVHTGEKPYK-----CEECGKGFKWSLNLDMHQREKPYKCGECGKHFSQASSLQLHQS-VHTGEKPYRCDV-------CGKVFSRSSQLQSHQRVHTGEKPYKCETCGKSFSWRSNLTIHYRIHAGDKSYKTGRGGKT........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 766
170 0.000e+00gi|351716032|gb|EHB18951.1| Zinc finger protein 226, partial [Heterocephalus glaber]  clstr ali  13  476LSSNLQAHVRVHTGEKPYKCEECGKSFRRNSHYQVHLVVHTGEKPYKCGICGKGFSQSSYLQIHEKA--------HNMEKPFKCEVCGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECG-KVFRQASNLLAHQR-VHSGEKPFKCEECGKSF------GRSSHLQAHQKVHTGEKPYK-----CEECGKGFKWSLNLDMHQREKPYKCGECGKYFSQASSLQLHQS-VHTGEKPYKCDVC-------GKGFSRSSQLQSHQRVHTGEKPYTCEICSKSFSWRSNLTIHHRIHVGDKSYKSNKDGKN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 781
171 0.000e+00gi|334329054|ref|XP_001379428.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  15  580VRAHLAAHQRIHTGEKPYECKQCGKTFTWRGNLAMHQKIHTGEKPYECKHCGKAFTQSGSLAA--------HQSIHTGEKPYECTQCGKAFTERSSLARHQRIHTGERPYVCKQCGKTFTWRVNLAMHQKIHTGEKPYQCKHCGKA-FTQRGSLAAHQ-SIHTGEKPYECIHCGKAFT------RRGDLVRHQRIHTGEKPYE-----CKHCGKAFTQRGSLAAHQGHKPYECTQCEKAFTRRGDLVRHQ-KIHTVKEHYIC-------KQCGRAFTRRGCFAKHQRIHTGEKPHE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 850
172 0.000e+00gi|296234502|ref|XP_002762485.1| PREDICTED: zinc finger protein 208-like [Callithrix jacchus]  clstr ali  16  768MKSRMIEHQRTHTGEKPYVCNECGKAFPRKSNLIVHQRNHTVEKSYLCSECGKGFTVKSMLII--------HQRTHTGEKPYICGECGKGFPLKSRLIVHQRTHTGEKPYRCSECGKGFIVNSGLMLHQRTHTGEKPYICSECG-KGFAFKSNLVVHQRT-HTGEKPFLCSECGKGFTMKR------YLIVHQQIHTGEK-----SCICSECGKGFAMEAELALHKQEKPYGCNECGKGFTVKSRLIVHQ-RTHTGEKPFVCSE-------CRKAFSSKRNLIVHQRTHNGNK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1035
173 0.000e+00gi|358417031|ref|XP_003583541.1| PREDICTED: zinc finger protein 91-like [Bos taurus]  clstr ali  266.......................................................................................................................................................................................................................................KCRICGKVFSKSSNLSKH-WKIHTGRKPFKCTD-------CSKAFNCRSRLTQHQRIHTGEKPYKCIECGKAFIYNSSLIQHQRIHTGEKPYKCTECSKAFIRHSFLTQHQRMHTAEKPYKCTECGKAFNRNSTLSQHQRIHTGEKPYKCKDCGKAFIRCSYLTEHQRIHTGEKPYKCKDCDKAFIRCSRLTEHQRIHTRERPNHFTECGQTFIRSSTLTEHHR-IHAGEKRYKCKECGKTFITSSYLTKHQQIHTGERPYKCTECGKNFNRNSNLTQHQRIHTGEKPYKCSKGGKAFNQNSSLTXKQRMHTGEKP................................................................................................................................................................................................................................................................................................................................ 572
174 0.000e+00gi|38049061|tpg|DAA01855.1| TPA_exp: regulator of sex-limitation candidate 11 [Mus musculus]  clstr ali  13  301.SSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK--------HQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECG-KTFSVHSTFSKHQ-IMHTREKPYKCKHCDKTFKY------PSPLVQHERIHTGERPYK-----CEVCGKAFTSSSNLKYHWREKPYKCEQCGKAFKNSSNVTRHYKFI...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 535
175 0.000e+00gi|296477179|gb|DAA19294.1| zinc finger protein 264-like [Bos taurus]  clstr ali  12  265..........................................................................................................................................................................................................EESLFKCNECGKVFNKKRLLARHERIKPYECTECGKTFSKSTYLLQHHM-VHTGEKPYKCME-------CGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHRSTFVLHNRSHTGEKPFVCKECGKAFRHRSYLMWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRIHTGEKPYVCTECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRADLIR-HFSIHTGEKPYECTECGKAFNRRSGLTRHQRIHSGEKPYEC..................................................................................................................................................................................................................................................................................................................................................................................... 579
177 0.000e+00gi|327284590|ref|XP_003227020.1| PREDICTED: zinc finger protein 91-like [Anolis carolinensis]  clstr ali  12  253.................................................................................FVCTKCGKCFWYKQELTRHQQAHTSEKAFKCNAYCK----------------GKKTHKCQECG-KYFAGRTILLVHQR-VHTGEKPFKCLECGKCFS------ASSNLVTHQRLHTGEKPY-----RCRECGKCCTRKSELVIHEREKPFKCQECGKCFSQNSTLATH-WRVHTEEKPYKCQE-------CGKWFAHKSSLLVHQRIHTGEKPYKCQECGKSFVHSSHLVTHQTLHTGEKPYKCQECGKCFAHTSHLVTHQTLHTGEKPYECLECGKCFATNSSLGSHIRVHTGEKPYKCQECGKTFAYSSHLMTHQTLHTGEKPYKCLECGKSFSTNSSLVSHQRVHTREKPYKCQECGKCFSTSSNLGTHHR-LHTGEKPYRCQECGKCCTRNSYLVKHKRLHSGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 637
178 0.000e+00gi|327290513|ref|XP_003229967.1| PREDICTED: zinc finger protein 658-like, partial [Anolis carolinensis]  clstr ali  10  85.............................................................................................................................................................................GSSFWNRGLVWEVGSLHKHQRTHTGEKPYK-----CLECGQSFSRNSHLYRHQREKPYNCLECGQSFTEKGSLHKHQ-RTHTGEKPYKCLE-------CGQSFARSSGLRSHQRTHTGEKPYKCLECGQSFARSSGLRSHQRTHTGEKTYNCLECGQSFTQKGSLHKHQRTHTGEKPYNCLECGQSFTQKGHLHSHQRTHTGEKPYNCLECGQSFTQSSGLRSHQRTHTGEKPYNCLECGQSFTEKGSLHKHQRIHTGEKPYNCLECGQSFTEKGSLHKHQR-IHTGEKPYKCLECGQSFAHSSGLRSHQRTHTGEKPYNCLECGQSFTQSSGLRSHQRTHTGEKPYNCLECGQSFARSSGLRSHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 448
179 0.000e+00gi|296234776|ref|XP_002807913.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 274-like [Callithrix jacchus]  clstr ali  12  498...............................................................................................................................................................RIHKGSQVCRCSECGKIFRNPRYFS------VHKKIHTGERPY-----VCQDCGKGFVQSSSLTQHQRERPFECQECGRTFNDRSAISQH-LRTHTGAKPYKC-------QDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQIASLIIRQRTHTGEKPFECTQCGKSFSQSYDLVIHQRTHTGEKPHECSLCGKSFTQSSKLRRHQRIHTGEKPYHCIECRKSFRWNSNLIVHQRIHTGEKPYEYTHCGRSFSQSSDFVAHKRTYTGEKPCECNQCQKAFIRSTQLIR-HLXIHTGEKPYKCNQCEKAFTGSSTLXEHQRTHTGEKPFECSTGSSHLLSHQRVHSGEKPYKCSDCGKSFRRRSQLVVHQRTHTGEKPY-ECSHCGKAFSQRSPL..................................................................................................................................................................................................................................................................................................................... 885
180 0.000e+00gi|291386293|ref|XP_002709601.1| PREDICTED: zinc finger protein 347 [Oryctolagus cuniculus]  clstr ali  11  184.RSSLTRHQRIHTGESPYECHECGKAFSQKSILTRHQLIHTGRKPHQCPECGKAFYGVSSLNRHQKACSECHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFKCNECEKAFSYYSAFVLHQRIHTGEKPYECKECGKA-FSQSIHLTLHQR-IHTGEKPYECHDCGKAFSH------RSALIRHHIIHTGEKPYE-----CNECGKAFNQSSYLTQHQREKPYECRECGKAFSQSTFLTQHQV-IHTGEKPYKCNE-------CGKAFSDRSGLIQHQRTHTGERPYECLECGKAFGYCSALTQHQRTHTGEKPYKCSDCAKAFSDRSALIRHQRTHTGEKPYKCKDCGKAFSQSSSLTKHQKTHTGERPYKCKECGKAFSEHSAFGQQKRIHTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 641
181 0.000e+00gi|338710304|ref|XP_003362339.1| PREDICTED: zinc finger protein 268-like [Equus caballus]  clstr ali  12  176.............................................YEHNLCAKAFSMVTNLKRC--------RRIHIEGKPYECSECPKSFRYRSKLIIHQRTHTGEKPYRCDECQKAFSTKCHLTLHQRTHTGEKPYGCTEC-QKSFRTKYHLILHHRT-HTGEKPYECKECGKA------YREKTKLRLHYRTHTGEKPFE-----CSDCGKGFMQKSNLIIHQRDKPYGCGDCEKAFCSKSQLVVHQ-RIHTGEKSYECRE-------CGKAFNKNSHLMTHQRIHIGEKPYECSECGKAFVHTSQLIVHQRNHTGRKPYECKECGKAFNKKSHFVTHERIHTGEKPYECSECGKAFIDNSQLIVHRRTHTGEKPYECKECRKAFNKRSSLITHQRIHTGEKPYECSECGKSFIDKSHLIVHQRTHTGEKPYECSECGKAFIRKAMLIVHQRT-HTGEKPFACLECQKAFSSMAMLSRHQLIHTGEKPHGCN.................................................................................................................................................................................................................................................................................................................................................................................... 599
182 0.000e+00gi|327290264|ref|XP_003229843.1| PREDICTED: zinc finger protein 658-like [Anolis carolinensis]  clstr ali  11  1MENDLHCDLRPQAGEKVETCMICGKGFSGRSSLVKHERTHTGEKPYQCMQCGKSFSRSDKLYD--------HQRAHTGEKPFECTECGKSFSQSGDLQSHQRTHTGEKPYQCMECGKSFSRRGYLLTHQRTHTGEKPYECIECG-KSFSHSGSLHSHQRT-HTGEKPYECMECGKSFSNSR------DLRCHERIHTGERPY-----QCMECGESFNQSGHLRSHEREKPHKCMECGESFSRNGYLLAHQ-RTHTGEKPYQCTE-------CGKSFVHSGDLRCHQRTHTGEKPYECMECGKSFSHSGYLLTHQRIHTGEKPFQCMECGKRFGRSGHLRSHQRTHAGEKPYKCMECGKCFIRRSYLTKHQRTHTGQKPYKCVECGKSFSESGHLRYHQRIHTGEKPYKCMECGKSFIQSGHLRSHQRTHTGEKPHKCTECGKTFSRSENL-RTHLRTHTGEKPYHCMKCGKSFSHSVSLHAHQRTHTGEEPHKC..................................................................................................................................................................................................................................................................................................................................................................................... 482
183 0.000e+00gi|296233642|ref|XP_002762107.1| PREDICTED: zinc finger protein 208-like [Callithrix jacchus]  clstr ali  15  907LRSALIQHRPIHTGEKRYDCKECGKSFTSHSTLIEHQRIHTGEKPYHCRECGKSFTFRSAL--------IQHQQIHTGEKPYDCKECGKAFRRRSKLTQHQRIHTGEKPYQCQECGKAFVRLSGLTKHHSIHTGEKPYECKTCG-KSFRQRTHLTLHQR-IHTGDRPYECKECGKSFTCG------SELIRHQRTHTGEKPY-----DCKECGKAFRCPSQLSQHKRDKTYQCPECGKAFFYASGLSRHYS-IHTGEKPYEC-------KTCGKAFRQLTQLTQHRRIH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1170
184 0.000e+00gi|297693549|ref|XP_002824080.1| PREDICTED: zinc finger protein 268-like, partial [Pongo abelii]  clstr ali  172..................................................................................................................................................................................CCILWSRKDQLVSHQKTHSGQKPY-----VCNECGKAFGLKSQLIIHEREKPYECNECQKAFNTKSNLMVHQ-RTHTGEKPYICSDCGYGCIQCGKGFSLKSQLIVHQRSHTGMKPYVCSECGKAFRSKSYLIIHTRTHTGEKLHECNDCGKAFSFKSQLIIHQRIHTGENPYECHECGKAFSRKYQLMSHQRTHAGEKPYECTNCGKAFGLKSQLIIHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHQ-GVHTGVKPYGCSQCEKTFSLKSQLIVHQRSHTGVKPYGCS.................................................................................................................................................................................................................................................................................................................................................................................... 506
186 0.000e+00gi|326666835|ref|XP_003198391.1| PREDICTED: zinc finger protein 271-like [Danio rerio]  clstr ali  10  30...........................................................................................................................................................................................................KNRFTCTQCGRRLANKSKLKIHMRERPFTCIQCGKSFIRSSSLNVHMMS-HTGEKPFSCTERPFTCTQCGKSFSQSSSLNQHMRIHTGEKPFTCTQCEKSFSQSSHLNEHMMIHTGKKPFTCTQCRKNFYCSSHLNKHMRIHTGEKPFTCTQCGKSFSRSSSLNLHMRIHTGVKPFTCTRCGKSFNCSSSLNLHMRIHTGEKPFTCTRCGKSFNCSSSLNRHMRIHTGEKPFTCTQCEKSFSQSS-HLNEHMMIHTGRKPFTCTQCGKSFSQSSYLNQHMRIHTGEKPFICTHCGKSFSHSSSLNQHMRIHTGEKPFTCTQCGKSFSQSSSLNLHMRIHGKKPFKCTLCGKSFSQSSSLNQHMMIHTGEKPFTCTQCGKSFSQSSS...................................................................................................................................................................................................................................................................................... 439
187 0.000e+00gi|282395053|ref|NP_848644.2| zinc finger protein 678 [Homo sapiens]  clstr ali  13  150...........................................KIFQCIECGRNFSWRSILTE--------HKRIHTGEKPYKCEECGKVFNRCSNLTKHKRIHTGEKPYKCDECGKVFNWWSQLTNHKKIHTGEKPYKCDECD-KVFNWWSQLTSHKK-IHSGEKPYPCEECGKAFTQF------SNLTQHKRIHTGEKPYK-----CKECCKAFNKFSNLTQHKREKPYKCEECGNVFNECSHLTRH-RRIHTGEKPYKCEE-------CGKAFTQFASLTRHKRIHTGEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYKCEECGRTFTQFSNLTQHKRIHTGEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCEECGKVFKQCSHLTSHKRIHTGEKPYKCKECGKAFYQSSILSKHKRIHTEEKPYKCEECGKAFNQFSSLTRHKR-IHTGEKRYKCKECGKGFYQSSIHSKYKRIYTGEEPDKCK.................................................................................................................................................................................................................................................................................................................................................................................... 575
188 0.000e+00gi|334328875|ref|XP_003341137.1| PREDICTED: zinc finger protein 91-like [Monodelphis domestica]  clstr ali  151....................................................................................................................................................................................................................GMAFGSSSDLIRHPKSKHFVNNKDGKPFSQNSKLGSHQI-IHGREKPYECKHS-------GRAFTLSSDLAAHQRIHIGERPYECKQCGKTFTERGNLVAHQRIHTGEKPYECKHFGKAFTWNDHLASHKKIHIGEKPYKCKQCGKAFTIRSHLATHQRIHNRAKLYKCKQCGKAFTQRRSLTEHQRIQTGEKPYECKQCAKAFTRRSELVAHQRIHTGEKPYKCKHCGKAFTQSSGLVTHQR-IHTGEKPYECKHCEKAFTRSDYLTEHERIHTGEKPYECKQCGKAFTQSGHLASHQRIHTGKKPYDSKQCGKTLIERSSLATHQRIHTREKP................................................................................................................................................................................................................................................................................................................................ 480
189 0.000e+00gi|334349310|ref|XP_001371021.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  245................................................................HACELTRHQRGHVGDKPCTCPECGKAFSQSSYLLQHQRVHTGEKPYRCRECGKAFAWSSNLIQHQRIHTGEKPYACPECGKA-FRAHSQLIHHQK-IHSGEKPYQCRECGKAF------GRSTTLIQHQRIHTGEKPY-----QCQECGKAFNWNSNFIEHQRERPHACGQCGKAFSQSSNLIEH-LKIHTGEKPHAC-------GQCGKAFMRSSGLRQHQRIHSGEKPYPCRECGKTFRESSQLIQHQRIHTGERPFECAECGKAFILISNLTEHQRVHTGEKPHACAQCGKAFSQRSNLLSHQRIHTGEKPYACGQCGKTFKGSSGLVHHQRIHTGERPYACGDCGKTFRGSSELRQHQRLHSGEKPYVCGDCGKAFVRNSELISHQR-IHTGERPYACALCGKPFSHRSNLNEHQKRHTGRRLYACRACGKAFRQGSSLAKHQKTHRGEKLFKCPACGKAFRHRSELVEHQRIHSGEKP................................................................................................................................................................................................................................................................................................................................ 709
