current user: public




Query: [CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components, from COG0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570
# E-value Template Links and tools%idFirst MRALLPYLALYKRHKWMLSLGIVLAIVTLLASIGLLTLSGWFLSASAVAGVAGLYSFNYMLPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCALAAFEALAPVTGAFQHLGQVIASAVRISDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYPEQSQQALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDNLLLASPGSSDEALSEILRRVGLEKLLEDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLRGLSRFQQIIVMDNGQIIEQGTHAELLARQGRYYQFKQGLLast
1 0.000e+00gi|738651792|ref|WP_036560583.1| ABC transporter [Oceanicola sp. MCTG156(1a)]  clstr ali  25  20..ALRGLLPFLAPYKLMXXXXXXXXXXXXXXSLVLPIAVRRVVDG--FETEAATLLDSYFSAALLIAGLLAIGTGLRYY--LVT-RLGERVVADIRKAVFARMIGMSPAFYEKIMTGEVLSRITTDTTLILSVIGSSVSIALRNFLIFLGGFVLMLLTSGKLSGXXXXXXXXXXXXI-IVLGRRLRGLSRENQDWIAASSGNASEALSSVQTVQAFTHEGQSRASFADVTEKSYQVARKRITTRAVMTVIVIFLVFSGVVGILWVGARDVRAGGMSVGELVQFVIYSVMVAGAVGALSEIWGELQRAAGATERLVELLGAEDSVHDPEDPLPVPSPGKLTFEGVRFHYPTRPQAALEDVTLTVQPGETVALVGPSGAGKSTVIQLLLRFYDPVQGRVTLDGLPLDAMRRSDFRQHMSLVPQDPVIFADTARENIRFGRLDATDXXXXXXXXXXXXHDFLMPDGYDSYVGERGVMMSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVDAMAADRTTIIVAHRLATVKKADRIVVFDEGRIVAEGSHDDLVAQDGLYARLAR.. 587
2 0.000e+00gi|890672738|ref|WP_048896875.1| thiol reductant ABC exporter subunit CydC [Bacillus endophyticus]  clstr ali  28  7.....WIMPYVQKYKYRMIAIMLLSMLSIGSAAALMFTSGFLISKSSLRPENILLVY---VPIVLVRTFGLGRAVFRYSERLVSHDFILRVLAKMRTRLYHLVEPRI-AGNKQLKTGEILGVLAEDIEGLQDLYLRTVLPTASALLLYIISIIALGYFSLPFALLMALYFFMLIIVMPIFSLVHMRAVNRTYKHEKDRMYQYTTDGLLGISDWLMSGQKGTFLERVLRIGRKVDEADRKTKRWQYYREFIAQVVVAAMIVTMMIFSSNLFSHGELANVYIAAFVLVVIPLSEAIIPVSNAVEKYPRYEESLTRITNLENKLESSKENSLEQVVKENITIDLKNLSFQYEEQEGAVLKDLNLHIPQGKKIAIIGRSGAGKSTLLQAIQGLLVPTGGSVTLNEYNASSIK-DGTSSLISVLNQNPYLFNTNVANNLLLANESATEEEVKEVVKKVRLENLVSQDGYQTSMEETGQRFSGGERQRIALARVLLQKTPIVMLDEPTVGLDPITERALLDTIFETLEGKTLLWVTHHLTGIEKMDEIIFLEDGRVKMRGTHDELLKTSAYYQKLYE.. 573
3 0.000e+00gi|494962622|ref|WP_007688648.1| ABC transporter ATP-binding protein [Sphingobium indicum]  clstr ali  28  20...LAMIWRFASRYPGRIAGALAALLVSSAATLAIPSGFRLVIDRGFMGGGDISRWFEYLFLIVAI--LALATAARFYFVSWLG----ERVVADIRSATQANLLRQEPRFFEENRPSEIASRMTADTAIIDQVVGSTVSIALRNVVTGTGGLIYLFALAPKLAGLLLLGIPVILVAI-IGLGRRVRALSRASQDRLADVGSVTSETLGAMKIVQAFGQEGREAARFDTTVEAGFATARRRIALRAAMTAIVIALVFGSITAVMWQGALDVAAGRLSGGSIAAFVLTGGLVAGAFGALSETWGDLLRGAGAAGRLHELMSATPQITAPPRPVPVEHGAHLQFEDVHFRYPTRPQAALHGISIDIAPGETVAIVGPSGAGKSTLIQLALRFYDPDSGVIRLNGVPLPQADPAEVRGMMAMVPQESIIFAASARDNLRYGRWDASDDQIWAAARAANAEAFLRPQGLDSFLGEGGARLSGGQRQRLSIARALLRDAPILLLDEATSALDAESERLVQDALGRLMQGRTTIVIAHRLATVRAADRILVLDEGRLVEQGDHAMLMRQKGLYARLA... 585
4 0.000e+00gi|739670870|ref|WP_037526057.1| ABC transporter [Sphingomonas wittichii]  clstr ali  26  16..DLAMVWHFARRYPGQIIGAIIALIVAASATLAIPAGFRLVIDKGFIAGGNVAPYFRGLLLTVLI--MAIATAIRFYFVSWLG----ERVVADIRIAVQANLLRLAPRFFEENRPSEIASRLTADTSVIEQVVGTTVSVALRNLFLAIGGIIYLFAVTPKLAAMLLFGIPLIMLPI-ILMGRRLRGLSRSSQDRIADLGAMIAEVLGAMKIVQAFGQEQREAERFGGAVGSAFATSKRRIIVRAVMTAIVMLLMFGSITMVMWQGANDVAAGRISGGAIAAFILTGGLVAGAFGALSEVYGDIVRAAGAAGRLAELLTEQPDIAAPTHATPLPVPGRLTFDHVTFRYPTRREKALDDFSLAIEPGEMVAVVGPSGAGKSTLLQLAQRFYDPEGGAVRLDGVALPDADPAEIRRRLAIVPQETVIFGASARDNLRYGRWDADDDAIWSAAEAANAAEFLRPGGLDSFLGESGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQDALHRLMKGRTTIVIAHRLATVRAADRIIVMDKGRIVEQGNHASLSAHEGLYARLAR.. 583
5 0.000e+00gi|971866199|ref|WP_058935088.1| ABC transporter [Roseateles depolymerans]  clstr ali  25  33LRAMWPLWPFLRPYKGRIAAAVLFLILAAVATLIFPLALRQLIDQGADPGDRMMALREHFLGLFAVAALGVFSALRFYAVTWLG----ERVSADLRSAVYAHVLRQSPEFFETTQTGEVISRITTDTTVIQNIVGSSLSMGLRNMIMGLGAVGLLIATNPWVMSQVMGILVLVVLPA-MFFGRRVRRLSRASQDRVADTSAIAAEMLNAISVVQSHAQEDREARRFGVASEAAFDTARKRTKVRSLLVAFIITATFGALLWGLYQGTQAVMAGHITAGHLGQTVVYVILLVSSVAVLAEVWGDLLRAAGATERLMELLAARSPVADPAAPLPVEGPAHVQFRQVRFHYPSRPRAALNAFDLDIAPGETVALVGPSGAGKSTVLQLLQRFYDVQDGDILVDGLRVDRVRLADLRARMALVPQQSVIFSATALDNIRYGRPDASREEVVAAAQAAHAHEFIEPQGYDSFLGERGVRLSGGQRQRIAIARAMLQNAPLLLLDEATSALDAESERLVQQALDEAMRDRTTLVIAHRLATVQRADRIIVMDQGRIVEQGRHAELVAQGGLYARLA... 608
6 0.000e+00gi|666936012|gb|KEZ78446.1| cysteine ABC transporter permease/ATP-binding protein CydC [Salinisphaera hydrothermalis C41B8]  clstr ali  38  1MSDWRRLFGLLRPYRGVLALGIGLATLVIVANVALMALAGWFITGMALAGLGLGTI-NYFAPAAGIRGLAIVRTGGRYLERLITHDATLRVLSTLRVTFYARLEPLAPAGLQRYRGGDLLSRMRADIDTLDNFYLRVIAPTIAAALCVVVVNAFAAVFSPAVAMVNVAALLVAGILLPWISYRTSRARGVERRQALADLRATVADSVGGMGELWAFQVTGRQAQRIRRLSRGLIAAQRRDAWADAVVNAASATVSRLALWGALILAIPLVARGVIGGPELAMLVFLVMASFEAVAPLPAALRALAETKAAARRVFEIMDAEPAVAEPASESAPPATFDIVLRDVYFRYEDAAPWALAGADLTLSPGRAIGLVGPSGAGKTSVVNLLLRFWPYQAGAIEIGGVPIERYTTATLRQWFAVVAQHTHLFNATIADNLRIAAPEANDEQLHAALARAGLAERVMPRGLDTFVGEAGLQLSGGEARRLAIARAVLKNAPILILDEPTEGLDPASEAEVLAALAPLMRRATTLVITHRPSVLRYVDEIAVIEDGRVIEQ.................... 554
7 0.000e+00gi|85698866|gb|EAQ36735.1| ABC transporter, ATP-binding/permease protein [Nitrobacter sp. Nb-311A]  clstr ali  28  71.........YIARYRGRXXXXXXXXXXXXXXXXXXPLAVRRIIDFGFTS-EGVAMINSYFTMMIGVVAVLAGASAARYF--LVT-TTGERIVADLRRDVFAHLISLSPVFFDTARSGELVSRLTADTTQIKSAVGSSISVALRNLVLFVGAVSMMVITSPRLSGLVLA--AIPLIVVPLVFGRWVRRLSRNAQDNLADATAYASELVGGIRTVQAYTNERLADARFGGEVEQAYVAARNSARARAVLTAIIIFIVFTSVVLILWIGSRDVLEGSMTPGRLGQFVLYAAFAATGLGQLSEVWGEVAAASGAAERLFELLRVKPVIAAPPAPRALPVRGDVTLDNVSFAYPSRPQKVLDGVSLAVKAGEKVAIVGPSGAGKSTLFHLLLRFYDPASGTISFDGVPLRAADPCEVRARIALVPQESVVFAASARENIRFGRPDASDAEVERAAELAHATEFIRPGGFEALLGERGVTLSGGQRQRIAIARAILRDAPLLLLDEATSSLDAESETLVQTALEELMRHRTTLVIAHRLATVLSCDRIMVMDHGRIVEQGTHASLVAANGLYARLAR.. 632
8 0.000e+00gi|806776329|dbj|BAR47129.1| ABC-type multidrug transport system, ATPase [Methylobacterium aquaticum]  clstr ali  26  57..ALKPLFPFAARYKGRIASAVVALVAASGATLVVPIAVRRVVDLGFSHGEVG-MIDAYFGGLIGVVAVLAVASAARYYCVVT---LGERVVADLRAAVFARLTTLDPAFFDRARSGELVSRLTADAAQVKSVFGVSLSILLRNLFLFTGAIGMMVWTSPRLSVLVLAAIPLIVFPL-ILSGRGVRRRSRAAQDRLADASAFATEAVGAVRTMQAFGMAGATAKRFAAASEDAFLASRASARARALLTGVAIFLISASVVGVLWYGAQGVAAGTLSAGQLSQFVLYAVFGASALGQLSEVYGELTLAAGAAERLAEILDTVPAIGAPDRPRALPTPGEIAFERVRFHYPTRPEPALHDLSFVVAPGERVALVGPSGAGKSTVLQLLLRFYDPESGTVRVDGVPVDAVEPEALRARMALVSQDPTVFSGSILDNIRYGRPEASEAEVERAAAQAHADGFIRPEGYATLVGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAESERAVQAALDVLMKDRTTLVIAHRLATIRAADRILVMEDGRIAEQGTHDALLARGGLYAQLA... 624