190 0.000e+00gi|296477316|gb|DAA19431.1| Zinc finger protein 208-like [Bos taurus]  clstr ali  12  93.............................................NKCKICEKVFSKSSNLSR--------HRRIHTGRKPFKCTECCTAFNCHSLLTQHQRIHAGEKPYICKECNKAFHRSSFLIEHQRIHTGEKPYKCTVCGKA-FMYNSRLIQHQ-QIHAGEKPYKCTDCSKAFTYN------SLLIQHRRIHTGEKPYK-----CTECSKAFTYNSHLIQHQRERPYKCTECSKAFTYNSLLTQH-RRIHTGEKPYKCTE-------CSKAFIYNSLLIQHQRIHTGEKPFKCTECSKAFTCNSDLIEHKRIHTGEKPYICKECNKAFRRSSFLTEHQRIHTGEKPYKCTVCGKAFTYNSRLIQHQRIHAEEKPYKCTECSKAFTRKSVLIKHRQIHTGEKPYKCTECSKAFTYNSRLIEHQQIHAGEKPYKCTECSKAFTYNS-LLIKHRRIHSGEKPYKCTECSKAFPCNSDLIEHQRIHTGEKPYICK.................................................................................................................................................................................................................................................................................................................................................................................... 516
191 0.000e+00gi|334313550|ref|XP_003339924.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  213.........................................................................RIHTGEKPYECKQCGRTFSHRSALAVHQRIHTGEKRYKCKQCGKTFTRNSGLAVHQRIHTGEKPYECKQCG-KTFSYRSALAVHQR-IHTGEKHYECKQCGKTFT------RSSGLAYHQKLHTGEKPYE-----CKQCGKTFSHASILSVHEREKPYECKHCRKTFSYSSALAVHQ-RIHTGEKPYEC-------KQCGKTFTQNSTLAHHQRVHTGEKPYECKQCGKAFSHTSSLSVHQRVHTGEKPYECKQCGKTFSRYSSLSVHQMVHTGEKPYECKQCGKTFSHSSILSVHQRVHTGEKPYECKQCGKTFSRSSSLSVHQRVHTGEKPYECKQCGKTFSHTSVLSVHQRVHTGEKPYECKQCGKTFSHASSLSV-HRRMHTGEKPYECKQCGKKFSHASSLSVHQRIHTGEKPYECKQCVKTPGSP........................................................................................................................................................................................................................................................................................................................................................................... 625
192 0.000e+00gi|334349848|ref|XP_003342268.1| PREDICTED: zinc finger protein 347-like [Monodelphis domestica]  clstr ali  11  343.SSSLAVHQRIHTGEKPYECNSCGKAFTKSSNLAVHQRKHSGVKPYECNKCGKAFRYRSSLTD--------HEKIHTGEKPYECNQCGKAFTKSSSLASHQRIHTGEKLYECNQCGKAFTQSSSLAVHQRIHTGEKPFQCSQCGKA-FRESSHLGAHQR-IHTGEKPYECSQCGKAFKES------SHLAAHQRIHTGEKPYK-----CNQCGKTFTKSSSLSVHQRKKPFVCNQCGKAFTRNSRLAAHQ-RIHSEEKPFEC-------KQCGKAFTQRTSFATHEKIHTGEKPYECDQCGKAFTGKGNLAAHQRIHNGDKSYECNQCGKTFKYSSSLVRHQSIHTGEKPFECNHCGKTFRISSSLFRHQRLHTGEKLSQCN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 698
193 0.000e+00gi|148680807|gb|EDL12754.1| mCG67691 [Mus musculus]  clstr ali  11  477......................................................................................................................................EKPYKTPE---KCSNKSSGLMVFQARG----KPWKCVQCGKSFAQ------YSALQNPHRICTVKKLY-----SCKECLKSFTWFSKLQAHHRQELYKSNKCGESFTQSSNLQVYQRIHHTGDKPYKCNE-------CGKYFTHSSSLKDHQRIHARHKPYKCNNCGKSFIKSSDLKGHYRIHTGDKPYKCNNCRKSFTQSSGLKRHYRIHTGDKPYKCNECGKYFTQSSNLQVHQRIHTKDKPYKCNECGKYFAHSSSLKVHHRIHTRNKTYKCNNCGKSFIRSSDLKRHYRIHTGNKPYKCNDCGKYFTHSSSLKGHHR-IHTRDKPYKCNNCGKSFRQSSSLKRHYRIHTGDKPYKCNECGKYFACSSSLKRHHRIHTGDKPYKCNECGKYFAQSSNLQVHQRIHTKDKP................................................................................................................................................................................................................................................................................................................................ 869
194 0.000e+00gi|334327335|ref|XP_003340873.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  13  786VRSHLVVHQRMHTGEKPYECEQCQKIFTCNSNLSRHQRIHTGEKPYECKECGKTFTCTSSL--------IVHQRMHTGEKPYECNQCGKTFTRISSLSVHQRVHTGERPYECNQCGKTFNQMSHLAVHQRIHTGERPYECKQCG-KTFNQRSHLVVHQRMN-SGEKPYECNQCGMTFMCS------SSLDVHQRIHTGMKSYE-----CNQCGKTFPRTSKLVVHQREKPYKCKQCGKAFNQRSNLVTHQ-RTHQGE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1024
195 0.000e+00gi|334349220|ref|XP_003342170.1| PREDICTED: zinc finger protein 850-like, partial [Monodelphis domestica]  clstr ali  10  1.............................................................................................SYYLAAHQIIHSGEKPYECKQCGKSFTWRDSLVVHERIHTGEKSYVCKQCGKA-FSERANL-VHEK-IHSGEKPYVCK-CGKAFTE------KGHLVVHQRIHTGEKPY-----PCNQCGKAFTHSSSLVTHQREKPYQCKHCGKSFQWRCDLVKHQ-RIHTGEKPYAC-------KQCGKAFIQRSDLLKHQRIHTGEKPYACEQCGKAFTQRSNLAKHQRIHTGEKPYACKQCGKAFTERSILASHQRIHTGEKPYACKQCGKAFTGRCVLVKHERIHTGEKRYACKQCGKAFTESGHLAAHQRIHTGEKPYECKHCGKTFTQSGHLATHQSIHMGEKPYECKQCGKAFTERGHLAAHER-IHSGEKPYACKHCGKAFTRRMDLVIHGRIHTGEKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 382
196 0.000e+00gi|334313437|ref|XP_001379835.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  244.......................................................................................GRSFSQKSELDSHQKIHCGEKPYECKQCGKAFTQRGGLAIHQRIHTGEKPYECKQCGKA-FTEKGSLVRHQ-TVHSGEKPYECKQCGKAFT------LRFSLITHQRIHTGEKPYE-----CKQCGKAFTNRGSLARHQGEKPYECGQCGKTFTQKLGIAMHQM-IHAGEKPYEC-------KQCSKAFTRRSYLTAHQRIHSGEKPYECEQCGKTFRWCGLLSEHQRIHTGEKPWECKQCGKTFIRWCTLAKHQRIHSGKKPYECKQCGKTFSQRDHLAEHQRIHTGEKPFKCAQCGKAFTQRGSLAMHQTIHSGEKPYECKQCGKAFTQRGHLVKHQTIHSGEKPYECKQCGKAFSLRSSLARHQ-TIHTGEKPYECKQCGKAFALKHSLAEHQKIHSGEKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 633
197 0.000e+00gi|334325096|ref|XP_001376380.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  297.......................................................................................................................TWRENFDVHQKFHTERKPFECNQCG-KTFAKRAALTVHQR-IHTGEKPYECNYCGKAF------KERSSLTVHQRIHTGEKPYE-----CNQCGKAFKYRKSMVEHQREKPYKCYHCGKTFTQRATLTVHQ-RIHTGEKPFECNEKPYKCDQCGKAFIDRSILTVHQRIHTGEKPYECNHCGKTFKERASLTVHQTIHTGEKPFECNLCGKAFRRRDYLKLHQRIHTGGKPYECNQCGKKIAKRAALIVHQRIHTGEKPYECNHCGKTFTERASLTVHQRIHTGEKPFECNLCGKTFIRRNRLTVHQRIHTGEKPYECNQCGKAFSQKSGLTIHQR-IHTGETPFECNQCGKGFRRRYLLNLHQRIHTGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 682
198 0.000e+00gi|334327371|ref|XP_003340886.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  12  157.........RNHTREKPYECKHCGKAFKRRGHLVAHQTIHTGEKPYECKHCGKAFTERGNLAA--------HQRIHSGEKPYECKHCGKVFTQRGHLAAHQTVHTGEKPYECKQCGKAFTWRGSLTRHQTIHSGEKPYECKHCGKA-FTQRDHLTTHQR-IHTGEKPYECKHCGKAFTQ------KGYLASHQRIHSGEKPYE-----CKHCGKAFTQKGYLAAHQREKPYKCKHCGKVFTWRDSLVAHQT-VHSGEKPYKC-------KHCGKAFTQRGYLAAHQRIHSGEKPYKCKHCGKAFTWRDSLVSHQRIHSGDKPYECKHCGKTFTQRGYLASHQRIHTGEKPYECKQCGKAFTGRGNLAAHQTVHSGEKPYECKHCGKAFTQRGNLAAHQRIHSGEKPYECKHCGKTFTWRDSFVAHQRIHSGETPYECKHCGKAFIWKISLAKHER-IHSGEKPYECKQCGKAFTQRDDFAAHERIHTGEKADECCGKTFPWRGSLARH....................................................................................................................................................................................................................................................................................................................................................................... 631
200 0.000e+00gi|296233403|ref|XP_002761998.1| PREDICTED: zinc finger protein 429-like [Callithrix jacchus]  clstr ali  13  285LSSNFTAHKRIHTGEKPYRCQECGRAFNRKAHLTRHKRIHTGEKPYKCEDCGKAFKQSLHLTNHKKFCEECHNRIHTGEKPYKCEECGKAFTLCSYLTAHKRIHTGEKPYKCEECGKVFTLSLHLARHKRIHTGEKPYRCQECGR-GFNRHIHLTGH-RRIHTGEKPYRCEECGKGFTLS------SYLTRHRRIHTGEKPYK-----CEECGKGFTLSSYLTRHEGEKTYKCKECDKAFNQYSNLTIHQ-RIHTGEKPHKCEE-------CGKAFKQSSHLTNHKIIHTGEKHYKCEKCGKAFTLSSYLTMHRRIHTGEKPYSCEKCGKAFTLSSYLTRHRRIHTGEKPYRCGECDKAFNQYSYLTKHKKIHTEEKPCKGEKYGKT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 674
201 0.000e+00gi|344298910|ref|XP_003421133.1| PREDICTED: zinc finger protein 484-like [Loxodonta africana]  clstr ali  341.........................................................................................................................YGNDFTHVNSHTEMNAYECNQCKKKVFTQKSHAFAHQ-SIYTEEKHHECSKCEIIFAQGKEFSLKSN---HQKTHTGEKPYKEKHFECTECRKAFTRKSTLSMHQKEKPYVCPECGKAFIRKSHFITHE-RIHTGEKPYECSD-------CGKSFTKKSQLHVHQRIHTGENPFICSECGKIFTHKTNLIIHQKIHTGERPYICAECGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFTWKSRLRIHQKCHTGERHYECSECGKAFIQKSTLSMHQKIHRGEKPYACTECGKAFFHKSHFITHERIHTGEKPYKCSGCGKSFTKKSQLHVHQQ-IHTGEKPYICAQCGKAFTDRSNLFTHQKIHTGEKPYKCSDCGKAFTRKSGLHIHQQSHTGERHYECSECGKAFARKSTLIMHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 856
202 0.000e+00gi|344269544|ref|XP_003406612.1| PREDICTED: zinc finger protein 268-like [Loxodonta africana]  clstr ali  11  158.......................GKSFFH----TQHEKFHPQVQCYKHNSCVKTFNVMANLKRDH--------RIHTDGKPYECSECPKSFRYKSKLIIHQRTHTGEKPYGCSECQKAFSTKCHLTLHQRTHTGEKPYGCSEC-QKSFRTKYHLILHQRT-HTGERPYECKECGKA------YREKTKLRLHYRTHTGEKPFK-----CGDCGKAFIQKSNLIIHQRDKPYGCRECEKAFCSKSQLIVHQ-RIHTGEKSYECSE-------CGKAFNKNSHLTTHQRIHTGEKPYECSECGKAFIHMSQLIVHQRTHTGQKPYKCKECGKTFNKKSHFITHQRIHTGEKPYECSECGKAFIDNSQLIVHRRTHTGEKPYECKECGKAFNKKSSLITHQRIHTGEKPYECSECRKAFIDKSHLIVHQRTHTGEKPYECSVCGKAFLRKAMLIVHQR-IHTGEKPFVCLECQKAFSSMAMLSRHQLIHTGEKPHGCN.................................................................................................................................................................................................................................................................................................................................................................................... 599
203 0.000e+00gi|119605298|gb|EAW84892.1| zinc finger protein 708 (KOX8), isoform CRA_b [Homo sapiens]  clstr ali  11  160..................QCDKYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCMLSQLT--------QHEIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLTRHKIIHTGEKLYKCEECGKA-FNRSSNLTKH-KIVHTGEKPYKCEECGKAFKQS------SNLTNHKKIHTGEKPYK-----CGECGKAFTLSSHLTTHKREKPYKCEECGKAFSVFSTLTKHKI-IHTEEKPYKCEE-------CGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPYKCEECGKAFSIFSILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEECGKAFNQSPNLTKHKRIHHTGEKSYKCDKCGKAFNWLLILMKQKIIHTREKPYKCK.................................................................................................................................................................................................................................................................................................................................................................................... 630
204 0.000e+00gi|334350393|ref|XP_003342345.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  35.................................................................................................................................................................HGGDKPHKCNECGKAFR------RSSNLIQHQKIHSGEKPYK-----CNECGKAFSRSTTLIHHQGEKPYECNECGKAFMASSALIRHQT-IHSGERPYECNE-------CGKAFSRNSILIEHKRIHSGEKPYECNECGKACRGSSKLIEHQRIHTGVKPYECNECGKTFSQNSHLTQHQRIHTGVKPYQCSECGKAFRQIATFINHQRIHSGEKPYECNVCGKVFRVRSDLIRHQRIHSGERRYECNECEKTFSQSSCLIQHRRTHSGEKLYECNECGKNFSRSSNLIQHQR-IHSGEKPYECSECGKAFSRSSNLIQHQRIHTGERPYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 352
205 0.000e+00gi|309268240|ref|XP_003084649.1| PREDICTED: zinc finger protein 420-like isoform 1 [Mus musculus]  clstr ali  14  482VKSSLRIHQKIHTGEKPYKCSECDKCFTKPSHLSIHQRIHTGEKPYKCSECEKCFTVKSSLRI--------HQKIHTGEKPYKCSECDKCFTKPSHLSIHQRIHTGEKPYKCSECEKCFNEKNILKIHQRIHTGERPYKCRECD-KCFSRKFHLGIHQR-IHTGKKPYKCSECDKCFT------TKGNLIIHQRIHTREKP-----HKCSECDKCFTQKSHLSIHQ-------------------------KIHTGEKPYK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 696
206 0.000e+00gi|332854414|ref|XP_003316280.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 85 [Pan troglodytes]  clstr ali  13  144...........................................................................................................KIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCRKCG-KSFRMISCLTEHSR-IHTRVNFYKCEECGKAFNWS------STLTKHKRIHTGEKPYK-----CEECGKAFNQSSNLIKHKKEKPYKCEECGKTFNRSSTLTTHKI-IHTGEKPYKCKE-------CGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECGKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKS-HTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 513
207 0.000e+00gi|359318831|ref|XP_003432721.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 345 [Canis lupus familiaris]  clstr ali  11  234.............................................................................................................................TQHQRIHTDEKLLECKECG-KDFSFVSVLIRHQR-IHTGEKPYECKECGKAF------GSGANLAYHQRIHTGEKPYE-----CSECGKAFGSGSNLTHHQREKPYECKECGKAFSFGSGLIRHQI-IHSGEKPYECKE-------CGKSFSFESALTRHHRIHTGEKPYECKDCGKAFGSGSNLTQHRRIHTGEKPYECKACGMAFSSGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSDLTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKAFS-SGSDLTQHQRIHTGEKPYECKECGKAFGSGSKLIQHQLIHTGEKPYECKECGKSFSSGSALNRHQRIHTGEKLYECKECGKNFGSGSSLTQHQKIHTGEK................................................................................................................................................................................................................................................................................................................................. 636
208 0.000e+00gi|334332901|ref|XP_001375703.2| PREDICTED: zinc finger protein 208-like [Monodelphis domestica]  clstr ali  12  327.................YKYNMHEKCFKDDSQLTKCPQIYTAQKPFMYNEFEKAFRHISQLKLRY-----TH---HSGEKSYKCNECGKAFTKWANLTRHQRIHSGEKPYKCDECGKAFTQRTHLTQHQLTHIGEKPFKCNECGKAFF-QRIHLTQHQHT-HIEEKPFKCNECGKAYSY------ISQLSLHQRIHSGEKSYK-----CNECGKAFTKWANLTRHQREKPYKCNECEKAFSQRAHLTQH-LLIHSGEKPFKCNE-------CERAFSQVSQLNLHQRIHTGEKPYKCNECGKAFTQRTILTQHQKIHSGEKPFKCNECGKAFTKRSNLTQHQHIHIGEKPFKCNECGKAYSYILQLNIHQRIHSGEKPYKCNECGKAFTKRVILTQHLKIHSGEKPYKCNECCKAFTKQANLTRHQRIHSGEKPYKCNDCGKTFTQKPNLTQHQRIHTGDKKSYKCNECGKVFPMWAELTRHLRTHSGEKPYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 779
209 0.000e+00gi|334327373|ref|XP_003340887.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  12  345.......................................................................................................................................KPYECKQCGKA-FTWKVSLDTHQR-IHTGEKLYECKQCGKTFTWKFSFVA------HQRIHAGEKPYE-----CTQCGKVFTQRRSLTVHTGEKPYECKHCGKAFTWKISLDTHQ-RIHTGEKPYEC-------KQCGKAFTWKFSLATHQRIHTGEKPYKCKHCGKAFTDRGSLVKHQRIHTGEKPYECTHCRVAFNVKSHLAAHERIHTGEKPYECKQCGKAFIRRSYLTKHQRNHTGEKPYECTHCRVAFAMKSHLAAHERIHTGEKSYKCKQCGKAFIRRNYLVKHQRIHSGEKPYECKQCGKAFRERGSLTKHQR-IHTGEKPYECTQCGKAFTQKRSLAAHKIVHTGDKPYECKH................................................................................................................................................................................................................................................................................................................................................................................... 687
210 0.000e+00gi|377836016|ref|XP_984201.4| PREDICTED: zinc finger protein 709-like [Mus musculus]  clstr ali  11  85..........................................................................................................................................................TRHVRS-HRWKKLYECNQCGKVFA------RPDLLQCHKRTHTGEKPYE-----CNQCGKAFSSHSGLRYHKREKPYECNQCGKAFSSHSGLRYHK-RNHTGEKPYECN-------QCGKAFSSHSNLRYHKRNHTGEKPYECNQCGKAFARPADLQCHKRTHTGEKPYKCNQCGKAFSCHSGLRYHKRTHTGEKPYECNQCGKAFSSHNSLRYHKRTHTGEKPYECNQCGKAFSSHSGLRYHKRNHTGEKPYECNQCGKAFSSHSGLRYHKRNHTGEKPYECNQCGKAFSSHSNL-RYHKKTHTGEKPYECNQCGKAFARPADLQCHKRTHTGEKPYKCNQCGKAFSCHSGLRYHKRTHTGEKPYECNQCGKAFSSHNSLRYHKRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 460
211 0.000e+00gi|344269604|ref|XP_003406639.1| PREDICTED: zinc finger protein 160-like [Loxodonta africana]  clstr ali  10  263..SHLAELQRFQSEEKFYECSQVEKSIKNCSSLTQLQMTHIREKPYKCSECGKTFSQCSVLTKHERICNECHQRIHTGERPYKCNICGKVFNQNSHLVSHCRIHTGEKPHKCNVCDKVFNQNSHLASHCRIHTGEKPYKCMKCGKA-FNKRSYLWDHER-IHSGEKPYNCTECGKAFRQ------WSSLRIHRRIHTGEKPYK-----CNECGKAFKQCSHLTKHQGEKPHKCNVCGKSFIHSSNLVKHQ-RIHTGEKPHKCSE-------CSKAYMQSSSLVEHQRIHTGETPYKCNECGKTFTVHSSLTKHKRNHTGEKPYKCNECGKTYTQFAHLTRHQKIHSGEKPYKCNECGKSFNWSSRLTRHQRIHTGEKPYKCNVCGKAFSQNSNLTTHQRIHTGEKPYKCNECDKAFKQYSSLTRHQNIHPGEKPYKCNVCSKAFIKRS-HLWGHEKIHTGEKTYNCIKCDKVFRQRSDFRIHQRIHTGEKL........................................................................................................................................................................................................................................................................................................................................................................................ 780
212 0.000e+00gi|344269608|ref|XP_003406641.1| PREDICTED: zinc finger protein 616-like [Loxodonta africana]  clstr ali  13  776IRSHLWGHERIHTGEKPFKCNDCGKAFTERSTLTQHRRIHTGEKPYKCNECGKDFPTRSHLWG--------HKRIHTGEKPYKCDVCGKAFTESSNLTQHKRIHSGEKPYKCNICDKAFSQNSSLTVHRRIHTGEKPYKCKECGKA-FKQYSSLTRHQ-NIHPEEKPHKCNVCGRAFI------KRSHLWDHERTHNGEKLYK-----CVLCSKAFRQWSDLKIHQKEKPHKCNECGKSFNQFSQWTKHQI-IHSR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1013
213 0.000e+00gi|332261953|ref|XP_003280029.1| PREDICTED: zinc finger protein 708-like isoform 1 [Nomascus leucogenys]  clstr ali  10  179MLSQLTQHEIIHTGEKPYKCEECGKAFSQSSTLTRHKIIHTGEKLYKCEECGKAFKKSSNLSN--------HKIIHTGEKPYKCEECGKAFSQSSTLTRHKIIHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKA-FKQSSNLTNHKK-IHTGEKPYKCGECGKAFTLS------SHLTTHKRIHTGEKPYK-----CEECSKAFSVFSTLTKHKIEKPYKCEECGKAFNRSSHLTNHKV-IHTGEKPYKCEECGYKCEECGKAFSIFSILTKHKVIHTEEKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEECGKAFNQSPNLTKHKRIHTKEKLYKCK......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 591
214 0.000e+00gi|334347868|ref|XP_003341990.1| PREDICTED: zinc finger protein 91-like [Monodelphis domestica]  clstr ali  15  844LKSHLVRHQRIHTGEKPYECKQCGKAFTGKSHLVSHQRIPSGEKTYECKQCGKAFT--------GRRELVSHQRIHTGEKPYECNQCGKAFIDKGSFNRHQKIHNGEKTYECKQCGKAFTRRSHLVSHQRIHTGEKPYECNQCGKA-FRLKSQLVVHQR-IHTGERPYGCKQCGKAFT------GRSHLVSHQRIHSGEKPYE-----CKQCGKAFTWRRELVSHQREKPYECNQCGKAYIDKGSLNKHQ-KIHTGE-PYECN-------QCGKAFIYKGSLNRHQKIHNGEKPF............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 1112
215 0.000e+00gi|334349364|ref|XP_001376777.2| PREDICTED: zinc finger protein 624-like [Monodelphis domestica]  clstr ali  17  484.......HQRIHTGEKPYKCKQCGKTFSGILSLTVHQRIHTGEKPYECKQCGKTFSRSCSLALHQRTCKHCHERMHTGEKPYECKQCGKTFSRSSHLVRHQRIHTGEKPYECKQCGKTFCRSTTLAEHQRTHTGEKPYKCKECG-KTFSRNFSLAEHQ-NIHTGKKPYECNQCGKTFNQ------RAHLAVHKRIHTGKKPYE-----CKQCGKTFKLRSELAVHQRERPYECKQCGKTFRNSSSLSVHK-RIHTGEKPYECKEDRCECRQCSHSFSVEIQLQT....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 800
216 0.000e+00gi|334349185|ref|XP_003342165.1| PREDICTED: zinc finger protein 665-like, partial [Monodelphis domestica]  clstr ali  12  2...................................................................................................................................YTGAKFYKCPQC-RKAFNKSSKLILHQR-IHVGENPCECNVFGKGFHCGKMFINDSKLILHQRIHTGEKPFK-----CNDCGKFFSHRSKLIIHQREKPFKCHDCGKAFIRSSHLLQHQ-RIHTDEKPFKCDD-------CGKAFNQNSNLLQHQRIHTDEKPFKCDDCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNRNSNLLQHQRIHTGEKPFQCNDCGKTFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFQCHDCGKAFSQSSYLLQHQRIHTDEKPFKCDNCGKAFNQNSNLSVHQR-IHTSERPFQCNDCGKAFNRSSHLLQHLRIHTGEKPFQCH.................................................................................................................................................................................................................................................................................................................................................................................... 375
217 0.000e+00gi|334325084|ref|XP_001374966.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  11  81.....................................................................................................................................................................................................PEKLYE-----CNQCGKAFLRRGQLTQHQKEKPFECRDCGKAFRLKEHLTRHQ-RIHTGEKPYECNE-------CGKAFHLRELLSLHQSIHTGEKPHKCNECGKAFSQRGHLNLHQRIHTGEKPYECNDCGKLFRLKEHLTRHQRIHTGEKPYECNECGKFFRRRGLLTRHQSIHTGEKPYECNECGKAFHLSTELTRHQRIHTGEKPYECNKCGKAFHMSTELTRHQRIHTGEKPYECNDCGKAFHLREYLTRHQR-IHTGEKPYECNDCGKAFRLREHLTRHQRIHTGEKPYECS.................................................................................................................................................................................................................................................................................................................................................................................... 368
218 0.000e+00gi|359318803|ref|XP_541578.4| PREDICTED: zinc finger protein 45 [Canis lupus familiaris]  clstr ali  10  141.................YKDEELGKGFNQNLHLQVHKD-HKGGKPYQGEECEKGFIHHSRLQTNQTA--------HVGEKPYKCEKCENTFRRLSSLQAHQKVHTGENPYKCEECGLSFSQSSYLQVHQRVHMGKKPYRCEECG-KGFSWRSRLQAHQR-IHTGEKPYKCEACGKGFSYS------SHLNIHCRIHTGEKPYK-----CEECGKGFSVGSHLQAHQGEKPYKCEECGKGFCRASNLLDHQ-RGHTGEKPYQCDEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGEKPYKCEKCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGEKPYKCEECGKVFSWSSYLQAHQR-VHTGEKPYKCEECGKGFSWSSRLSDHQRVHTGEKPFKC..................................................................................................................................................................................................................................................................................................................................................................................... 674
219 0.000e+00gi|334313163|ref|XP_001368898.2| PREDICTED: zinc finger protein 729-like [Monodelphis domestica]  clstr ali  10  234...........................................................................................SLVSILTQKQILHTGEKPYECKDCGKAFCQSIQLTVHQRIHTGEEPYKCKLCGKKTFRKSSQLILHQR-IHTGEKPFKCNYCEKAFR------RSSRLTQHQRIHTGEKPYE-----CKDCGKAFHQSSGLTQHQREKPYKCNDCGKAFRRRSKLTQHQ-RIHTGVKPYEC-------KDCGKAFHQSSGLTQHQTIHTGEKPFKCNDCGKVFRRSSKLIQHQRIHTGVKPYECKDCGKAFHQSSQLTLHHRIHTGEKPFKCSDCGKAFHQSSELTIHQRIHTGEKPYQCNNCGKAFCRSSKLTAHQKIHTGEKPFKCNDCGKAFHQNSELTVHLRIHNGEKPYKCNHCGKAFHRNSELTRHQR-IHTGEKSYKCNDCGKAYYWSSGLIRHQRIHIGQKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 727
220 0.000e+00gi|334325098|ref|XP_003340602.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  185...........................TWRENLDVHQKIHTGGKPFECNQCGKA--------CRSRNSMVKHQSIHTGEKPYKCKHCGKTFTQRATLTVHQRIHTGEKPYECNLCGKAFRYRKDIVKHQSIHTGEKPYECDQCGKA-FTQKSALTVHER-IHTGEKPYEFNHCGKTFKCGKTFAKRAALTVRERIHTGEKPYE-----CNHCAKSFTQRATLTVHQKIKPYECNHCGKTFKERASLTVHQT-IHTGEKPFECNLCGFECNQCGKTFAKRAALTVHERIHTGEKPYKCDQCVKTFTERASLTIHQRIHTGEKPFECNLCGKAFIRRARLTVHQRIHTGEKPYECNQCGKAFTQKSALTIHQRIHTGETPFECNQCGKAFRGRNGLKLHQRIHTGEKPYKCNQCGKAFTHRSTLTVHQSVHTGEKPYECNQCGKAF-RSRNSLVTHQSIHTEEKPYECNQCGKAFRGRDGLKLHQRIHTGEKPYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 682
221 0.000e+00gi|296475131|gb|DAA17246.1| zinc finger protein 197-like [Bos taurus]  clstr ali  11 1179LKKSLILHQRIHSGEKPYKCDECGKTFAQTTYLVDHQRLHSTENPYKCKECGKVFIRSKSLLLHQRVCKKCHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFILKKSLILHQRFHTGENLYECKDCG-KVFGSNRNLIDHER-LHNGEKPYECRECGKTFIMSKSFM------VHQKLHTQEKAYK-----CEDCGKAFSYNSSLLVHRREKPFECNECGRAFSSNRNLIEHK-RIHSGEKPYECNE-------CGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHTGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVHQRIHTGEKPYKCSECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCNDCNKVFRQRKNLTVHQK-IHTDEKNCECDESEKEFSQTSNLHLQPKIHSLED......................................................................................................................................................................................................................................................................................................................................................................................... 1670
222 0.000e+00gi|296222945|ref|XP_002757417.1| PREDICTED: zinc finger protein 2-like [Callithrix jacchus]  clstr ali  10  139............................................................................................................................................................................HKKSLSQEKGSRRVSALPK-------EIPTKERQQECSDCGKTFFDHSSLTRHQREKPYNCHECGKAFSHRSSLSRH-LMSHTGESPYECSV-------CAKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHERIHTGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKAFFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQR-ICTGKKPWKCNECEKAFSYYSAFILHQRIHTGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 449
223 0.000e+00gi|334323388|ref|XP_003340389.1| PREDICTED: zinc finger protein 729-like [Monodelphis domestica]  clstr ali  11  258..............................................................................................................................................................RIIHEGEKDHKCDECGKSFTCGKAFSGSTSLCLHQRIHTGEKPYICDPYECDKCGKAFNWSSDLVKHQRERPYECNYCGKAFNQSSDLIKHQ-RIHTGEKPYNCNECGYHCNECGKGFSQNSGLISHLRLHTGEKPYECSECGKAFSENSHLIKHHRTHTGEKLYYCTKCGKRFSQNEGLISHKRIHTGEKPYKCDECGQTFKQNSALIQHQRIHNGRKSYDCLECGKAFRWSSHLVQHQRIHTGEKPYGCNECGKAFRGSSDLIQHRRIHTGEKPYECNECGKAFSQSSKLIRHQR-IHSGEKPYECNECGKSFSQISVLIRHQRIHTGENPYACN.................................................................................................................................................................................................................................................................................................................................................................................... 667
224 0.000e+00gi|334329186|ref|XP_001380391.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  161...SLLKYNRISVGKKLSKYNKYRKPFSYHSDLIQFRITNSGDKSYICHECGKAFGQRRYLIE--------HQRIHTGQKPHKCDECGKAFIQRGNLTSHQRIHTRERPFECKECGKTFSQRGHLTEHQRIHTGEKPFECKECGKA-FSHRGHLAEHQR-IHTGEKPFACNECGKAFSH------RTSLIYHHRIHTGEKPFK-----CNECGKAFSQRGNLTEHQREKPFECNECGKAFSHRGHLTTHQS-THSSEKPYLCNE-------CGKTFSQRGNLIEHQRIHTGEKPFECNECGKTFSRRAYLPEHQRIHTGEKPFQCNECGKAFSHKGSLTEHQRIHTGEKPFQCNECGKTFIKNARLAQHQKIHTGEKPFECTECGAMFSQEERLIEHQRRHAGEKPFECKECGKFFSRKGYLTEHQRIHAGEKSFECKECGKFFSRKGYLTEHQR-IHAGDKSFECNECGKAFSQRKYLTQHQKIHTGEKPFECN.................................................................................................................................................................................................................................................................................................................................................................................... 626
225 0.000e+00gi|281345976|gb|EFB21560.1| hypothetical protein PANDA_020762 [Ailuropoda melanoleuca]  clstr ali  11  305...............KLFKYGACVKQIYSSADLQQHEKQRMGEKPFRSRVDRASFVNSSNFHDSG--------------KPLTFEEVAKDFATSEHLQQ-QATHTGENHHTWEECKKAFGPKHTLVQDQGIHTGRQCFVCPEC-RKTFRYKSSLLIHQR-VHTGDKLHVCSDCGKSFR------GSSTLSQHRRIHTGPRQYK-----CSKCGKSFSQKFVLRSHTGENGYVCHVCAQSFSQSSILIQ-QRTVHTGEMSYECTE-------CGKCFRRKSDLIEHWRVHTGERPYECSECGKSFTSSSALRYHQRIHTGEKPYKCSECGKSFTSSSGLRYHQRIHTGERPYECNDCGKSFTQINHLIIHRRVHTGERPYECSECGKSFSHKSYLSQHQRVHTGERPYECSECGKSFTSGSALCYHQRVHTGEKPYECSECGKSFT-NGPILIRHRRVHTGERPYECSECGKSFTQRNHLNIHQRVHTGERPYECNECGKSFTSGSALR....................................................................................................................................................................................................................................................................................................................................................................... 779
226 0.000e+00gi|109461614|ref|XP_001078778.1| PREDICTED: zinc finger protein 569 [Rattus norvegicus]  clstr ali  10  168......................................................................................................................................................................................................EQPFHNSSPKCNHCGKGFSQTLDLIRHLREKLYECNECGKTFIKMSNLMRHQ-RIHTGEKPYVCQE-------CGKSFSQKSNLIDHEKIHTGEKPYECRECGKSFSQKQSLVAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGEKPYECSECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFITHQKIHTREKPYGCNECGKAFIQMSNLVRHQR-IHTGEKPYLCKECGKAFSQKSNLIAHEKIHSGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 494
227 0.000e+00gi|326667012|ref|XP_003198451.1| PREDICTED: zinc finger protein 271-like [Danio rerio]  clstr ali  10  30..............................................................................................SSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCG-KSFNRSSNLDHHMR-IHTGEKPFTCTQCGKSFN------RSSNLDQHIRIHTGEKP-----ITCTLCGKSFRQSSSLSKHMREKPFTCTQCGKSFSQSSNFNLH-MRIHTGEKPFTCT-------QCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFRQTSSLNKHLRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNL-DHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSS......................................................................................................................................................................................................................................................................................................................................................................... 423
228 0.000e+00gi|334349400|ref|XP_001379879.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  12  114........................................................................................................................................................................................................................TWRENLDVHQKEKAYGCNQCGKTFTQRSSLIVHQ-RIHTGEKPFECN-------QCGKAFTQKAHFTAHQRIHTGEKPFECNQCGKAFRGRYGLILHQRIHTGEKPFECSQCGKAFTDRSSFSVHQRNHTGEKPFQCNQCGKTFAKRAALPVHERIHTGEKPFKCNQCGKAYTQKAGLIIHERVHTGEKPYECNQCGKTFAKRAYLTLHQRIHTGEKPFECNQCGKTFTHKSGL-TLHQSVHTGEKPFECNQCGKAFRLKYSFNLHQRIHNGEAPFECH.................................................................................................................................................................................................................................................................................................................................................................................... 387