9 0.000e+00gi|494127887|ref|WP_007067659.1| ABC transporter [Fulvimarina pelagi]  clstr ali  23  24LRPLGRLVPYVRRHMGLAIGATIFLTIAALVTLSLPLAVRRLIDEGFTS-SSAYMINGFFGLLFVLAGLLAVSSACRYFFVVT---LGERVVAELRKDVFAHVTKLSPAFFDRALSGEIVSRLSADTTQIKSAVGSTASVFLRNAILFIGALGMMIVTSPSLSLIVIA--AIPLIVLPLVFGRGVRRRSREAQDTLADATAYASEAIGAMRTVQAFTSEGTVSKRYSDAVDKAFGAARASIKARAMLTAVAIFLIFSSIVAVLWIGASRVALDMLSPGTLGQFVLYAVFAAGALGQLSEVWGELALAAGAAERLSELLTEEPQVRAPAEPLALPSPGRIVFDHVTFAYPSRPDPTIEDLSFTIAPGETVAIVGASGAGKSTIFGLIERFYDPVAGTITIDGINIAKTDPADLRTRIAFVPQDTTIFAVSAFENIAFGQPGASRAEVRSAAGSALASNFIDDRDYDTLLGERGVTLSGGQRQRIAIARALLRNAPILLLDEATSALDAESEILVQKALDELMVGRTTLVIAHRLATVLKADRILVLEGGQIVEEGTHQTLIEKDGVYARLAR.. 594
10 0.000e+00gi|797179585|ref|WP_045848997.1| amino acid ABC transporter ATP-binding protein [Domibacillus enclensis]  clstr ali  28  1MNWL---IPYMKEHKRLLAVVVFLGSLTIFAASALLFSSGYLISKAASRPENLLMIY---VPIVMVRTFGIMRSVSRYLDRLTSHSLILTIVSRMRVRLYEALRPQT----ARFKTGDALSLFADDIEHLQDVYIKLIFPWLSALLLYIVSIAALGYFSVPFALVMGLYFFVFTVLVPLVSLLVTKAKQTRQKEQRAAQYSQLADAVMGLGDWIFSGRQRSFIDSYERREEEWTKIEAFKRSFTRGRDFALQLLIGTAVVAMMIWAGGQSTSGQIAPVLIAAFTLVLFPITEAFLPLSSAAESWSGWSHSLNRLDAVEQGKSQQXXXXXXXXXXXXXX-XLQDVSFSY-NEQAPIFDHFHMAIEHGEKVAILGPSGSGKSTLMQLAFGLIAPQNGVVLINGYE----PDDDISREIAVLNQQPYLFNTTVMNNVRLAKPNASDQEVMEAVKKVHLHDYIQPNGYHTMMQEAGARFSGGERQRIALARVLLQQTPIVILDEPTIGLDPITERQLMDTVFEVLHGNTIVWITHHLAGMEKMDRIVFLEEGKIQMDGPPAELFAANTRYKRLYE.. 557
11 0.000e+00gi|501280335|ref|WP_012323353.1| cysteine/glutathione ABC transporter ATP-binding protein/permease CydC [Shewanella woodyi]  clstr ali  45  1MKVLFPFLKLFKHQWLMMFTGLLLSVVTLMAGIGLLSLSGWFLSAAAVAGLSTAMMFNYFTPAGGVRFLSIARTASRYGERLATHEATFKLLTQLRSWAWRKLLPLSAENLQGLRQGDLLNRLVADIDTLDHLYLRLITPMAASLIMLVVLYFFVAWFDTDLALILSGTLLAVWGLLPLVFYHLGRRPGVELLENKRQLRVLLLEFIQGQAEISLFGATDRFRAELAASEQALFSNQSAMASVTALSQAMLVLCHGVAVVLVFYVATAGVGEHVPPGPILATMVFMTMACIEMLMPIAGAFQHLSSCVSAATRVNELLDQEPGISFNTDSELKITQGELKLSDLSFSYDGEHQ-VLSRLSLCIKAGEKVALLGQTGCGKSSLLSLIAREWEAQEGEISIDGERLDRYSESSLREGITLVSQRIYLFAGTLRSNLILAQAEANDAILIEVLNRVGLSSLTQGEALDAWIGEGGRQLSGGEQRRIGVARALLRDAPILLLDEPTEGLDKRTEREILALLFEFAKDKTVVMISHRLTAMEQMDCIYLMEEGGVLAHGEHDQLLQDSPYYKSLYRQL 590
12 0.000e+00gi|505066743|ref|WP_015253845.1| amino acid ABC transporter ATP-binding protein [Thermobacillus composti]  clstr ali  29  1.......MPPIKQQLWRFAAAAFTGTLAVSCAGALLFTSGYLISRSSLQPENVLMVY---VPIVLVRAFGFGKAAIQYAERLISHDTVLRILSRMRIRLYRILELQALHLRSRFRTGDLLGLLAEDIEKLQHVYLRLVLPAVTAVLLYAAGIAALGRMDGTFALLMALYCGFLLFALPVFALFVSRKWRKRYMMERSMAYQELTDAVFGMSDWLLSGRSGQFLADFHERQKSMAEAEKRMRRAEWRLQWLSQCAVSGAVILLALWAGRRSLNGAMEAEWIAAFALVAFPLLDALVRAGEAVIRTPDYRGSLERLEQVEAAAPPETAGAPTAPLENVPDLLLDRVSFRYPGSEEWSLRDVTLRVPKGSAVAVIGRSGAGKTTLLHLIQGELVPVSGTVTLNGVPVREAAGEA-SRLFAVLNQQPYLFDTTISNNIRLGRPGAADEEVREAAERAGLGRLISPDGLETRVREAGDRFSGGERQRIALARILLQNCPIVLLDEPTVGLDPVTERELMDTIFETLQGRTLIWITHHLSGMERMDQIVFMDRGRIAMQGTHEQLLKNSERYRQLY... 586