229 0.000e+00gi|334327545|ref|XP_003340915.1| PREDICTED: zinc finger protein 347-like [Monodelphis domestica]  clstr ali  10  406...............................................................................................................................................GGKGFGLSSDLIRYQR-IHTKEKPYECKECGKAFTE------RGSLSVHKRIHTGEKPYK-----CKECGKAFTQRATLDAHQREKPFECKECGKAFTMKCHLVAHQ-RTHTGEKPFECN-------QCGKAFTMKDSLTKHQRIHSGEKPFECKQCGKTFTEKVHLAKHLIIHTGEKPYECKDCGKAFRSKHSVATHQMIHSGEKPYECKDCGKAFRSKHSLAIHQMIHTGEKPYECKDCGKAFTQRGSLAAHQRIHTGEKPYECKHCGRPFSQNSELAAHQRIHTGEKPYECKHCGKAFTQRGSLAAHQR-IHSGEKPYECKHCGKVFTKRDYLAAHQRIHTGEKPYECKHCGKAFTQSGSLASHQSIHTGEKPYECKQCGKVFTRRESLAAHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 848
230 0.000e+00gi|334329028|ref|XP_001378907.2| PREDICTED: zinc finger protein 184-like [Monodelphis domestica]  clstr ali  11  440.............................................HECVTFGRKFKLGSVLTPKQKATRGKHL--------YKYDSLGKSFKYLPDIFKYNKTTSGKKHYKNNKCRKPFSYHSDLFQYRKIHSGEKTHKCDECG-KTFSNNSCLTVHLK-IHTGEKPFNCTECGRAFR------RRAHLIQHQRIHTGEKPYK-----CYVCGKAFSVDSYLIKHQREKPYKCNDCGKAFRQLGNLNQHQ-RIHTGEKPYKCNE-------CGKAFSQWGHLNQHQRTHTEEKPFECNECGKVFRQLENLNQHQRVHTGEKPYKCKQCGKAFNNNYLLIQHERIHTGEKPYVCTDCGKAFSRGTYLKKHKRIHTGEIPYKCNECGKEFTDKASFIYHQRIHTGEKLYECIECGKTFSQKANLKKHKMIHTGEKPFECNECGKAFRERGSLSVHKR-IHTGEKPFECNECGKAFRERGSLSAHQEKHAEEKLYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 863
231 0.000e+00gi|309271713|ref|XP_001004338.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 729 isoform 4 [Mus musculus]  clstr ali  11  423.SSTLQIHKRTHTGEKPYECNQCGKAFKRSSDLQKHKRTHTGEKPYECKQCGKAFAESSTLQI--------HKRTHTGEKPYECNQCGKAFKRSCELQKHKRTHTGEKPYECNQCGKAFKRSCELQKHKRIHTGEKPYKCNQCGKA-FTQSSHLQIHKRT-HTGEKPYECNQCGKAFA------RNCDLQKHKQTHTGEKPYE-----CNQCGKAFARKCDLQNHKQEKPYECKQCGKAFAQSSHLRIHK-RTHTGEKPYECN-------QCGKAFKRRSDLQVHKRTHTGEKPYKCKQCGKAFARSGGLQKHKRTHTGERPNECNXCGKAFAGNSGLQCHKRSHTGETPYECNQCGKAFAGRSDLQIHKRRHRGEKLY........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 775
232 0.000e+00gi|297685150|ref|XP_002820161.1| PREDICTED: zinc finger protein 37 homolog [Pongo abelii]  clstr ali  14  853...NLIQHQGIHTGEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECNECEKTFSHRSSLRN--------HERIHTGEKPYPCNECGKAFSHISALTQHHRIHTGKKPYECTECGKTFSRSTHLIEHQGIHSEEKSYQCKEC-RKVFCHSTSLIRHQRT-HTGEKPYECNECGKAFSCGKAFNRSAHLTEHQRTHTGEKPY-----VCKECGKTFSRSTHLTRHQREKPYQCNECGKSFSLSSALTKHK-RIHTR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1143
233 0.000e+00gi|334347751|ref|XP_001372793.2| PREDICTED: zinc finger protein 91-like [Monodelphis domestica]  clstr ali  12  260.............................................................................GKKPHMTNTCNKAFSYHSDLIRYHRVTTRDKPYAFDEFGKAIQQRRHLTRHHRIRPGDKPYTCTECG-KTFSRIPYLMLHQR-IHTGEKPYKCNVCEKAFCQ------RGHLTEHQRIHTGEKPYK-----CNVCEKAFTQSGHLTEHQKEKPYKCSECGKTFSNKSSLILH-RRFHTGEKPYKCYECGYKCHYCGKAFLQYIGLVVHQRIHTGEKPYKCHVCEKAFSQSGHLSEHQKSHNGEKPYECNECGRAFSNTSSLILHHRIHTGEKPYKCNDCGKAFSNSSVLTVHQRIHTGSKPYKCLECGKAFLQCIGLIVHRRTHTGEKPYKCNVCKKAFSQRGHLTQHLKIHNGEKPYKCSECGKAFTQRG-HLTEHRRTHSGEKPYTCNECGKAFSNHSHLTLHHRIHTGEKPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 687
234 0.000e+00gi|335307329|ref|XP_003360799.1| PREDICTED: zinc finger protein 436-like [Sus scrofa]  clstr ali  220.........................................................................................................................................................................................................................................................HKEVHT-------SIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVHTGERPYKCDECGKNFSQNSDLVR-HRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEKPYECNA................................................................................................................................................................................................................................................................................................................................................................................... 458
235 0.000e+00gi|123227460|emb|CAM27169.1| novel KRAB box and zinc finger, C2H2 type domain containing protein [Mus musculus]  clstr ali  10  59.SRSHGRHERSCSPEQPSDFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTCKQCHNRTHAGEKHYECNQCGKAFERRSHLQIHKRTHTGEKPYECNQCGKAFARSGVLQKHKRTHTGEKPYECKQCGKA-FAQSSHLHKHERT-HTGDKPYECKQCGKAFACGKAFAVIYTLQMHKQTHTGEKPYK-----CKQCGKAFARSCHLRIHKREKPYECKQCGKAFARSGVLQQHK-RTHTGEKPYEC-------KQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSDDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFARSGDLQKHKQT-HTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 582
236 0.000e+00gi|327287650|ref|XP_003228541.1| PREDICTED: zinc finger protein 420-like [Anolis carolinensis]  clstr ali  11  1..........................................................................................................................................................................MECGKGFSCS------SKLCLHQKKHTGEKPYK-----CLECGMNFTQSSNLRLHQREKPYTCLECGKRFTSSGSLCKHQ-RTHTGEKPYTCLE-------CGKSFAWRGNLDVHQRTHTGEKPYTCLECGQSFTENGSLRKHQRTHTGEKPYTCLECGKSFASSGNLDVHQRTHTGEKPYTCLECGQSFTERGSLRKHQRTHTGEKPYSCLKCGKCFTGSGSLHSHQRIHTGEKPFTCLECGKSFAQSGTLRSHQRIHTGEKPYTCLECGQSFT-KSGTLRSHQRTHTGEKPYTCLECGESFTENGSLRKHQKIHTGEKPYTCLECGKCFTESGSLHSHQRTHTGEKPYSCLECGKCFAQSGSLRSHERTHTGEKPYTCLECGQSFTKSGSLRS.............................................................................................................................................................................................................................................................................................................. 379
237 0.000e+00gi|354504222|ref|XP_003514176.1| PREDICTED: zinc finger protein 568-like [Cricetulus griseus]  clstr ali  209.....................................................................................................................................................................................................................................PFKCNQCGQDFIHKSDLLRHE-RNHARGKPYGCKE-------CGKSFSRKENLITHQKIHTGEKPYMCNECGKAFIQMSNLTRHQRIHTGEKPYACKECWKAFSQKSNLIEHERIHTGEKPYGCKECGKSFSQKQNLIEHEKIHTGEKPYECNECGRAFSRMSSLTLHMRSHTGEKPYKCNQCGKAFSQCSVFIIHMRSHTGEKPYVCSECGKAFSQSSSLTV-HTRNHTAEKPYECNECGKAFSRKENLLTHQKIHTGEKPYECNECGKAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKP................................................................................................................................................................................................................................................................................................................................ 517
238 0.000e+00gi|148688549|gb|EDL20496.1| mCG7830, isoform CRA_a [Mus musculus]  clstr ali  10  490.RRYLRIHKKTHTGEKPYECNQCGKAFAYHRTLQIHKRKHTGEKPYECNQCGKAFAYHKTLQI--------HERTHTGEKLYQCNQCGKAFAYHRTLRIHKRTHTGEKLYECNQCGKAFACLGNLQKHKTTHTGEKPYECNQCGKA-FKQYVHLQCHQR-IHTGEKPYECKQCGKAFTC------HSSLQIHKRTHTGEKPYE-----CNQCGKAFAGHSNLQRHKREKLYECKQCGKAFTCHSYLKIHERR-HTGEKPYEC-------KQCGKAFACYKSFQIHKRTHTGEKPYECNQCGKAFACRRYLQIHKRTHTGEKPYECKQCGKAFAYHRTLQVHKRTHTGEKPYECNQCGKAFACHRYLQMHIRTHTGEKPYECNQCGRAFTQFVHLQCHEITHTEEKPYECN......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 873
239 0.000e+00gi|344307373|ref|XP_003422356.1| PREDICTED: zinc finger protein 208 [Loxodonta africana]  clstr ali  10  114......................................................................................................................................................................................FNQHTYLSQHPRCHPTEKPYKCKPYECKQCGKAFSRDSQLSLHQREKPYACKECGRAFTQSSQLILHH-RIHTGEKPYKCEECGYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRIHTGEKPYQCKECGKAFICGSQLSQHQKIHNGEKPYECNECGKAFIRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQLTQHLRIHTNEKPYECKECGKTFSHGSQLTQHQRIHTGEKPYQCKECGKAFNR-GSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 472
240 0.000e+00gi|350585141|ref|XP_003127140.3| PREDICTED: zinc finger protein 568 [Sus scrofa]  clstr ali  11  176.................YKCDSLDKGFEHTLDLLSYEKSCIREGNYECNKYRKPFYHCST---HVVTS-------------FKCAQCGQDFSHKFDLIRHERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKA-FIQMSNLIRHQR-IHTGEKPYACKDCWKAFSQ------KSNLIEHERIHTGEKPYE-----CRECGKAFSQKQNLIEHEKEKPYACNECGRAFSRMSSVNLH-MRSHTGEKPYKCN-------KCGKAFSQCSVFIIHMRSHTGEKPYVCSECGKAFSQSSSLTVHMRNHTAEKPYECNECGKAFSRKENLITHQKIHTGEKPYECNECGKAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFSQRQNLLEHEKIHTGEKPFKCNECGKAFSRISSL-TLHVRSHTGEKPYECNKCGKAFSQCSLLIIHMRSHTGEKPFECN.................................................................................................................................................................................................................................................................................................................................................................................... 619
241 0.000e+00gi|327287806|ref|XP_003228619.1| PREDICTED: zinc finger protein 197-like [Anolis carolinensis]  clstr ali  10  415....................TESSKPFGHNGGLPRHQQTHAREMLYKCNVSGQYFTQKSHLKADYKLPHLSQQEIFEGTEDFISQEYGKSFIQSSHLGKHEKFRTGEKPHQCQECEKYFASNSDLVKHKRLHTGEKPYQCQECG-KCFSDSSALVSHKR-LHTGEKPYQCQECEKCFA------DSSGLVRHKRIHTGEKPY-----QCQECGKCFTSSSNMVSHKREKPYQCQECGKCFTDSSALVSHK-RLHTREKPYQCQE-------CGKCFTNSSALVNHKRLHTGEKPFQCQECGKCFADSSALVKHKRLHTGEKPYQCQECGKCFADSSALVSHKRLHTGEKPYQCQECGNWFARSSQLVRHKRHHTGEKPYQCQECGKCFARSSNLGRHKRLHSGEKPYQCQECGKCFNQRSSLVSHQRIHRGEKPYQCQECGKCFVRNSHLVRHKI-LHTGEKPYQCQECGKCFARSSDLVRHKNLHTGEKPYQC..................................................................................................................................................................................................................................................................................................................................................................................... 919
242 0.000e+00gi|338716352|ref|XP_003363445.1| PREDICTED: zinc finger protein 717-like [Equus caballus]  clstr ali  11  814..............................SALIAQERRHVGEDRDRCNEWGKTVCEKTQLSLHRADFKEQHHK-------Y--NQSGNNFSKNLQFTQLQRIQLGEKTFQCNVCGKTFYKKSNLTKHQKIHTGEKPYKCSECE-KTFISKTVLTIHQRT-HTGEKPYACDECDKSFCH------KSHLTVHQRIHTGEKPYE-----CYECGKSFFVKTKLTVHLREKPYECKECGKTFYEKSALTVHQ-RTHTGEKLHECQECPYECKECWKSFCRRSALTVHQRTHTGEKPYECNQCGKTFCQKSHLSKHLRTHTGEKSFQCNVCGKTFYKKSNLTKHQRTHTGEKPYACDECGKSFYQKSALTAHQRTHTGEKPYECKECGKSFGHRPALTVHQRTHTRDKPYKCNECGKSFCVKPKLTVHLRLHTGEKPYECEECGKTFYQKSKLTVHQRT-HTGEKPYKCSECRKTFCEKSTLNRHQRTHTGEKPYGCK.................................................................................................................................................................................................................................................................................................................................................................................... 1335
244 0.000e+00gi|334327333|ref|XP_003340872.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  131................................................................................................................................................................................................RRMHTGETPYE-----CKQCGKTFTQNSCLAVHQREKLYEYQQCGKTFTHTSSLAIYQ-RIHSEEKPYECKE-------CGKTFKQKFHLVQHQRLHTGEKPYECKQCGKTFNQRSHLAVHQRMHTGEKPYECMQCGKTFKQMSHVAVHQRIHTGEKPFECKQCGKTFNRRSNLAVHQRMHTGEKPYECKQCGKTFKLRSHLDVHQRMHTGEKPYECNQCGKTVTRISSLATHLRIHSGEKPYECKQCGRTFTCTSNLSRHQK-MHTGEKPYECKQCGKTFTCTSSLLVHQRMHTGEKPFKCNQCGKTFTRISSLAVHQRIHTGEKPYKCKQCGKAFNQKSYLAKHQRIHTKEKP................................................................................................................................................................................................................................................................................................................................ 475
245 0.000e+00gi|334313536|ref|XP_003339918.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  10  239......................................................................VHQRIHSGEKPYECKQCGKTFSQISHLIVHHGNHTGEKPYACKQCGKTFRLSFSLVVHQRIHTGEKPYECKHCG-KTFNQSSHLARHQK-IHTGEKPYECKQCGKTFRLS------SRLAVHQRIHTGEKPYE-----CKQCGKPFRNSSSLGRHQKEKPYECKQCGKTFSRSYNLAQHQ-RIHTGEKPYEC-------KQCGKTFRVSSSLSQHLNIHTGEKPFECKQCGKAFSQRSHLHNHQSIHTGKKPYECKQCGKKFSQRSQVHNHQSIHTGKKPHECKECGKTFRVSSTLAEHQRIHSGEKPYECKQCGKTFRNSSSLGRHQRIHTGEKPYECKQCGKTFSRSCNLGIHQRIHTGEKPYECKQCGKAFRGSSSFAIHQR-IHTGGEIHECKQCGKTFSRSCSLVIHQRIHTGEKPYECKQCGKAFSQSSSLAKHQRVHSGEKPYECKECGKTFRSRPSLAYHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 697
246 0.000e+00gi|377837229|ref|XP_003689254.1| PREDICTED: zinc finger protein 845-like [Mus musculus]  clstr ali  11  209................PYKCSEFYKYLIQREKLQSQQRIYHGKKPYKSSKSDKCFTHQIHLSI--------HQGIYTEEKIYKCSECDKCFKHKFNLTMHQRIHTGEKPYKCSECGKCFTEKSSLRIHQRIHTGEKPYKCSECD-KCFTKQSHLSIHQR-IHTGEKPYKCSECDKCFT------KQSHLSIHQRIHTGEKPYK-----CTECGKCFTEKSSLRIHQREKPYKCTECDKCFTEKGSLRIHQ-RIHTGEKPYKCSE-------CDKCFTEKGSLRIHQRIHTGEKPYKCSECDKCFSGKGSLRMHQRIHTGEKPYKCSECDKCFTKQSHLNIHQRIHTGEKPYKCSECEKCFNEKNSLKIHQRIHTGERPYKCSECDKCFSRKFHLGIHQKIHTGKKPYKCSECDECFTQKSFLNIHQSIHAGEKPYKCSECDKCFTQKSFLNIHQR-IHAGEKPYKCSECDKCFTTKGNLIIHQRFHTREKPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 661
247 0.000e+00gi|334325092|ref|XP_001376235.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  12  562VRGNLIAHQRTHTGEKPFTCNECGKAFSGRGYFITHQRTHTGEKPFPCNECGKAFSERGSLTR--------HQRIHTGEKTFTCSECGKAFNQRASLITHHRTHTGEKPFSCNDCGKAFRRRRNLITHQRSHTGDKPFVCSECGKA-FSERGHLITHQRT-HTGEKPFECNDCGKAFSE------KGSLNRHHRTHTGEKPF-----ACKECGKAFSGRANLIRHEREKPFTCD-CGKAFSGRANLVRHQ-RSHTGERPFACNE-------CGIAFSRKANLMSHQRIHTVEQPLERKEQGKAFINREVIKNCQRIKANQKPFECNECRKAFRERKHLIIHQRIHSGVKHFD................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 887
248 0.000e+00gi|334328907|ref|XP_001376193.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  12  278...........................................................................................................................................................................VCGKAFSQN------SSLTQHFRIHTGEKPYK-----CKDCGKAFRQNSHLVRHQREKPYECQECGKAFSQSSDIIYHGRRIHSGKKPFEC-------KDCGAAFSWHSNLLEHQRTHTGEKPYECKVCRKAFSQSSSLTQHFRIHTGEKPYKCKDCGKAFRQNSHLIRHQLIHTREKPYECKECGKAFSQSSDIIKHERIHSGKKPYECKECGAAFSWRSYLIQHQRTHTVEKPYECKECGKAFSQSSSLIQHHRIHTGEKPYECKECGKAFSQRSSLIQHHR-IHTGEKPYKCKDCGAVFSGHSGLIQHERIHTGEKPYECKECGKAFRQSSA......................................................................................................................................................................................................................................................................................................................................................................... 597
249 0.000e+00gi|297276613|ref|XP_002801202.1| PREDICTED: zinc finger protein 85-like [Macaca mulatta]  clstr ali  13  291...........................................................................................................KIFQCDKYVKVIHKFSNSNRHRIRHTKKKPFKCRDCG-KSFRMISCLTQHSR-IHTRVNSYKCEECGKTFNWS------STLTKHKRIHTGEKPYK-----CEECGKAFNQSSNLIKHKKEKPYKCEECGKAFNRSSTLTTHKI-IHTGEKPYKCKE-------CGKAFNRSSTLTSHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHKIIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTAEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECGKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKK-IHTEEKPYKCEECGKGFKWPSTLTIHKVIHTGEKPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 660
250 0.000e+00gi|334324890|ref|XP_001374319.2| PREDICTED: zinc finger protein 135-like [Monodelphis domestica]  clstr ali  11  465.RRSIIEHQRVHTGEKPYECGQCGKAFRSRRSIIEHQSIHTGEKPYECDQCGKAFTQKSGLFI--------HQRIHTGEKPYGCNQCGKAFTHKSVLTKHQRIHTGEKPFECNLCGKAFIQRGELTVHQRIHTGEKPFECNLCGKA-FIQKGKLTVHQR-IHTGEKPYECNQCGKAFIQ------RASLTVHQKIHTGEKPFK-----CNQCGKAFIQKATLTAHQREKPFKCNQCGKAFIQKAYLTVHQ-RIHTGEKPYQCN-------LCGKAFIRRHRLTVHQRIHTGEKPYECNQCGKAFTQKSGLTIHQRSHTREKPYECNQCGKAFIQRASLTVHQRIHTGEKPFECNQCGKGFIQKCGLTVHKRIHSGEKPFECNQCGKAFTQKAGLTVHQKIHTREKSYT........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 855
251 0.000e+00gi|334349670|ref|XP_001368486.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  114...........................................................................................TWRENLDVHQKIDTGGKPYECNQCGKAFSQKSTLTVHQRIHTGETPYICNQCGKA-FRSRNSLVTHQRRIHTGEKPFECNQCGKAFRCGKAFSQKSGLTEHQRIHTGEKPYE-----CNQCGKAFRSRNSMVKHQRQKPFKCNQCGKAFIHKSTLTVHQ-RIHTGEKPFECNQCGKACNQCGKAFSQKSGLTEHQRIHTGEKPYECNQCGKAFIQRNRLIVHQRMHTGEKPFECSLCGKAFTEKSGLTAHQRIHTGEKPYECNQCGKAFIWRNKLTIHQRIHTGEKPFECNQCGKAFIQKTKLTVHQRIHTGEKPFECNQCGKAFSQKSGLTVHQRIHTGEKPYECNQCGKAFIWR-NKLTIHQRIHTGEKPFECNQCGKAFTQKARLTVHQKIHTGGKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 584
252 0.000e+00gi|334329018|ref|XP_003341165.1| PREDICTED: zinc finger protein 729-like [Monodelphis domestica]  clstr ali  12  2...................................................................................................................................YTGEKFYKCPQC-RKAFNKSSKLILHQR-IHVGENPCECNDCGKVFHH------RSKLKIHRRAHTRKNPY-----QCNDCGKMFINDSKLILHQREKPFKCNDCGKVFSHRSKLIIHQ-RIHTGEKPFKCHD-------CGNAFNQSSTLLQHQRIHTGEKPFQCNDCGKAFNQNSHLLQHQRIHTGEKQFQCNDCGKAFNRSSHLFQHQRIHTGEKPFKCDDCGKAFNWISSLRKHQRIHTGEKPFQCNDCGKTFNQNSNLSLHQRIHTSERPFQCNDCGKAFIRSSTLLQHQRIHTGEKPFQCHDCGKAFNRSSHLFQHQR-IHTGEKPFKCDDCGKAFNQNSNLRKHQRIHTGEKPFKCS.................................................................................................................................................................................................................................................................................................................................................................................... 347
253 0.000e+00gi|291394029|ref|XP_002713240.1| PREDICTED: zinc finger protein 717-like [Oryctolagus cuniculus]  clstr ali  10  125.......................................HAGEKPN-------AYSITGKLH-GYPEHHSQHQKIQTLKQTFEHRE-GKVFNRDTISFTHKRAHMGVTLSKCNEDRNAYSKSSALFK-QQTYTEEKTSECTEYEE-LFISKSDLTVSERT-HTGKKPYACNLYEKSFSC------KTKLGIHHRIHTGGKP-----HGCNKCGKTFFQKSHLIIHKGEKLCECNEFGKT-CQRSHLNKHQ-RTHTREKPFKCNE-------CGKIFSQKSVLSVHQRIHTGEKPFGCNDCGKTFGQKSHLSVHQRTHTGEKPFECNECGKTFAQKSVLTVHQRTHTGEKPYECSECGKTFCQKSVLTIHLRTHTGEKPYECCECGKTFCRKSKLSMHQRIHTGEKPYVCNQCGKTFYHKSVLSMHQRTHKREKPYECNECGKTFYQKSDLMIHQR-IHTGEKPYECKECGKIFCQKSHLIKHQRIHTGEKPFECSECGKTFSRKSSLRMHQRTHTGEKPYKCIECRKTFSHKSGLTIHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 620
254 0.000e+00gi|149026508|gb|EDL82658.1| rCG53336 [Rattus norvegicus]  clstr ali  11  77.........................................GSKPYIFKECGKTFPWNSLLIQHH--------KIHPGAKLYTCDECGKSFNVRSTLYKHHRTHTGEKPYKCKECGKAFTCSSSLNQHHRIHTGEKPYKC-ECGKA-FNNSSALTQHQR-IHTGERPYKCDECGKAFNCGKTFNFPTSLSQHQRIHTGEKPYK-----CEECGKAFNNCSALTQHQREKPYKCEECGKAFYNCSALSRHQ-KIHTGEKPYKC-------ADCGKAFIFRSSLSQHQRIHTGEKPYKCKECGKAFNCSSHLNQHGRIHSGEKPYKCEECGKAFSCSSYLKYHQRFHTGGKSYTCKECDKTFRSSSYLRNHQRFHTGEKPYTCKECGKAFVNSSSLLVHQRIHTGEKPYKCKECGKAFRCSSYFKYHQRLHTGEKPYTCKECGKAFAKSSCLILHQR-IHTGEKPYKCAECGQAFICSSYLRKHQRIHTGEKPYTCE.................................................................................................................................................................................................................................................................................................................................................................................... 559
255 0.000e+00gi|332855053|ref|XP_003316342.1| PREDICTED: zinc finger protein 420 [Pan troglodytes]  clstr ali  120...............................................................................................................................................................................................................................................FNQHTYLSQH-SKCHSTEKPYKCKE-------CGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRIHTGEKPYECKECGKAFIC-GSQLSQHQKIHNGEKPYECKECGKAFIRGSLLMQHQRIHTGEKPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 366
256 0.000e+00gi|281341409|gb|EFB16993.1| hypothetical protein PANDA_011049 [Ailuropoda melanoleuca]  clstr ali  11  332........................KVPRQSSVFSENQTVNNPEKSFECTECGKPFSPSRALSRR--------QRSHPGEKPYECNECGKTSRCCSVLSQHQRVHCGEKSHTCAECGKAFRAHSYFIQHHNTHTGERPYECSECG-KTFSARSSYSQHVK-IHTGQKPHECNQCGKAFSH------TSNLIHHQRIHSREKLYK-----CKECGKAFSRHSHLLQHEREKPYNCTECRKAFSARLSLIQHQ-RTHTGEKPYECSE-------CGKSFSLNRTLTVHQRIHTGEKPYRCNECGKSFSQRSQVIQHKRIHTGEKPYVCNECGKSFSARLSLIQHQRIHTGEKPYGCSECGKTFSQKGHLIQHQRIHTGEKPYECNECGKAFSQSFNLIHHQRTHNGEKPYECNECDKAFSVLSSLVQHQRVHNGEKPYECHKCGKAFSQGSHLIQHQRS-HTGEKPYECTECGKTFGQISTLIKHERTHNGEKPYAC..................................................................................................................................................................................................................................................................................................................................................................................... 780
257 0.000e+00gi|334327297|ref|XP_003340857.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  317..................................................................................................................................................................................................................................................................................AFTLRSSLAAHQRIHTGEKPYLCKHCGKAFTQRGNLAAHQRIHTGEKPYECQHCEKAFTQRSNLDAHERVHTGEKPYECQHCEKAFTRKISLAAHERIHTGEKPYECQHCGKTFAGKVSLTAHERIHTGEKPYECQHCGKAFRWKVSLTAHERIHTGEKPYECQHCGKTFTKRNNLTTHERT-HTGEKPYECKQCGKAFTQRGNLAAHQRIHPGEKSYECKQCGKTLTTM........................................................................................................................................................................................................................................................................................................................................................................... 545
258 0.000e+00gi|359318773|ref|XP_541480.4| PREDICTED: zinc finger protein 420 [Canis lupus familiaris]  clstr ali  10  91.................................................................................................................................................................................................................................................................KPFNCTE-------CGKAFIYHSDYILHQRIHTGEKPYKCNDCGKAFSNSSYFIQHHIIHTGEKPYVCSECGKTFTQNSSLTEHQRIHTGEKPYKCKECGKAFTQSSSLIKHQRCHTGEKPYKCNQCGKFYSQVSHLSRHQKIHTGEKPYKCGECGKAFCHTSSLTQHQTIHTGEKPYKCNECGKTFSHSSSLSQHQR-VHTGEKPYECSECGKAFSHSSSLTQHQRIHTGEKPYECNECGKAYTQISHLMRHQSIHTGEKPYKCNECGKTFSQNSSLTRHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 372
259 0.000e+00gi|148700671|gb|EDL32618.1| zinc finger protein 184 (Kruppel-like), isoform CRA_a [Mus musculus]  clstr ali  120.................................................................................................................................................................................................................................KKEKLCKCNECGKAFTYCSALIRHQ-RTHTGEKPYKCNE-------CNKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIHTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCTECGKSFSQRGHFMEHQKIHTGEKPFKCEECEKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKT-HTGEKPYDCAECGKAFSYWSSLAQHLKIHTGEKPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 380
260 0.000e+00gi|301788642|ref|XP_002929738.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 227-like [Ailuropoda melanoleuca]  clstr ali  305........................................................................QQIHMRNNQHVCE----AFMKKSPLSDHINTDTEQKPYKFNKCGK--SMSDGLNHH--VPPGEEFHPCRECG-KGVSYSSVLPLHQ-NVHTREKC---------------SSQSSHLQTHQRIRPREK-----LNKCHESGDCFSKSSHQLNHTGEKAYRCDSCGKGFSSSTGLIIHY-RTHTGEKPYKCEE-------CGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHYHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQR-VHTGEKPYKCDVCGKDFSYSSNLKLHQVIHTGEKPYKCE.................................................................................................................................................................................................................................................................................................................................................................................... 689
261 0.000e+00gi|359318700|ref|XP_003638890.1| PREDICTED: zinc finger protein 569-like [Canis lupus familiaris]  clstr ali  10  184.KSNLIDHEKIHTGEKPYECNECGKAFSQKQSLTAHQKVHTGEKPYACNECGKAFPRIASLAL--------HMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGEKPYECNECGKSFSQSSALTVHMRSHTGEKPYECKEC-RKAFSHKKNFITHQK-IHTREKPYECNECGKAFIQ------MSNLVRHQRIHTGEKPY-----ICKECGKAFSQKSNLIAHEKEKPYECNECGKAFSQKQNFITHQ-KVHTGEKPYDCNE-------CGKAFSQIASLTLHMRSHTGEKPYVCNECGKAFSQRLSLIVHMRGHTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKPYHCNECGKAFSQKSHLVRHQRIHT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 559
262 0.000e+00gi|358417009|ref|XP_002702020.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91, partial [Bos taurus]  clstr ali  11  268.......................................................................................................................................RPYKCNECDI-TFLQDSELTRHQR-IHTGGKPYKCDVCGKAFNQTRK------LAIHWRIHTGEKP-----HKCDVCGKVFKQAAHWRYHMREKPYKCDVCGKAFSQTANLAVHQ-RIHTGEKPYKCNV-------CGKAFNHSANLAVHQRVHTGEKPYKCDVCGKAFNQTAKLGLHQKIHTGEKSYKCDVCGKAFSRTGNLAVHRRVHTGEKPYKCDICGKAFRVTSHLADHRRVHTGEKPYKCNVCDKAFSRAANLTVHWRIHTGEKPYKCDVCGKAFNHTTRLQLHQRIHTGEKPYKCNVCERAFSHTSSLSV-HRRLHTGVKPYKCDICGRAFSQTASLALHRSIHTGEKPYKC..................................................................................................................................................................................................................................................................................................................................................................................... 608
263 0.000e+00gi|344307384|ref|XP_003422361.1| PREDICTED: zinc finger protein 567 [Loxodonta africana]  clstr ali  10  275...........................................................................................................................................................................................................EKKHMCTECGKSFCRKSVLILHQGEKPYQCHHCGNAFRRKSYLIDHQ-RTHTGEKPFVCNE-------CGKSFRLKTALTDHQRTHTGEKSYECSECRNAFRLKSHLIRHQRTHTGEKPYECNECGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKPYICNECGKSFSQKTTLALHEKTHNEEKPYICNECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKSYLIDHHRT-HTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICSECGKSFRQKATLTVHQKIHTGQKSYECSQCGKAFSRKSYLIHHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 613
264 0.000e+00gi|334327411|ref|XP_003340898.1| PREDICTED: zinc finger protein 546-like [Monodelphis domestica]  clstr ali  10  473..................................................................................................................................................................................................................................KEKSHECNGCDKAVSQGTHLTRH-RKIRTGEKPYECSE-------CGKAFNQKRDLAQHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQKRDLAQHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQKRDLAQHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQKRDLAQHQR-IHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKSFTWRAYLTRHQRVHTGEKPFKCNECGKAFVQKKGLTRHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 784
265 0.000e+00gi|334314294|ref|XP_001364077.2| PREDICTED: zinc finger and SCAN domain-containing protein 2-like [Monodelphis domestica]  clstr ali  16  570..SVLIIHQRIHTGERPYKCPECGKGFSNSSNFITHQRTHIGENPNTCSECGKNFSQSSHLAVHRSSHLICHQRIHTGEKPYKCPECRKGFSDHSNLTAHQRIHTGEKPYKCSECWKSFNQSSSLIMHQRIHTGEKPHKCSECG-KSFTNSSHFNAHWRT-HTGEKPYQCPECGKRFSCGKSFSDRSNLITHRRIHTGERPYK-----CGECGKSFNQSSSLIIHQREKPYECNECGRRFNNSSHFSAH-RRTHVGEKH................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 865
266 0.000e+00gi|4567179|gb|AAD23607.1|AC007228_2 BC37295_1 [Homo sapiens]  clstr ali  11  150.SAHLAQHQRIHTGEKPFECTECGKAFSQNAHLVQHQRVHTGEKPYQCKQCNKAFSQLAHLA--------QHQRVHTGEKPYECIECGKAFSDCSSLAHHRRIHTGKRPYECIDCGKAFRQNASLIRHRRYHTGEKPFDCIDCGKA-FTDHIGLIQHKRT-HTGERPYKCNVCGKAFSHG------SSLTVHQRIHTGEKPYE-----CNICEKAFSHRGSLTLHQREKPYECKECGKAFRQSTHLA-HHQRIHTGEKPYECKE-------CSKTFSQNAHLAQHQKIHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRLHSGKRPYECLECGKAFRQRASLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFSQVAHLTLHKRIHTGERPYECKECGKAFRQSVHLA-HHQRIHTGE...................................................................................................................................................................................................................................................................................................................................................................................................................... 584