13 0.000e+00gi|1004040542|ref|WP_061495835.1| ABC transporter [Ramlibacter tataouinensis]  clstr ali  24  15.RALSGLLPFVRPYRARIALAGLFLVLAATATLLFPVALRGLVDSAVQKGEQVLALREHFLALFAVAALGLFSAARFYMVSWLG----ERITADLRNAVYAHVLEQSPEFFETTQTGEVLSRLTTDTTLVQTVVGSQLSLGLRNSVMGLGALAMLVWTNPYVMTQVLLILVLVVLPT-MWFGRRVRRLSRASQDRVADSSALAAEVLNAIPVVQSHNAEPREAQRFRDATQGAFETGIRRTRARAALVAFIIIGNAALLLWGLYQGTQAVIAGRITAGHLGATVVYVIILAGAVAVLGEVYGDLLRAAGATERLMELLEARSPVTSPARPQAMPARGAVRFEQVTFHYPSRPAPALKDFSLQVEPGETVALVGASGAGKSTVFQLLLRFYDPGEGRILIDGASTREVDLCALRARMAIVPQEAVIFSASVLENIRYGRPGAGDDEVVDAARAAFAHDFITPEGYGSFVGERGVRLSGGQRQRIAIARAILKNPPLLLLDEATSALDAESERMVQAALESAMRNRSTLVIAHRLATVQKADRIVVLDHGRIVEQGSHDQLLARQGIYARLA... 588
14 0.000e+00gi|491948588|ref|WP_005686466.1| amino acid ABC transporter ATP-binding protein [Haemophilus influenzae]  clstr ali  48  1MRTLFPFIRLFKFAKFPLILGLVLMILGLGSSMGLLTVSGWFLAATAIAGLGSL--FNFFYPSASVRGLAIGRTVMRYFEKIVTHDATFRILSKLRVQVFEKIIPLSPAVLNRYRNSDLLNRLVSDVDTLDSLYLRLLAPFFTAAFVTIAITIGLSFINIPXXXXXXXXXXXXXXXXPTVFYRLGQQFGERLIQARATYRTQFLEFIQAQAELLLFNAEDKLKEKMSATEKTWQEDQAKEAKLSGFSTALVLFLNGLLISGMLWFASNDFGTDEYRTAYIALFTFAALAAFEIIMPLGAAFLHIGQVIAAAERVTEIIEQKPLVEFNGNEKFETKVRLISANNLSFSYPEQETLVLKNLTLDLEQGQKIAILGKTGSGKSSLLQLLVRNYDANQGELLLAEKPISAYSEETLRRQICFLTQRVHVFSDTLRQNLQFASADISDEQMIEVLHQVGLSKLLEQEGLNLWLGDGGRPLSGGEQRRLGLARILLNNAPILLLDEPTEGLDRETERQILRLILQHAENKTLVMVTHRLSSIEQFDKICVIDNGRLIEEGDYNSLIKQNGFFKRLVERV 576
15 0.000e+00gi|345504440|gb|AEN99122.1| ATP-binding/permease protein cydD [Lactobacillus sanfranciscensis TMW 1.1304]  clstr ali  27  14.....WIKPYLARYKKLLVLVFFLGVLTFFCAIGLMFVAGYLISRSATHPYNILVVY---VPVLLTRAFGIGRPLFKYLERINSHNWVLKVTSLLRKRLYTTLETSAMFLTSKFQTGDLLSILAEDIDHLENLYLRTIFPTVVAYITGIIVILCLGVISWLYAIFMLISFAIILLFIPLASVAMRGAAKEYERSLVHESYSELTDATFGIDDWMISGRKNGFLKRVTKNDSKLDASNFRTRKYEWNRDLLVKVMFAIILIGTLIWSNCFFNSSQALANYAAAFVLGVFPLMDTFIPVSQAMEEWPMYKDSVLRLNKLSNDEIK-PSPDQSATNPDTFEIKMNDVTFNYPGESVSLIKNVSLEVKRGQKLAIIGPSGVGKTTLLQLLLGSLIPTKGSVTIDGINVTRLQNNQ-AKWFSVLDQHPFLFNTSVLNNVRIGNENASNEDVKQAIKDVGLEDYIKPDGYNTNVRESGVRFSGGQRQRLALARILLQNNPIVLLDEPTVGLDPITENDLIKTLDRVLKGKTVIWVTHHLQGLSNMNQVIFLENGSIKMEGTPSELYKNNPRYRKLY... 576
16 0.000e+00gi|1021380530|gb|KZN65926.1| hypothetical protein N473_10180 [Pseudoalteromonas luteoviolacea CPMOR-1]  clstr ali  25  23...LLPIVAFIKPYKWVAMLALLVLLITAGLNLSIGQGVKFVIDSGFIAGSKAQLTQAISGLVVLISLVAVGTFCRFYLMSWLG----ERVSADIRKAVFNQIVHLHPSYFEENRSGEMMSRLTTDTTLLQSIVGSSFSMALRSALVLFGGLIMLLVTNFKLTLLVVACVPLTLVPI-MIFGKRVRRLSENNQSAIADISTYAGEIIQHIKVVQSYTHEEKEKHAFGGEVEKAFNVARQSIKQRSFLIAAVIFLTFGAISVMLWVGGMDVLEGRMTGGELGAFIFYAIMVAMSVATIAEVYGELQRAAGAASRLLELLKIDSAIKDVDEPVEMQHTGEIAFNNVDFYYPSRPDPALKGINLSIAKGKVVALVGPSGAGKTTLFELLQRFYDPQQGDIKFNNEVLTQVSLNALRHSMGMVPQHPVLFSSDVWHNIRYGNPDASDEQVIEAAKRAHAHDFILPDGYGSFLGEQGVRLSGGQKQRIAIARAILKDPEVLLLDEATSALDAQSEFHVQAALNELMQNRTTLIIAHRLATVTHADVIVVMDKGQIVDMGTHQDLLESSVLYQRLCE.. 590