267 0.000e+00gi|297271429|ref|XP_002800252.1| PREDICTED: zinc finger protein 658-like isoform 1 [Macaca mulatta]  clstr ali  11  297............TVEKSCKDDEFRKNF-DKTTLFNDMRTDTR---------GKC----SDLNEYGTSCDKTHMMTH-----YECNERGINFSRKSPLTQSQRTITGRSAFESNKCEENFRQSSAHIVHQKTQTGDKDY--NECCRKSFYQKGHLIQHQRP-HSGEKPYECNECGKAFCQNSNLSKHSHLKGHQRILMGEKPYE-----CIECGKTFSKTSHLRAHQREKPYECVECEKTFSHKTHLSVHQ-RVHTGEKPYECND-------CGKSFTYNSALRAHQRIHTGEKPYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTGEKPYECNECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYECNECEKTFAHNSALRAHQNIHTGEKLYECNECGKTFFQKTRL-STHRRIHTGEKPYECSKCGKTFSQKSYLSGHERIHTGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 860
268 0.000e+00gi|334328914|ref|XP_003341147.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  15  518LKNGLTAHQRIHTGEKPYECKQCGKAFMWSGHFARHRTVHSGEKPYECKECGKAFTQRGSLAK--------HQRIHTGEKPYECKQCGKAFRMRICFAAHQRIHTGERPYECKQCGKLFRGRSSLAVHQRIHTGEKPYECKECGRA-FTRRDSLAAHQR-IHTGEKPYECKQCGKAFTQ------RGSLGAHQRIHTGEKPYE-----CKHCGKTFTERGSLAAHQREKPYKCTQCGKAFTWRSDLAKHQS-IHIGEKIYEC............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 761
269 0.000e+00gi|291410773|ref|XP_002721685.1| PREDICTED: zinc finger protein 347 [Oryctolagus cuniculus]  clstr ali  255.................................................................................................................................................................................................................................KKEKSIKCNECGKAFSYCSALIRHQ-RTHTGEKPYKCNE-------CEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIHTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNDCGKAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKT-HTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCN.................................................................................................................................................................................................................................................................................................................................................................................... 515
270 0.000e+00gi|338710060|ref|XP_001494044.3| PREDICTED: zinc finger protein 850 [Equus caballus]  clstr ali  11  260........................................................................................................................................................................KCNDCEKVFSQS------SSLTLHQRIHTGEKPYK-----CVDCGKAFSQRSNLVQHQREKPYECKECRKAFSQNAHLVQH-LRVHTGEKPYEC-------KVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYECNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQECRKAFSQIAYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTQHQRVHTGEKPYECNVCGKAFSYCGSLAQHQR-IHTGERPYECKECKKTFRQHAHLAHHQRIHLGDRPSVCAQCGKGFIQELDLIRHLRVHTAEKPYECYECGKAFSRKENLSSHQKIHTGEKP................................................................................................................................................................................................................................................................................................................................ 622
271 0.000e+00gi|73956084|ref|XP_546639.2| PREDICTED: zinc finger protein 624 [Canis lupus familiaris]  clstr ali  16  576IKSHLTVHQRIHTGEKPYKCTDCERAFTKMSYLIVHQRTHTGEKPYKCNECERAFTNTSQLT--------VHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKCNDCGKAFSQMVHVTEHQKIHSGEKPYKCDVCGKA-FRRGSYLTVHWRT-HTGEKPYTCKECGK------GCITLSQLTLHQRIHTGERPYK-----CEECGKAFRTNSDFTVHLREKPYKCNECGKAFRSSSSLTVHQ-RIHQRE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 814
272 0.000e+00gi|123256853|emb|CAM19749.1| novel KRAB box containing protein [Mus musculus]  clstr ali  11  145........QGIHMQKKKHNRNEFEKVFVSK-HKVMVKRNNTGVNPYKCSEFDKYLTQREKLQSQ--------QRIYHGKKPYKSSKSDKCFTHQIHLSIHQGIHAEEKIYKCSECDKCFTHKSHLNIHQRIHTGENPYKCSECD-KCFKHKFSFSMHQR-IHTGEKPYKCSECDKCFNE------KGSLRIHQRIHTGENPYK-----CSECDKCFTHKSHLNSHQREKPYKCSECDKCFTKNGSLRIHQ-RIHTGENPYKCSE-------CDKCFTQKSDLNIHQRIHTGEKPYKCSECDKCFTHKSHLNSHQRIHTGEKPYKCSECDKCFTRKFHLSIHQRIHTGENPYKCSECDKCFTQKSDLNIHQRIHTGEKPYKCSECDKCFTHKSHLNSHQRIHTGEKPYKCSECDKCFTRKFHLSIHQRIHTGEKPYKCSECDKCFTRKFHLSIHQR-IHTGENPYKCSECDKCFTRKFHLSIHQRIHTGEKPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 605
273 0.000e+00gi|348551817|ref|XP_003461725.1| PREDICTED: zinc finger protein 850-like [Cavia porcellus]  clstr ali  12  383........................................................................QKMHPGRKP-----CGKDFWQEEFLMDHQGVHTNEKPYKCKECGKAFRYGSRLIQHENIHSGKKPYECKECGKA-FNSGSNFIQHQR-VHTGEKPYECKDCTKAFS------RSSQLIEHQRIHTGEKPY-----QCKECSKAFNRISHLKVHYREKPYSCKECGKTFSHRSQLIQHQT-VHTGKKLYECKE-------CGKAFNQRSTLIRHQRIHTGEKPYTCQVCGKTFRVSSQLKQHQRIHTGEKPYQCKVCGRAFTRVSHLSVHCRIHTGEKPYECRECGKAFRTHSSLTVHQRIHTGEKPYKCNDCGKAFSDGSSFARHQRCHTGKKPYECVECGKAFIQNTSLVRHWRYHTGEKPFDCIDCGKAFSDHIGL-SQHRRIHTGEKPYKCDVCHKSFRYGSSLTVHQRIHTGEKPYEC..................................................................................................................................................................................................................................................................................................................................................................................... 787
274 0.000e+00gi|123232535|emb|CAM21132.1| novel KRAB box and zinc finger, C2H2 type domain containing protein [Mus musculus]  clstr ali  10  56..........................FQTSRSHGRHERSCTAVKPSEFIQCGKAFAYQS--------LRQRHERTHKGEKDYYCNQCGKAFIISSHLQIHKRRNTGEKPYECNQCCKTCTVRSDLQIHKQTHTGEKPYECNQCGKA-FAGSGDFQKHKRRQ-RGEKPYECNQCGKTFA------VRSDLRIHKRTHTGEKPYE-----CKQCSKAFIRRGDLQIHKREKPYECNQCGKAFIRSADLQIHK-RTHTGEQPYECN-------QCGKAFIRSGDLQIHKRIHTGEKPYECKQCGKAFTKSSNLQIHERTHTGEKPYECKQCGKAFIRSGDLQIHKRTHTGEKPYECNQCGKAFIRSGDLQIHKRTHTGEKPYECKQCGKAFTKSSNLQIHERTHTGEKPYECKQCGKAFTKSSNLQIHERTHTGEKPYECKQCGKAFIRSGDLQIHKRT-HTGEQPYECNQCGKAFIRSGDLQIHKRTHTGEKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 498
275 0.000e+00gi|334326907|ref|XP_001377951.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  122................................................................................................................................................................................................QRKHTEEKCSES-----NDCRKTLMHSTSLKIHNGERPYECKQ-----------------IHTGVKTYEC-------KQCGKTFTMNYNLAVHQRIHTGEKPYECKQCGKTFTNKSYVAVHQRIHTGEKPYECKQCGKTFKMKSTLAVHQRIHTGEKPYECKQCGKIFKMKSSLAVHQRIHTGEKLSECKQCGKIFHQSSDLAIHQRIHTGEKPYECKQCGKTFSRNSTLA---RIHTGEKPYECKQCGKTFRWSSDLAIHQR-IHTGEKPYECTQCGKTFRQRSDLAIHQRMHTWEKPYECKQCGKTFGQSST......................................................................................................................................................................................................................................................................................................................................................................... 406
276 0.000e+00gi|334313167|ref|XP_001369108.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  213............................................................................VGENCHKCDMCKKNFKENSGLIKHKRTCSGKKRFECNECDKAFSQRAHLIQHQRIHTGERPYECNECGKA-FRRTIDLTQHQR-IHTGEKPYECNQCERAFSQ------RAHLIQHQRIHTGERPYE-----CSECSKAFSWSTHLTEHQKEKPYECNECGKAFRKSTDLNRHQ-RIHTGEKPYECSE-------CEKAFSQRAHLTQHQRIHTGEKPYECNECGKTFRWSTHLTQHQRIHTGEKPYECNKCGKTFRRSTELTQHQRIHTGEKPYKCSECEKAFSCRTHLIHHKSTHSGEKPYGCNECGKTFNRSSSLTQHQRIHTGEKRYKCNECGKAFSRSTFLTQHQSIHTGERHYKCNECSKAFSQRTHLVQHQR-IHTGERPYECNDCGKAFSQRSHLVQHQRNHTGEKPYDCN.................................................................................................................................................................................................................................................................................................................................................................................... 613
277 0.000e+00gi|296227010|ref|XP_002759206.1| PREDICTED: zinc finger protein 251-like [Callithrix jacchus]  clstr ali  11  482LNSHLRLHRRIHTGEKPFGCGECGKAFSRSSTLIQHRIIHTGEKPYKCNECGRAFSQSPQLT--------QHQRIHTGEKPHECSHCGKAFSRSSSLIQHERIHTGEKPHKCNQCGKAFSQSSSLFLHHRVHTGEKPYVCNECGRA-FGFNSHLTEHVR-IHTGEKPYVCNECGKAFS------RSSTLVQHRRVHTGEKPY-----QCIECGKAFSQSSQLTLHQREKPYECGACGKAFSRRSTLTQHQ-KIHSGESSFTPNGQIPTGEKQSRAFNHGANLILCWTIHTGEKSFGYNECGKAFSPTSQPTEDQKMHTEEKPYKCQECRKAFSGNSTHIQYQVTHTGGKPCHCSMCGKAFSQSSQLT-HQQTHAGEKP......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 854
278 0.000e+00gi|377835896|ref|XP_001478744.3| PREDICTED: zinc finger protein 709-like [Mus musculus]  clstr ali  10  143......................................................................................................................................................................................................DKPYE-----CNQCGKAFAQLNSLQRHKREKPYECNQCGKAFAQYRYLQYHK-RTHTGEKPYECN-------QCGKAFSQHSYLQHHERTHTGEKPYECNQCGKAFAQLNSLQCHKRTHTGEKPYECHQCGKAFAQLNSLQRHKRTHTGEKPYECNQCGKAFSQYGHLQYHKRTHTGEKPYECNQCGKAFAYLSSLQCHKRTHTGEKPYECNQCGKAFARHSHLQRHKRTHTGEKPYECHQCGKAFAQYRYLQYHKRT-HTGEKPYECNQCGKSFSQYSHLQHHERTHTGGKPYECNQCGKAFAQLNSLQRHKRPHTGEKPYECNQFGKAFSQYGHLQYHKRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 481
279 0.000e+00gi|194238244|ref|XP_001917682.1| PREDICTED: zinc finger protein 658-like, partial [Equus caballus]  clstr ali  11  97......KRQKTPTGEKS---NECNKNVKGLSYKKDHQKFQTLAQSFEYNEFGKCVTVTSSL---------------TGEESYKCEECGKSFIRNSPLIQPQRTITGQGASQSSKCEENLSQSSDLMIHQRTHTEENFYECGKYGKKFFYQKAHLIQHQRIC-SGDKTYECEECGRSFSYAKTFCQKSNLIEHQRTHTGEKPYE-----CIECGKTFSKTSHLRAHQREKPYECIECGKTFSHKTHLSAHQ-RTHTGEKPYECNE-------CGKTFADNSTLRAHQRTHTGEKPYDCNECGRSFAHISVLRAHLRIHTGEKPYECNDCGRSFAHNSALRAHQRIHTGEKPYECNECEKTFAHNSALRVHHRVHTGEKPYECNECEKTFAHNSALRAHQKIHTGEKLYECNECGKIFSQKTHLSTHRRIHTGEKPYECTACGKTFSQKS-YLSGHERIHKGEKPYECNECGKTFVYKAALIVHQRIHTGERPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 722
281 0.000e+00gi|334328857|ref|XP_003341132.1| PREDICTED: zinc finger protein 729-like [Monodelphis domestica]  clstr ali  11  108..........................................................................MYTGEKFYKCPQCRKAFNKSSKLILHQRIHVGENPYECNVCGKGFHHRSKLNIHRRAHTRKNPYQCNDCG-KMFINDSKLILHQR-IHIGEKPFKCNDCGKIFSH------RSRLIIHQRIHTGEKPFK-----CHDCGKAFIRSSTLLKHQREKPFKCDDCGKAFNQNSNLSVHQ-RIHTSERPFQCND-------CGKAFNRNSNLLQHQRIHTGEKPFQCHDCGKAFNWSSSLLQHQRIHTGEKPFKCHDCGKAFIKCSHLLQHQRIHTGEKPFKCDDCGKAFNQNSNLLQHQRIHTGEKPFQCHDCGKAFNWSSSLLQHQRIHTGEKPFQCHDCGKAFNWSSSLLQHQRIHTGEKPFKCHDCGKAFNKCSHLLQHQR-IHTGEKPFKCDDCGKAFIRSSTLLKHQRIHTGEKPFKCH.................................................................................................................................................................................................................................................................................................................................................................................... 510
282 0.000e+00gi|344299267|ref|XP_003421308.1| PREDICTED: zinc finger protein 84 [Loxodonta africana]  clstr ali  10  196.........................................................................................................................KSQIIIYHRTRLGEKLYECCEC-RKRFSKKSSLIKHQ-SRHVREIAYGCGNCGKTFPQ------KSQFVTHHRTHTGEKPY-----DCSQCGKAFSQKSQLTSHQREKPYECGECGKAFSRKSHLISH-WRTHTGEKPYECSE-------CGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKSQLITHQRTHTGTKPYGCGDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFVCSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQR-IHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECGECGKAFGEKSSLATHQRTHTGEKPYECSDCEKAFSQKSQLNTHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 603
283 0.000e+00gi|355703855|gb|EHH30346.1| hypothetical protein EGK_10990 [Macaca mulatta]  clstr ali  10  179.........................................................................................................................................................................................................FRGKPCECNEHGKVFSVSSSLANHQADNPYKCNECDKVFSNSSNLVQHQ-RIHTGEKPYKCHECGYKCNECGKVFTQNSHLANHHRIHTGEKPYKCNECGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFSGGSGLTAHLVIHTGEKLYKCNKCGKVFNRNAHLTRHQRIHTGEKPYECKECGKVFRHKFCLTNHHRTHTGEQPYKCNECGKVFSYNSHLARHQRIHTGEKPYECKECGKVFRHKFCLTNHHRT-HTGEQPYKCNECGKVFSYNSHLAQHQRIHTGEKPYKCS.................................................................................................................................................................................................................................................................................................................................................................................... 505
284 0.000e+00gi|335301086|ref|XP_003359118.1| PREDICTED: zinc finger protein 84-like [Sus scrofa]  clstr ali  10  94...........................................................................................REKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKA-FSRKSHLISHWRT-HTGEKPYGCSECGRAFSE------KSNLINHQRIHTGEKPFE-----CRECGKAFSRKSQLVTHQGEKPYECSECRKAFRERSSLINHQ-RTHTGEKPHGC-------IQCGKAFSQKSHLLSHQMTHTGEKPFVCSKCGKAFSRKSQLVRHQRTHTGEKPYECNECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECTECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYECGICQKAFFEKSELIRHQRT-HTGEKPYECSECRKAFREKSSLINHQRTHTGEKPFECSDCGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 531
285 0.000e+00gi|334349979|ref|XP_001381864.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  257VSSNLAVHQRIHTGEKPYECRLCGKTFSVSSSLSVHQRIHTGEKPYECKQCGKTFSVSSSLACHRRICKQCHQSIHTEDKPYECSQCEQTFRESSHLVHHQKIHTGEKPYECKQCGKTFSMSSRLTKHRRIHTGEKPYECKQCG-KTFRETSHLVYHQR-IHTGEKPYECKLCGKTF------GETSSLTKHQRIHTGEKPYE-----CKQCGKTFSVSSSLSVHQREKPYECKQCGKTFSVSSRLAGHQ-RVHTGEKPYEC-------KQCGKTFSVSSSLAIHQRIHTGEKPYECKQCGKTFSVSSSLTKHQRIHTGEKPYECKQCGKTFRETSHLVYHQRIHTGEKPYECKQCGKTFIVSYRLADHQRIHTGEKPYECKQCGKTFSVSSSLTKHQRIHTGEKPYECKQCGKTFRESSSLSVHQRIHTGEKPYECKQCGKTFSRSYRLTIHQRIHAVKKLKSICVEKQSQ........................................................................................................................................................................................................................................................................................................................................................................................................... 731
286 0.000e+00gi|334327668|ref|XP_001375524.2| PREDICTED: zinc finger protein 729-like [Monodelphis domestica]  clstr ali  14  915.RGSLAKHQKIHTGEKPYECKHCGKAFTQGGSLTRHQKIHTGEKPYECKLCGKAFMQSSNLTAHQKICKQCHQRIHTGEKPYECKQCGKAFTRSSSLATHQLIHTGEKPFVCKQCGKAFTYRGSLTRHQKIHTGEKPYECKQCGKA-FPERGYLTKHQR-IHTGEKPFVCKQCGKAFTF------IGSLAKHRRIHTGENPHETKTYECKQCGKAFTFIGSLAKHRREKPYECKRCGKAFTQRSHLARHQL-IHTGEKPHEC-------RHCGKSFKEKGSLVVHHRIHSGIKP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1238