17 0.000e+00gi|915916251|ref|WP_050927562.1| ABC transporter [Aestuariivita boseongensis]  clstr ali  24  24MRALSALWPFMAPYKLLMAAAGAALVLTAMVSLALPMAVRRVVDN--FEAEESAILDLYFAAALGIAALLAVGTGLRYA--LVT-RLGERVVADIRKAVFDRVIGMSPAFYERIMTGEVLSRITTDTTLIQSVLGSSVSIALRNILIFFGGLVLMMLTSPKLTG--LALLLVPAVIVPLVLGRRLRVLSRENQDWIAASSGNASEALGAVQTVQAFTHEAENRAAFGDVTERSFDAARRRIWTRALMTVIVIFMVFTGIVGILWMGANAVRSGDMTVGTLVQFLIYSIMVAGGVAALSEIWGELQRAAGATERLVELLESVDSVSDPAAPVALPARGQITFENVTFRYPSRPKAALDDVSLDIAPGETVAFVGPSGAGKTTIIQLILRFYDPIAGRILMDGVDLADMARDQFRRHIALVPQDPVIFATTARENIRFGRPEATDXXXXXXXXXXXXXXXXXPDGYDSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVDELSEGRTTLIVAHRLATVKKADRIVVLDQGRVVATGSHDALVAEGGLYARLAR.. 593
18 0.000e+00gi|1019496400|emb|SAL04230.1| ABC transporter ATP-binding/permease [Burkholderia sp. LMG 29320]  clstr ali  23  13..PLFALLPFLRPYAGRWACAFLALLTSAGATLAIPVAFKYLIDRGFASGNRTHIDRYFIALFVVSLIFAAAAALRFYWVSWLG----ERVTADLRRAVYDHVMKMSPQFFETTQTGEVLSRLTTDTTLIQTVVGTSLSLGLRNILLIVGGVAMLFTTSAELSSYXXXXXXXXXXXXXXI-GRRVRQLSRASQDKVASASALAGEVLNAMPTVQSYTHETHEANRFGGAVEAAFDTALARIRARALMTAVVIVSVFAAIVFVLWLGAQEVLARHMTAGQLSQFILYAVFTAGAVGAVAEVWGDLQRAAGATERLLQVLAARSPVVEAESPVPLPARGNIRFHDVGFSYPSRPGAALSSFSLDVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQSGEILINGVRTDQVSLTSLREAIGVVLQESVIFSGSVLDNIRYGMPDATLAQVQRAAEMAAAAGFIEPQGYETFLGERGVRLSGGQRQRLAIARAILKNPPILLLDEATSALDAASERLVQTALDNAALNRTTLVIAHRLATVQRADRIVVLDHGRIVAQGRHAELLQSSPLYAQLA... 579
19 0.000e+00gi|495866587|ref|WP_008591166.1| thiol reductant ABC exporter subunit CydC [Salimicrobium jeotgali]  clstr ali  30  1MKELRTVLALVAREKKDIWFSIVFGVLAGLTTVGLFGASGYLISKAALAPP----LYTLIIVIAMVKLFGFTRALGRYVERLFSHRATFTILSHIRTRFFEMLEPEVPHIFRKYRSGDLLARVIGDVESLQNFFLRVYYPPIVLLIVFLSTIIFTTFFSWMLALLFFLGLVIVGVVIPFIATLKQRKSQYSVREGRGILSTKLAEWLYGFRDLKIYQKQEETEADLRESMETYEAAHERQQLQMAGGEGWNLLASLTATWAVVLVSVWQIGAGELDGIFLAMFIMISLMVFEDAGPMANVPRHLEDNRNAAERLFSLPGQT-GRHSGDVSLEPSGPLSFSMENVTYSFPESLTPVLQDATISFPAGSKTAIVGASGSGKSTIQQLLLSMDVPEAGRIKVQDKDMQRVSQESVWKEVNAILQESHFFYGTVRDNLLLADEDADDRRMKEVLERVKLPHL-SPE---HPVEEKGGNLSGGEKQRLALARIYLKPARTWILDEPFSSVDVLTERELMQDFWETAVHDTVILISHNLKGLEQMDNIVVVEQGQVIEKGSYEELMEWKGYFYRMKQ.. 562
20 0.000e+00gi|260223124|emb|CBA33374.1| hypothetical protein Csp_B18730 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  24  13.KSLSGLLPFLRPYRARIGMALVFLVLAAGATLAFPVALRSLIDGGLVQTDKGAQMMALFAALFGVAALGLFSAARFYMVSWLG----ERVTADLRNAVYGHVLKQSLEFFETTQTGEVLSRLSADTTLVQTVVGSSLSMGLRNAVMGIGALGVLVWTNPXXXXXXXXXXXXXXXPS-LWFGRRVRKLSRASQDRVADSSAIAAEVLNAIPVVQSYTAEGRETGRFVASTDNAFATATKRSLMRSGLVAFIIIATSAALLWGLYQGTQAVAEGRITAGHLGQTVVYVIILASAFAVLGEVYGDLLRAAGATERLMELLGTQSPITSPSNPVLPSAGSAIKFEAINFHYPSRPQQALQNFSLDVKPGQTVAIVGPSGAGKSTVFQLLLRYYDPQSGSIALDGVETRSQALDALRQRVGIVPQDAVIFSSSAMENIRYGKPDASDAEVKAAAHAAFAHEFIEPEGYDTFLGERGVRLSGGQRQRIAIARAMLKNPPLLLLDEATSALDAESERMVQAALESAMRDRTTLVIAHRLATVQKADLIVVLDHGVLVEQGTHAELVARGGVYAGLA... 586
21 0.000e+00gi|495304542|ref|WP_008029292.1| ABC transporter [Rhodobacter sp. SW2]  clstr ali  24  23..ALRGLMPFLAPYRTLTTAALVALVLTAAISLILPLAVRRVVDG--FAADNASLLDQYFXXXXXXXXXXXXGTGLRYY--LVT-RLGERVVADIRRALFDRVMGMSPAFFERILTGEVLSRLTTDTTLILSVIGTSVSVALRNLLLLVGGMAFLMFTSAKLTGLVLLIVPAVVIPI-IVLGRRLRVLSRENQDWIAASSGNASEALLSVQAVQAFTNVDRARATFGNVTEKSYESAKKRIGTRALMTVIVIFLVFTGIVGVLWIGARDVRDGTMSPGQLVQFLIYAVMVSGAVGALSEIWGEIQRAAGATERLVELLHTVDPVQDPAQPRALPRPGEISFEGVHFQYPARPGSALDGVDLHVMPGETVALVGPSGAGKTTILQLLLRFYDPQQGAVKLDGIDLREMSRGDFRRAMALVPQDPVIFAASARENIRFGRPDATDXXXXXXXXXXXXXXXXXPEGYDTYVGERGVMLSGGQKQRVAIARAILRDARVLVLDEATSALDAESERLVQAAVERLSEGRTTIVVAHRLATVKRADRIVVFDQGRIVATGTHDALVAEGGLYAHLAK.. 590
22 0.000e+00gi|499775301|ref|WP_011456035.1| ABC transporter [Jannaschia sp. CCS1]  clstr ali  25  32...LKGLLPFLSNHKPMLAGSIMALVLTALVSLALPLAVRRVVDG--FETEATELLDQYFMAALGIAGLLALGTGLRYY--LVT-RLGERVIADIRKAVFDRMITMSPAFYERIMTGEVLSRITTDTTLLLSVISSSMSIALRNLLILIGGIALMLWTAPKLAGAVLLIVPLVVVPI-VILGRRLRVLSRQNQDWIAESSGNASEALLSAQTVQAFTHEAPTADRFTKVTELSFDSAKKRIATRAVMTVIVIALVFSGVVGVLWIGARDVRAEAMTIGALIQFLIYAIMVAGSVGALSEIWGELQRASGATERLVELLGTDDTVADPSNGVGLPQRGAIIFDDVQFHYPTRPEAALDGLSFQIQPGETVALVGPSGAGKSTVFQLLMRFYDPDTGQISLDNTPLPDMTRQTFRSAMALVPQDPVIFAASARDNIRFGRPDATDADVEXXXXXXXXHGFISPKGYDTYVGERGMMLSGGQKQRIAIARAILRDAPILLLDEATSALDAESERAVQDAVTRMSKTRTTLIVAHRLATVKQADRILVFEGGKIVSEGTHDALVSQGGLYARLAQ.. 598
23 0.000e+00gi|558634426|ref|WP_023509275.1| amino acid ABC transporter ATP-binding protein [Sporolactobacillus laevolacticus]  clstr ali  27  4.....WLVPSIKKHWRGFSLAAFLSLMAILCASGLLFTSGYLISKAALRPENILMIY---VPIVGVRTFGTFRAVFNYVGRLASHNTILKVLSEMRAHLYEKLEPAALFIRSKYKTGNILSVLSEDIEHLQDLFLRTVLPGGIALVIYALWVAMLGLFSPSFXXXXXXXXXXXXXXXPFISLIWMRKFHRRISKSRHQLYEQLTDAILGSADWMMSGRQEQFIVSYEKLEKESRLAEYTLDNFRKWRDFAAQALIGICVVITVIWSGHMVQADSMDRTLIAAFALVIFTISESLVPLSEAIERLPQYKQSLNRLEEIKNVEDKLTKQVMSKNWDQPAEIEVNHVFFKFAETEDWSVNDVSLSVPQGAKMAVIGRSGAGKSTLAHLIYGALVPSEGSVTLNGTP-AHMIGEMRSKQISVLSQNPHLFDTSVLNNLALGSPQATIDDVVRAAKLVGLHQLIEPEGYHTQMHEAGSIFSGGERERLALARILLRNAPVVILDEPTVGLDPITERTLLKTIFKTLEGKTLIWITHHLTGTEKMDQVLFMENGSIHLKGQHAQLMRESDRYRSLYE.. 570
24 0.000e+00gi|917346024|ref|WP_051952736.1| ABC transporter [Methylocapsa aurea]  clstr ali  26  21.RALLPLLPYVLRYKARIAGALLAVTVASAATLAVPLAIRRMIDFGFSV-DSAGVINTYFFALIGVAGILALASGSRYYFVTT---LGERFVADLRTDVFKHLCRLDAGFYDTAQTGELLSRLTADTTQMKTAFGATAALALRNFFLFLGSIALMVYSSPKLSAVVLI--AIPVIVLPLVSGRSVRKRSRKAQDTLAEASAYAGENLAAVRVMQAYGAEPATSQRFGAAVEEXXXXXXXXXXXXXSLSFVAIFLIFASIVGVLWFGAQDVLADRMTGGLLSQFLLYAILGASALSELSQVWGEISSASGSAGRIAEILAVQPTIQAPAAILPSPSRGDIRFEHVDFSYPTRPDAALHDLSFKIAAGETVAIVGPSGAGKTTLFQLLSRFYDPTSGRILLDGVDIKTADPAELRRRIKSVPQDPVIFSASIADNIRYGAPEASDEAVXXXXXXXXXXXFIRPEGYATRAGERGVTLSGGQRQRIAIARAILQEAPVLLLDEATSALDSENEVLVQTALEKVMSERTTLVIAHRLATVLNADRILVLENGQLVEEGVHATLVAKDGLYARLAK.. 590