287 0.000e+00gi|119624924|gb|EAX04519.1| zinc finger protein 624 [Homo sapiens]  clstr ali  14  687IKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYL--------IVHQRTHTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKCNDCGKA-FSQMVHVTEHQK-IHSGEKPYKCDVCGKAFR------RGSYLTVHWRTHTGEKPY-----TCKECGKGCITLSQLTLHQRERPYKCEECGKAFRTNSDFTVH-LRMHTGEKPYKCNE-------CGKAFRSSSSLTVHQRIH.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 950
289 0.000e+00gi|334325100|ref|XP_003340603.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica]  clstr ali  12  183............................................................................................................................LVAHQRIHTGGKPYECNQCG-KTFEKRAYLTVHQR-IHTGQKPFECNLCGKAFI------RRASLTVHQRIHTREKPFE-----CNQCGKTFRGRDGLILHQREKPFECNQCGKAFIRRARLTVHQ-RIHTGEKPFECN-------QCGKTFRGRDGLILHQRIHTGEKPFECNLCGKAFIRRASLTVHQRIHTGEKPHECNQCGKAFRCRKRLVAHQRIHTGGKPYECNQCGKAFTHRSTLTGHQRIHTGEKPYECNQCGKAFRCRKRLVAHQRIHTGGKPYECNQCGKTFEKRASLTVHQRIHSGEKPYECNQCGRTF-EKRAYLTLHERIHTGQKPFECNLCGKAFIWRNSFTEHQRIHTGGKPYECNQCGKTFTQRSS......................................................................................................................................................................................................................................................................................................................................................................... 546
290 0.000e+00gi|326667171|ref|XP_003198510.1| PREDICTED: zinc finger protein 850-like [Danio rerio]  clstr ali  11  65......................................................................................................................................................................CFICTQCGKSLSCKNK------LKIHMMIHTGEKPF-----TCTQCGKSFSQLSSLNLHMREKPYTCTQCGKSYSQLSSLNLH-MRIHTGEKPFTCTEKPFTCTQCGKSFSLSSNLNKHMKIHTGEKPFTCPQCGKSFSQSSHLNKHMRIHTGEKPFTCPQCGKSFSQSSHLNKHMRIHTGEKPYTCPQCGKSFSQSSYLNKHMRIHTGEKPFTSNQCGKNFYCSSNLNQHMRIHTGEKLFTCTQCGKSFSNSTNLNQHMRIHTGEKPFTCTQCGKSFSQSSNL-NHHMRIHTGEKPFTCSQCGKSFSQSSSLNLHMMIHTGEKPFTCTQCGKSFSQSS.......................................................................................................................................................................................................................................................................................................................................................................... 415
291 0.000e+00gi|359076015|ref|XP_002695358.2| PREDICTED: zinc finger protein 665, partial [Bos taurus]  clstr ali  15  253VSSSLAVHQRVHTGEKPYKCDTCGKAFNQTAKLGLHQKIHTGEKSYKCDVCGKAFSRTGNLT--------VHRRVHTGEKPYKCDMCGKAFRVSSNLAVHQRVHTGEKPYKCDVCGKAFSQATGLAVHQRIHTGEKPYKCDVCGKA-FNQSSNLGIH-RSVHTGEKPYKCDVCGKAFSH------TGNLAVHRRVHTGEKPYK-----CDVCGKAFSCTGNLAVHRREKPYKCDVCGKAFSRTGNLAVH-RRLHTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 490
292 0.000e+00gi|335281214|ref|XP_003122336.2| PREDICTED: zinc finger protein 160-like [Sus scrofa]  clstr ali  14  407.KSNLAVHQRTHTGEKPYKCNECGKVFREKANLASHQRIHTGEKPYKCSECGKSFYYGSQLRK--------HQRIHTGAKPHQCDVCGKVFCRRSHLTGHQRVHTGEKPYRCNECCKSFSLSSLLSRHQRIHTGEKPYECNECG-KVFGQKTSLKRHQK-IHSGEKPYKCNECGKVFRE------KSTLAGHQRIHTGEKPYKCKE--CDTCGKHFLTNRKLQLHRREKPYKCDECGRVFHRKENLTGHY-RIHTGEKPYK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 651
293 0.000e+00gi|293354801|ref|XP_002728565.1| PREDICTED: mCG142610-like [Rattus norvegicus]  clstr ali  11  282.SSSLKTHHRVHTGEKPYKCNECGMFYXSLXGLKVHHRTHTGNKPYKCNGCGKSFTNALSLQNHH--------RIHTGEKPYKCNECGKSFTESSSLKIHHRIHTGEKPYKCNECGKSFTWSSGLKIHHRIHTGDKPYKCTECG-KSFTESSSLKIHHR-IHTGEKPYKCNECGKSFTQ------TSNLKTHHRIHTGEKPYK-----CNECGKSFXXSSNLKSHHREKPYKCNECGKCFTKSSGLKVHH-RTHTGNKPYKCN-------GCGKSFTNALSLQNHHRIHTGEKPYKCNECGKSFTESSSLKIHHRIHTGEKPYKCNECGKSFIKYSKLRTHHRTHTEDKPYKCNECGKSFTQSSNLKTHHKIHGGDKPYKCNECGKSFTQSSALKVHHIIHTGNKP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 661
294 0.000e+00gi|297300308|ref|XP_001095372.2| PREDICTED: zinc finger protein 34 [Macaca mulatta]  clstr ali  11  387.SSNLIQHQRIHTGEKPYKCNECEKAFIQKTKLVEHQRSHTGEKPYECNDCGKVFSQSTHL--------IQHQRIHTGEKPYKCSECGKAFHNSSRLIHHQRLHHGEKPYKCSDCKKAFSQSTYLIQHRRIHTGEKPYKCNLCGKA-FSRSSTLIQH-RIIHTGEKPYKCNECGRGFSQSPQ------LTQHQRIHTGEKP-----HECRHCGKAFSRSSSLIQHEREKPHKCNQCGKAFSQSSSLFLHH-RVHTGEKPYVCNECGYVCNECGKAFRRSSTLVQHRRVHTGEKPYQCVECGKAFSQSSQLTLHQRVHTGEKPYECGDCGKAFSRRSTLIQHQKIHTGEKSFGCNEYGKAFSPTSQPTEDQKMHAGEKPYKCQECGNAFSGNSALIRHQVTHTGGKPCHCSVCGKAFSQSSQLTPPQQTHVGEKP................................................................................................................................................................................................................................................................................................................................................................................................................................................. 871
295 0.000e+00gi|358422982|ref|XP_002706977.2| PREDICTED: zinc finger protein 91-like, partial [Bos taurus]  clstr ali  15  874..SSLIQHQRIHTGEKHYKCTECSKAFTCNSLLIQHQQNHTGEKPYKCTVCGKAFTYNSRLIKHQRICTECHRRIHTGEKPYKCTECSKTFTYNSRLIQHQRIHSGEKPYKCTECSKAFTCNSSLIQHQRIHTGEKPYICKECNKA-FHRSSFLTQHQR-IHTGEKPYKCTECGKAFTY------HSNLIQHRRMHAGERPYE-----CTQCSKAFSRSAHLRTHTGEKLYF........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1114
296 0.000e+00gi|296477318|gb|DAA19433.1| zinc finger protein 347-like [Bos taurus]  clstr ali  13  156.SSFLTQHQRIHTGEKPYKCTVCGKAFTYKSLLTKHQRIHTGEKPYKCTECSKAFTYNSLLIQHRRICTECHQRIHTGEKPYICKECNKAFRRSSFLTRHQRIHTGEKPYKCTVCGKAFTYKSLLTKHQQIHTGEKPYKCTECSKA-FTYNSSLIQHQR-IHAGEKPYKCTECSKAFICN------SDLIEHQRIHTGEKPY-----ICKECNKAFRRSSFLTRHQREQAYKCTVCGKAFTYSSNLIQHQ-RIHTGEKPYKCTE-------CSKAFICYSDLTYHKRIHTGEKRYKCTECGKTFITRYNLTEHRRVHTGERPYKCTECGKAFGYKSALTLHRRMHTGERPYECTECGKAFSQSAHLSKHQRTHTGEK.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 534
297 0.000e+00gi|334327301|ref|XP_001369730.2| PREDICTED: zinc finger protein 347-like [Monodelphis domestica]  clstr ali  13  371..........................................................................................................EKLCEYNDYWKAFKNKSELTPYQAVNIGEKSYKCSDCEKA-FRYRSELSQHQ-TIHTGEKPYECNVCGKAFR------LKAQLKQHQKIHTGERPFK-----CDECGKAFIQSQNLKQHYREKPYECNECGKAFTQRIGLIQHQ-RIHSGEKPYQCN-------QCGKAFRLRGKLSQHQTIHTGEKPFKCEECGKAFIQSQNLKQHHRTHTGEKPYECNECGKAFGQKKELNRHYTIHTGEKPYECNECGKAFRQRMGLTRHQTIHTGEKPYECNECGKAFSQKIGLSRHQTVHTGEKPYKCSECGKAFRLSALLTAHKNIHTGEKPYECNECGKAFRLRA-LLTTHKNIHTGEKPYECNECGKFFRLRALLTAHKNIHTGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 746
298 0.000e+00gi|50950167|ref|NP_001002954.1| zinc finger protein 252 [Canis lupus familiaris]  clstr ali  244........................................................................................KAPRQSSVLSENQRVNNPEKSFECTECRRLFSPSKALSQHQRSHTGEIPCESGGCGRTS-HHCSVLSQHQEVHHGGE-SHTCAECGKAF------KAHSYFIQQHNTHTGERPYE-----CSECA-HLSYSQHLQIHSGQKPHECSQCGKAFSHSSNLF-HHQRIHSGEKPYECKE-------CGKAFGRHSHLLQHKRIHSGEKPYDCTECGKAFSARLSLIQHQRTHTGEKPYECNECGKSFSLNRTLIVHQRIHTGEKPYRCNECGKSFSQRAQVIQHKRIHTGEKPYVCNECGKSFSARLSLIQHQRIHTGEKPYGCSECGKTFSQKGHLIQHQRIHTGEKPYECNECGKAFSQSFNLI-HHQRTHNGEKPYECNECDKAFSVLSSLVQHQRVHNGEKPYECH.................................................................................................................................................................................................................................................................................................................................................................................... 627
299 0.000e+00gi|297706097|ref|XP_002829891.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 470-like [Pongo abelii]  clstr ali  11  207....................................................KSLKTHSVVKKHKQDCGEK--------KLLKCNDCEKIFSKISTLTLHQRIHTGEKPYECIECGKAFSQSAHLAQHQRIHTGEKPFECTECGKA-FSQNAHLVQHQR-VHTGEKPYQCKQCNKAFSQ------LAHLAQHQRVHTGEKPYE-----CIECGKAFSDCSSLAHHRRKRPYECIDCGKAFTDHIGL-IHHKRIHTGERPYKCNV-------CGKAFSHGSSLTVHQRIHTGEKPYECNICEKAFSHRGSLTLHQRVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEKPYECKECSKTFSQNAHLAQHQKIHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRLHTGKRPYECLECGKAFRQRASLICHQR-CHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFSQVA.......................................................................................................................................................................................................................................................................................................................................................................... 638
300 0.000e+00gi|338718277|ref|XP_003363794.1| PREDICTED: zinc finger protein 184-like [Equus caballus]  clstr ali  135.........................................................................................................................................................................................................................QNSDLIRQKKKKPCKCSECGKTFRDHTTLIQHQ-RTHTGERPYKCNE-------CGKRFNQSSHLTNHQKTHTGEKPYKCNECGKAFSYCSVLIQHQRIHSGERPYECVECGKTFSRSTYLTQHQRIHTGEKPYKCLECGKAFSQSTHLTLHQRIHTGEKPYECNECGKAFSQSAHLTQHQRIHTGEKPYECNECGKAFSDHSALIRHHIVHTGEKPYECNDCGKAFSYCSDLIQHQR-MHTGEKPYRCNECGSAFSDCSALIQHQRTHTGEKPYECNECGKAFGNYSALIRHQRIHTGEKPYECKECGKAFSRSTYLTQHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 458
301 0.000e+00gi|334327664|ref|XP_003340966.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  11  299........................................................................................KKFSQYSVLNQCMKL-TSENDF-CSEYSKCFPEEIGLVQ-----SNEKPYQGNVGGMA-FGRSSDLRKHVKMV---------SVSGKGINQ--PLSQNSELAARQRIHDGKKSYE-----CKQCGKTFKRRDYLAGHQREKPYECKQCGKAFTDKRNLAAHQ-RLYTGEKPYEC-------KQCGKAFLRSSTLTSHQLIHTGEKPYECKQCGKAFTQRSNLAKHQLIHTGEKPYECKHCGKDFTQRGHLTSHQRIHTGEKPYDCKECGKAFALSTTLATHQLMHTGEKPYECKQCGKTFTQRCHLAVHQRIHTGEKPYECSHCGKAFTGSSHLAAHQRIHTGEKPYECKQCGKAFTDKRNLAAHQR-AHTGEKPYECSHCGKAFTGSSYLAAHQRIHTEEKPYECSHCGKTFTDKRNLAAHQRIHTGEKPYECKRCGKAFTDKRNLAAHQRIHTGEKHECKQCGKAFLSSSYLAAHQRIHTGEKP..................................................................................................................................................................................................................................................................................................... 766
302 0.000e+00gi|326667006|ref|XP_003198449.1| PREDICTED: zinc finger protein 271-like [Danio rerio]  clstr ali  27.................................................................................................................................................................................................................................QTEKPFTCTQCGKSFSQSSHLNRH-MRIHTGEKPFTCT-------QCGKSFNCSSSLIQHMRIHTGEKPYTCTQCGKSFSQSSSLNQHMRIHTGEKPFTCTQCGKSLVSKSKLKIHMMIHTGEKPFTCTQCGKSVNCLSHLNQHMRIHTGEKPFTCTQCGKSFSQSSNLNLHLMIHSGEKPFTCTWCGMSFSLSSNLNLHMRIHTGEKPFTCTQCGKSFIRSSSLNLHIMS-HTGEKPFTCTQCGKSFIRSSSLNLHIMSHTGEKPFTC..................................................................................................................................................................................................................................................................................................................................................................................... 286
304 0.000e+00gi|334349402|ref|XP_003342200.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica]  clstr ali  10  128..........................................................GTGTCIGRARLTVHQRIHTGEKPFECNQCGKTFARKSHLIAHQRIHTGQKPFDCNQCGKAFIQKVTPTVHQRIHTGEKPFECNQCGKA-FRSRNNMVKHQRFC-NGEKPFKCNQCGKTFIQ------RTKLTEHQRIHTGEKPFE-----CNQCGKAFRSRNSLVTHQREKPFKCNQCGKAFIQRTKLTVHQ-RIHTGEKPFECNQCGKACNQCGKAFSQKYTLTVHQRIHTGEKPFECNQCGKAFLWRARLTVHQRIHTGEKPFECNLCGKAFTEKSGLTVHQRIHTGKKPYECNQCGKAFIWRNKLTIHQRMHTGEKPFECNQCGKGFIQRTKLTVHQRIQTGEKSYECNQCGKAFSQKSGLTVHQRIHTGEKPFECNQCGKSFTHKSGLTVHQR-IHTGEKPFECNQCGKAFIQKVSLTVHQKIHTREKSYKCNH................................................................................................................................................................................................................................................................................................................................................................................... 575
305 0.000e+00gi|334346646|ref|XP_003341833.1| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  12  203...........................................................................................SQNSTLIEYQRVHTEQKSYECNQCRKTFCQRSGLAQHQRIHTGEKPYKCKECG-KTFSQSSSLGRHQRS-HTGEKPYECKQCGKTFSRSYSLAQHNYFAIHQRIHTGEKPYE-----CNECGKTFCQRSGLVHHQREKPYECKECGKTFFQRSGLAVHQ-RIHTGEKPYKC-------KQCGKAFRLRSSLGQHQRIHTGEKPYKCKQCGKTFRLRSSLAQHQRVHTGEKVYECKECGKIFCER-YFTVHQRIHTGEKPYECNECGKTFCQRSGLAQHQRSHTGEKPYECKQCGKTFRLRSRLAGHQRSHMGEKPYECKQCGKTFRLRSRLAGHQRIHTGEKPYECKQCGKTFRLSSSLAQHQK-IHTGEKPYDCKQCGKTFRLRSSLGQHQRIHTGEKPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 614
306 0.000e+00gi|348559643|ref|XP_003465625.1| PREDICTED: zinc finger protein 729-like [Cavia porcellus]  clstr ali  279.......................................................................................................................................................................................................................FIYSSLLTRHVREKPYQCNECGKVFSYTSSLA-HHRRIHTGEKLYKCIE-------CGKAFFRRSYLLVHERHHTGAKPYKCNECGKVFTQNSHLTSHRRIHTGEKPYKCNDCGKAFSVRSNLTNHQVIHTGEKPYKCNECGKVFSQTSSLAIHRRTHTGEKPYRCNECGKVFSSHSNLNTHQVIHTGEKPYKCSECGKVFTQNSHLANHWRIHTGEKPYKCNECGKAFSVYSSLTTHQ-AIHTGEKPYKCDECGKVFTQNSHLASHRGVHSGEKPYKCDECGKVFSQTSNLARHWRVHTGEKPYKCNECGKAFSVRSSLTSHQVIHGEKPYKCNECGKVFSQTSSLAIHQRIHTGEKPYKCNQCGKAFNSHSN...................................................................................................................................................................................................................................................................................... 647
308 0.000e+00gi|309267057|ref|XP_001476618.2| PREDICTED: zinc finger protein 850-like [Mus musculus]  clstr ali  14  783.SHKLQVHYRIHTGQKPYKCNECGKSFTQNSELKVHYRIHTGEKPYKCNECGKSFIQNSDLKVHQRICNECHYRIHTGQKPYKCNECGKSFSQSSKLQVHCRIHTGEKPYKCNKCGKIFTQNSDLKVHYRIHTGEKPYKCNECG-KSFTWNKVLKVHYRT-HTGEKPYKCNECGKSFTQNKV------LKVHYRIHTVEKPYK-----CNECGKSFVQYSHYTIHTGEKPYKCSECGKYFTRYTYLQVHY-RIYTGEKPYKCNESMKSVK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1065