25 0.000e+00gi|357937152|gb|AET90710.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Burkholderia sp. YI23]  clstr ali  22  22.SPLFALLPFLRPYAARWAVAFLALLTSAGATLALPVAFKYLIDRGFASGEHAHIDRYFIALFILSLVLAGATALRFYCVSWLG----ERVTADIRRAVYDHATRMSPEFYETTQTGEVLSRLTTDTTLIQTVVGTSLSLGLRNSLLTFGGLAMLVITSPVLSGYIIATLIVVVAPI-VIFGRQVRRLSRDSQAKVASASALAGEVLNAMPTVQSYTQEAHESRRFEGAVEAAFDTALIRIRARAGLTXXXXXXXXXXXXXXLWLGAKAVLAGEMTAGQLSQFILYAVFTAGAVGAVAEVWGDLQRAAGAAERLLQLLAMRSPVAEPETTIPLPRHAEIRFENVSFSYPSRPGSALSGFTLEVGPGEHVALVGPSGAGKTTLFQLLLRFYDSQSGNIFISGVPTRQVSLAELRKSIGVVMQESVIFSGSVLDNIRYGKLDATLHEVQRAAEMAAAADFINPQGYDTYLGERGVRLSGGQRQRIAIARAILKDPPILLLDEATSALDAASERLVQTALNNAAHNRTTLVIAHRLATVQQADRIVVLDQGRIVAQGRHAELLEHSPLYARLA... 589
26 0.000e+00gi|873892770|ref|WP_048599288.1| ABC transporter [Nereida ignava]  clstr ali  26  24..ALRGLVPFIKPYTALLVAAVFALISTAVISLVLPLAVRRVVDN-FNTGDAEILDQYFXXXXXXXXXXXXXTGLRFY---LVT-RLGERVVTDIRMAVFDRVIGLSPAFFEKIMTGEVLSRITTDTTLIQSVIGSSISIAARNALILLGGMVLMLLTSAKLTSLVLLIVPAVIVPI-IVLGRRLRMLSRENQDWIAASSGTASETLLAVQTVQAFTSEGHTRAQFADVTEKSFVAAKKRVLTRALMTVIVIFLVFTGIVGVLWIGANDVSAGAMTAGELVQFVIYAVMVAGAVAALSEIWSELQRAAGATERLVELLHAEDTVLDPASPVALPDAGTVSFEDVTFRYPARPAAALDGISFSVKPGETVALVGPSGAGKSTIIQLLQRFYDPQAGRIMLNGVDLRDMERAAFRRAIALVPQEPVIFAASAADNIRFGMPAATDAEVIXXXXXXXXDEFLSPEGYDTYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAASERAVQQAVQTLSANRTTLIVAHRLATIKQADRIVVFDQGKIVATGTHDELVAQDGLYARLAR.. 591
27 0.000e+00gi|738677160|ref|WP_036576966.1| thiol reductant ABC exporter subunit CydC [Oceanobacillus picturae]  clstr ali  31  1MKDLAIVTKLMMFEKRDIFLSILVGFIAGIAGVGLFAASGYLISKAALAPP----LYALIVLTSTVKLLGFTRALTRYAERYFSHRATFTILSNLRVSFFEKIEPLAPGIFQKYRSGDLLARIVGDIESLQNFFLRVFYPPIVLVLVFLSTLFFTAFFSIYAAFVLFLGLVMTGFVVPAIFAIKQRRIDQDVRENRAVLSTDVTEYLYGFRDLKVYQQLESREEQLLQSSGQYIKEQEVEGISKLFSQSLNTLVSHIITAIVLGLGVYLVANGSLEGVLLAMLVMISITVFEDASPMAAFPIYYHDNQRAARRLFQVVKEDKTAANDSNLSSIPDEPSVSMDSVTFTFEDEWRPTLKDISFELEKGSKTAIVGPSGSGKSTILQLILKLYEPVQGDIQLNNLSLSSSNKESIWSLANVVLQENHFFFGTIKENLLLAGDDLTDEQLTEALQQVNLNRF----SLSDEVLEKGANLSGGEKQRLAIARALLKKGKLWLLDEPTSSVDALTEKSIHECILRQAEKDTLILVSHRLAGMEKMDHILVMDQGEIVEFGSYEELMDKKGYFYEMKE.. 564
28 0.000e+00gi|746126061|ref|WP_039191575.1| ABC transporter [Aureimonas altamirensis]  clstr ali  25  16LRPLRKLLPYLAANRGLVAGAVIFLALASLTTLSLPLAVRRVIDLGFDTPDT-RFVDTYFAMLVVLAGLLAVASAGRYYFVVT---LGERVVASLRKDVFAQVTLLSQDFYDRTMSGEIVSRLTADTTQVKSAVGSTASLALRNAILVTGSLAMMVFTAPALSFXXXXXXXXXXXXL-IAIGRQVRRKSRAAQDTLAHASAYATEAIGAMRTVQAFTAEDMATRRYAQAVDDAFEAARGTIKARAFLTAFAIFLVFSSIVAVLWIGSQQVITGDMTAGTLGQFILYAVFAASALGQLSEVWGDLALAAGATERLTELLAEEPSVPEPALPMPQPARGAIAFHDVSFAYPAGGMPAVSGLSFTIRPGETVAIVGPSGAGKSTVFSLIERFYDPTSGRIQMDGCDIRAVSLNALRSRIALVPQDVAAFAASIADNIAFGRSDATRDEIEAAARSAMAEGFIRPDGYDTRVGERGVTLSGGQRQRLAIARAILRDAPVLLLDEATSALDSQSERAVQEALETLMRGRTTLVIAHRLATVLKADRILVMSGGRIIEEGTHASLSASGGLYSELAR.. 585