309 0.000e+00gi|296478686|gb|DAA20801.1| zinc finger protein 84 [Bos taurus]  clstr ali  234.............................................................................................................................................................................LKYYACDKVSYKKSQIIIYHRSRSGEKLYECSECRCGKCGKTFPQKSQFITHHREKPYNCSQCGKAFSQKSQLTSHQ-RTHTGEKPYECGE-------CGKAFSRKSHLISHWRTHTGEKPYGCTECGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKSQLVTHHRTHTGTKPYGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECGKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLLSHQMTHTGEKPFVCTKCGKAFSRKSQLVRHQRT-HTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKP................................................................................................................................................................................................................................................................................................................................ 625
310 0.000e+00gi|358417007|ref|XP_002702019.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91 [Bos taurus]  clstr ali  13  571VSSSLAVHQRVHTGEKPYKCDTCGKAFNQTAKLGLHQKIHTGEKSYKCDVCGKAFSRTGNLT--------VHRRVHTGEKPYKCDMCGKAFRVSSNLAVHQRVHTGEKPYKCDVCGKAFSQATGLAVHQRVHTGEKPYKCDMCG-KTFSQAAGLAVHQR-IHTGEKPXKCDICGKAFSHTTR------LELHQRIHTGEKPYK-----CNVCDKAFSHTANLTVHRREKPYKCDICGKGFRVSSNLGVH-RSVHTGEKPYKCDV-------CGKAFSHTGNLAVHRRVHTGEKPYKCDVCGKAFSRTGNLAVHRRIHTGEKPYKCDVCGKAFSRTGNLAVHRRLHTGEXPCNYGICAKAFTVSSSLAVHQSVHTGEKPYK....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 925
311 0.000e+00gi|332264402|ref|XP_003281226.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 252-like [Nomascus leucogenys]  clstr ali  10  244.......................................................RQSSVLSENQRMNNP--------ERPFQCTGHGKTYNQNRAFNQHQRIHSGEKPCECIECGKAFSWPTILSKHQRIHTGKKPYTCEDCG-KSFSAHSYFIQHCKIIHTGEKPHECNQCGKAFSHS------SNLIHHQRIHSGEKPYK-----CKECGKAFNRQSHLIQHQREKPYDCKECGKAFSTQLSLIQHQ-RIHTGEKPYECNE-------CGKSFSLNQTLTVHQRIHTGEKPYRCNECGKSFSQRSQVIQHKRIHTGEKPYICNECGKSFGAHLSLVQHQRIHTGEKPYGCSVCGKTFSQKGHLIQHQRIHTGEKPYECSECGKAFSQSFNLIHHQRTHNGEKPYECNECDKAFSVLSSLVQHQRIHNGEKPYECHTCGKAFSQGSHLIQHQRS-HTGEKPYECNECGKTFGQISTLIKHERTHNGEKPYDCS.................................................................................................................................................................................................................................................................................................................................................................................... 684
312 0.000e+00gi|296193458|ref|XP_002744526.1| PREDICTED: zinc finger protein 184-like [Callithrix jacchus]  clstr ali  13  543..SALIIHQRIHTGEKPYACKECGKAFSQSSALIQHQRIHTGEKPYKCNECGKSFKQNLHLIEHQRICNECHQRIHTGEKPYKCNECEKAFSNSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVHQRIHTGEKLYKCSECEKA-FNCRAKLHRHQR-IHTGEKPYKCSECGKGYSCGRTFTRIATLIEHERIHTGQKPYQCNEYTCDECGKAFGCKSNLYRHQREKPYQCNQCGKAFSQYSFLTEHE-RIHTGEKLYKCIE-------CGKAYSYRSNLCRHKKVHTKEKLYKWKEYGKPSICSSSLTQYQRFLRGDKAYE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 923
314 0.000e+00gi|338710438|ref|XP_001495005.2| PREDICTED: zinc finger protein 135 [Equus caballus]  clstr ali  13  866.SSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECNECGKAFSQSTLLTEHRRICNECHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECGDCGKAFSHSSSLTKHQRIHTGEKPYKCNTCSRA-FSQLAPLIQHQR-IHTGEKPYECTECGRAFSQS------SLLIEHQRIHTKEKPYGCKPYECQDCGKSFRQSTHLTQHRREKPYECRDCGKAFTHSSSLTKHQ-RTHTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1158
315 0.000e+00gi|194216083|ref|XP_001491294.2| PREDICTED: zinc finger protein 470 isoform 1 [Equus caballus]  clstr ali  12  214..SFLKKNKQVYGEKKLLKCNDCEKTFSKISTLTLHQRIHTGEKPYECIDCGKAFSQSAHLA--------QHQRIHTGEKPFECTECGKAFSQNAHLIQHQRVHTGEKPYQCKQCNKAFSQLAHLAQHQRVHTGEKPYECIECGKA-FSDCSSLA-HHRRIHTGKRPYECIDCGKAFRQN------ASLIRHRRYHTGEKPF-----DCIDCGKAFTDHIGLIQHKRERPYKCNVCGKAFSHGSSLTVHQ-RIHTGEKPYECTV-------CEKAFSHRGSLTLHQRVHTGEKPYECKECGKAFRQSTHLAHHQRVHTGEKPYECKECSKTFSQNAHLAQHQKIHTGEKPYECKDCGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRLHTGKRPYECLECGKAFRQRASLICHQRCHTGEKPYECNICRKAFSHRKSLTLHQR-IHTGEKPYECKECSKAFSQIAHLTLHKRIHTGERPYECK.................................................................................................................................................................................................................................................................................................................................................................................... 681
316 0.000e+00gi|332261068|ref|XP_003279598.1| PREDICTED: zinc finger protein 879 [Nomascus leucogenys]  clstr ali  11  202.....................................................................................................................................................................KCYKCNICGKIFLHS------SSLSKHQRIHTGEKLYK-----CKECRKAFSQSSSLTQHLREKPYICSECGKAFSFTTSLIGHQ-RMHTGERPYKCKE-------CGKTFKGSSSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECTQCGKAFTSISRLSRHHRIHTGEKPFHCNECGKVFSYHSALIIHQRIHTGEKPYACKECGKAFSQSSALIQHQRIHTGEKPYKCNECGKAFSWISRLNIHHRIHTGEKPYNCKECGKSFKQNLHLIEHQR-IHTGEKPYKCNECEKTFSHRSSLLSHQRIHTGEKPYKCSECEKAFSNSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVHQRIHTGEK................................................................................................................................................................................................................................................................................................................................. 566
317 0.000e+00gi|296224981|ref|XP_002758493.1| PREDICTED: zinc finger protein 167 [Callithrix jacchus]  clstr ali  12  617LSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPYECNECGKVFSYSSSLM--------VHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYECSECGKAFSQRSTFNHHQRTHTGEKQYVCTECGKA-FSQSANLTVHER-IHTGEKPYKCKECGKAFSHS------SNLVVHRRIHTGLKPY-----TCSECGKSFSGKSHLIRHQGEKTYECKECGKAFSRSSGLISHH-RVHTGEKPYTCIE-------CGKAFSRSSNLTQHQRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKAYECDECGKAFILRKTLNEHQRLHRREKPYKCDECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1008
318 0.000e+00gi|334313257|ref|XP_003339862.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica]  clstr ali  14  339.RSHLALHQRIHTGEKPYKCKQCGKSFSHKSHLAVHQRIHTGEKPYECNQCGKTFTDSSSLA--------VHQRVHTGEKPFECKQCGKMFRQSSELTVHQRVHTGEKPFECKQCGKAFSQKSHLATHQRIHTGEKPFECKQCG-KTFTYHSSLVLHQR-VHTGEKPFECKQCGKTFRQS------SHLAVHQRIHTGEKPYE-----CKQCGKTFRQSFELVLHQREKPYELNQCGKIFTNSSSLAVHQ-RVHTGEKPHEC-------KQCG.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 585
319 0.000e+00gi|334325054|ref|XP_001375372.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica]  clstr ali  10  388...........................SQNSSHMGHQKMYSEEKSF-----GKTFR--------MRQKCDISQRIHTGEKLYECKHCGKTFSRSSSLTIHQRIHTGEKPYKCNHCGKIFRWSSNLARHQRIHTGEKPYECKQCG-KTFRQSSDLTQHQR-IHTGEKPYECKQCGKTFNE------RSSLAIHQRIHTGEKPYE-----CKQCGKTFTENSSLVVHQREKPYECKQCGKTFSQSSSLAQHK-RIHTGEKPYEC-------KQCGKTFSQRSHHVKHQRIHTGEKPYECKQCGKTFSERFHLAVHQRIHTGEKPYGCSHCGKTFAQSSSLAQHKRIHTGEKPYECKQCGKTFIHSSNLADHQRIHTGEYPYKCKQCGKTFSQSSKLAVHQRIHTGEKPYECKQCGKTFTLTSSLTVHQRIHTGEKPYECKQCGKTFSQQSHHVKHQR-IHTGEKPYDCKQCGKTFSQRSSLAIHQRIHTGEKPYECKQCGKTFSQRSHHGKHQRIHTGEKPYECKQCGKTFSQRSSLAIHQRNHTGEKP................................................................................................................................................................................................................................................................................................................................ 880
320 0.000e+00gi|281185516|sp|Q14591.4|ZN271_HUMAN RecName: Full=Zinc finger protein 271; AltName: Full=CT-ZFP48; AltName: Full=Epstein-Barr virus-induced zinc fin  clstr ali  10  72.........................................................................................................................................................................................................FKRRPHNCDEYGQSFVWSTSLFRHRKEKPYSCNWCIKSFSWSSDLIKHQ-RVHTGEKPYKCDECGYQCRHCSKSFSQRSDLVKHQRIHTGEKPYTCNQCNKHFSQSSDVIKHQRIHTGEKPYKCDVCGKAFSQSSDLILHQRIHTGEKPYPCNQCSKSFSQNSDLIKHRRIHTGEKPYKCNECGKAFNQSSVLILHQRIHTGEKPYPCDQCSKTFSRLSDLINHQRIHTGEKPYPCNQCNKMFSRRSDLVKHHR-IHTGEKPYECDECGKTFSQSSNLILHQRIHTGEKPYACS.................................................................................................................................................................................................................................................................................................................................................................................... 401
321 0.000e+00gi|334329112|ref|XP_001380175.2| PREDICTED: zinc finger protein 160-like [Monodelphis domestica]  clstr ali  11  259....................................ERIHVGENPNECNDCGKGFHHRSKLNI--------HRRAHTRKNPYQCNDCGKMFINDSKLILHRRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCHDCGKA-FIRSSHLLQHQR-IHTDEKPFKCDDCGKAFKQN------SHLLQHQRIHTGEKPFK-----CDDCGKAFNQNSNLSVHQRERPFQCNDCGKAFNRSSHLLQHQ-RIHTGEKPFKCDD-------CGKAFNQSSHLFKHQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTGEKPFQCHDCGKDFNQNSNISVHQRIHNGERPFQCNDCGKSFNQSSHLLQQQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTGEKPFQCNDCEKAFNRSSTLLKHQRIHTGEKAFKCDDCGKAFNQNSHLLQHQR-IHNGEKPFKCNDCEKAFNRSSNLLKHQRIHTDEKPFKCN.................................................................................................................................................................................................................................................................................................................................................................................... 691
322 0.000e+00gi|297706232|ref|XP_002829940.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 135-like [Pongo abelii]  clstr ali  12  205..................................................................................................................CGK--REKPDLNILQKTCVKEKPYKCQECGKA-FSHSSALIEHHRT-HTGERPYECHECGKGFR------NSSALTKHQRIHTGEKPYK-----CTQCGRTFNQIAPLIQHQREKPYECSECGKSFSFRSSFSQHE-RTHTGEKPYECSE-------CGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECSECGKAFSQSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECNDCGKAFSHSSSLTKHQR-IHTGEKPYECNQCGRAFSQLAPXIQHQRIHTGEKPYECN.................................................................................................................................................................................................................................................................................................................................................................................... 565
323 0.000e+00gi|309265734|ref|XP_003086595.1| PREDICTED: zinc finger protein 160-like [Mus musculus]  clstr ali  340..............................................................................................................................................................................................................................................SFIPEYHYSKHRERLH-------------KSNNCGKSFIQSSKLQVNYRIHTGEKPYKCNKCGKYFTQSSKLLVHYRVHKGEKPYKCNECGKSFIQNSELKAHYRIHTKEKPYKCNTCGKSFTQNSKLQVHYRIHTGEKPYKCNECGKSFTQKSNLQVHYKTHTGEKPYKCNECWKSFTHTSSLQVHYRIHTGQKPYKCNECGKSFTQKSDLQVHYR-IHTGEKPYKCNECGKSFKQNSQLQVHYRIHTGEKPYRCS.................................................................................................................................................................................................................................................................................................................................................................................... 582
324 0.000e+00gi|334349714|ref|XP_003342246.1| PREDICTED: zinc finger protein 420-like, partial [Monodelphis domestica]  clstr ali  12  118.........................................................................RMHTGEKPYECKQCGKTFIWRASLVQHQRIHT-EKLYQCKQCGKTFSQSSLLVRHQRIHTGEKPYECKHCG-KTFSQSSLLVRHQR-IHTGEKPYECKHCGKTFSQS------SLLVRHQRIHTGEKPYE-----CKHCGKTFSQSSLHVRHQREKPYECKQCKKTFSQSSLLVQHQ-RIHTGEKPYECGEKPYECKQCGKAFGRISSLAIHERMHTGEKPYECKQCGKAFSQNVSLAAHQRIHTGERPYECKQCGKTFSRITYLAIHQRVHTGEKPYECKQCGKAFTWRASLIRHQRIHTGEKPYECKQCGKTFRYSSRLVQHQRIHTGEKHYKCKQCGKAFSYSSHLVRHQRSHTGEKPYECKQCGKAFSSIHNLAIHQR-IHTGEKPYECKQCGKAFSRLPSLAIHQRIHTGEKPYECKQCGKTFTQNSS......................................................................................................................................................................................................................................................................................................................................................................... 559
325 0.000e+00gi|297705569|ref|XP_002829647.1| PREDICTED: zinc finger protein 347-like [Pongo abelii]  clstr ali  10  229.........................................................................................................................................................................CNELGRS------LWQASTLILKQRVPHGDRPRKWGRPW-----------KSLKR-QREKPFNCTECGKAFIYHSDYILHQ-RIHTGEKPYKCHD-------CGKAFSNSSYFIQHHIIHTGEKPYACHACGKTFTQSSSLTEHQRIHTGEKPYKCKDCGKAFTQSSSLIKHQRCHTGEKPYKCGQCGKFYSQVSHLTRHQKIHTGEKPYQCGECGKAFCHTSSLTQHQTIHTGEKPYKCNECGKTFSHSSSLTQHQRVHTGEKPYECTDCGKAFSHSSSLTQHQR-IHTGEKPYACHECGKAYTQISHLMRHQSTHVGEKPYVCNECGKAFSHTSSFTQHQTIHTGEKPYKCTECGKTFSQNSSLTRHQRIHTGEKP................................................................................................................................................................................................................................................................................................................................ 583
326 0.000e+00gi|301771518|ref|XP_002921183.1| PREDICTED: zinc finger protein 879-like [Ailuropoda melanoleuca]  clstr ali  14  530.SSALIQHQRIHTGEKPFNCKVCGKAFRQSSSLMTHMRIHTGEKPYKCKECGKAFSQSSSLTNHQRTCHECHRRIHTGEKPYRCDECGKTFSHRSSLLAHQRIHTGEKPYKCNECEKAFSSSSTLIKHLRVHTGEKPYHCKECGKA-FSQCSTLTVHQRRIHTGEKPYKCSECGKGYSCGRTFTRISTLLEHRRIHTGQKPYQCNEYTCGECGKAFGCKSNLYRHQREKPYQCNQCGKAFSQYSFLTEHE-RIHTGEKLYKCME-------CGKAYSYRSNLCRHKKVHTKEKLYKWKEYGRPLIYSSSLTQYQRFLRADKPGE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 939
327 0.000e+00gi|334324898|ref|XP_003340580.1| PREDICTED: zinc finger protein 268-like [Monodelphis domestica]  clstr ali  12  604VRQSLIKHQRIHTGEKPFQCNECGKAFSQKGHLVSHQRTHTGEKPFRCNECGKAFSWKESLII--------HQIIHTGVKPFKCNECGKAFSQKRKLINHQRIHTGEKPFKCNECGKAFSWKESLITHQSTHTGEKPFECNECG-KTFSARKSLIKHQ-SIHTGEKPFQCNECGKAFSW------KGSLIIHQRTHTGEKPF-----QCNECGKAFSHKRRFIIHQREKLFECNECGKDFSCKESLITHQ-RTHTGEKPFKCNE-------CGKAFSQKGSLNIHLRTHTGEKPFECNKCGKTFSHKKSLVVHQRTHTGEK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 899
328 0.000e+00gi|344276345|ref|XP_003409969.1| PREDICTED: zinc finger protein 167 [Loxodonta africana]  clstr ali  13  588LSKCLIRHQRLHTGEKPYKCKECGKSFNQNSHLIIHQRIH