29 0.000e+00gi|640619744|ref|WP_025047796.1| ABC transporter [Sulfitobacter mediterraneus]  clstr ali  25  30..ALRALAPFMWPYRALMIAAVLALISTAVISLTLPLAVRRVVDNFGTSEP--ELLDQYFLAALVIAGLLAVGTGLRYA--LVT-RLGERVVADIRKAVFDRVIGMSPAFYENIMTGEVLSRITTDTTLILSVIGSSVSIALRNVLIFLGGLVLMLLTSAKLTGLVL--LIVPAVVIPILTGRRLRVISRENQDWIAASSGNASESLTAVQTVQAFTHEMASRGQFAQMTEASFDAARRRIKTRAAMTVIVIFLVFSGVVGVLWIGARDVRADQMSAGALVQFVIYAVMVAGAVAALSEIWGELQRAAGATERLVELLQTEDAVQDPANATPLAQPGLIAFEDVHFAYPARPDVALDGVTLNIAPGETVAFVGPSGAGKTTIIQLIQRFYDPASGRITLDGVDLRRLARNDFRRSIALVPQDPVIFAASAAENIRFGRPDASXXXXXXXXXXXXXHEFITPEGYDSYLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQLAVDKLSADRTTLIVAHRLATVKKADRIVVLEAGQIVATGTHDELVAKGGLYARLAR.. 597
30 0.000e+00gi|476514456|gb|AGI72465.1| ABC transporter ATP-binding protein [Octadecabacter arcticus 238]  clstr ali  26  86..ALTALWPFMRPYGWMIALAGIALVSTAMMSLVLPLAVRRVVDN-FDIAESGLL-DGYFAAALGIAGLLAVGTALRY---YFVTRLGERVVADIRVAVFDRMIGMSPAFYERIMTGEVLSRITTDTTLILSVIGSSVSIALRNSLILVGGIGLMLFTSVKMSLMVLWXXXXXXXXX-XXXGRKVRRLSKENQDWIAQSSGDASEQLLSAQTVQAFTHESQSRGNFHRVTEQSFIAARRRIATRAILTAIVIFMAFSAIVGFLWMGASDVRGGVITVGELVQFMIYTIMVAGGVAALTEIWSELQRAAGATERLVELLTTTDAVTDPVQALAAPDHGRIAFENVGFVYPSRPGPALDGVSFTVELGETIALVGPSGAGKTTIIQLLLRFYDPSSGRITLDGDDLRDLNRADFRRHMALVPQDPVIFATSARENIRFGRPDASDAQVEXXXXXXXXHDFLTPDGYGSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVDHLSKDRTTLIVAHRLATVKKADRIIVFEAGGIAAVGTHDTLVAQGGLYARLAR.. 653
31 0.000e+00gi|737721853|ref|WP_035690686.1| ABC transporter [Azospirillum halopraeferens]  clstr ali  25  34.........FLAPYRWRIXXXXXXXXXXXXXVLGLGQGMRVLVDQGFAEGDAALLDRALLVLLGVIVLLAASTYARFYLVSWIG----ERVVADLRRAVYDHVLRLSPGFFETTRTGEILSRLTTDTSVLQVVVGSSVSIALRNTLLFLGGSIMLLVTSPKLTGXXXXXXXXXXXXX-XXXGRRVRALSRDSQDRVADVGAFIDETLSGIRTVQAYTHEGRERSRFAGRVEDAFAVAVRRVQMRAIMTVIVIVLVFGAVGTILWIGGHDVLTGRISPGQLSAFVIYAIVVAGSVGAISEVIGDLQRAAGATERLFDLLATEPDIRAPAAPQPLPEPGAVAFRDVRFHYPSRPDPALEGFTLDVQPGETVALVGPSGAGKSTVFQLLLRFYDPQAGSVLVDGVDVRAADPQDVRRRIGLVAQDPVIFSADAWENIRYGRPDATDEEVRAAAEAAHALDFLEPDGLSTFLGEKGVRLSGGQRQRIAIARAILRNPPILLLDEATSALDAESERVVQDALEKLMRQRTTLIIAHRLATVLNADRIAVMDGGRLVASGRHADLIREGGLYARLA... 594
32 0.000e+00gi|946966462|ref|WP_055888118.1| MULTISPECIES: ABC transporter [Methylobacterium]  clstr ali  25  26...LKPLVPFAAVYRGRIVAAFLALLVASGATLVVPIAMRRVIDHGFSA-ENAPVIDAYFAGLLGVVAVLALSSAARYYTVVT---LGERVVADLRSAVFRRLTVLDPAFFDRSQSGEIISRLTADATQVKSVFGISISILLRNAFLFVGAVVMMVITSPRLSVLVLVAIPLIVFPL-ILSGRGVRRRSRAAQDRLAEASAYASEAVGSIRTMQAFGMGRTTAGRFAQASENAYGAARDSVRARSLLTGVAIFLISSSVVGVMWYGAQGVLAGTMTAGQLSQFVLYAVFGASALGQLSEVYGELAQAAGAAERLGEILAAEPVIRAPDAPVAMPSPGELAFEAVRFSYPTRPEAALDGIDFSVSRGERVALVGPSGAGKTTVLQLILRFYDPVSGCVRIDGVDIAKADPDALRQRLSLVPQDPTVFSGTVFENIAYGRPSATEADVRRAAELAHADGFVQPQGYHTVVGERGVTLSGGQRQRVAIARAILKDAPILLLDEATSALDAESERAVQSALDTLMRGRTTIVIAHRLATIRSADRILVLDGGRIVESGTHDSLLAEGALYAQLA... 592
33 0.000e+00gi|594550819|gb|AHM05838.1| ABC transporter, ATP binding protein/permease protein [Roseibacterium elongatum DSM 19469]  clstr ali  25  48...LQALWPFLMPYKPMLAAAITALVLTAIVSLTLPLAVRRVVDG--FETESSELLDQYFLAALGIAILLAFGTGLRYY--LVT-RLGERVVADIRKAVFDRMIGMSPAFYERIMTGEVLSRITTDTTLLLSVISSSMSIALRNTXXXXXXXXXXXFTSAKLTGAVLLIVPLVIVPI-IILGRRLRVLSRQNQDWIAESSGNASEALLSVQTVQAFTNERASASTFAGVTEKSFDSARKRIATRAVMTVIVISLVFAGIVGVLWVGARDVRGDAMSIGELIQFLIYAIMVAGAVGALSEIWGELQRAAGATERLVELLRTDDAVSDPSVGKPLAQQGAIRFDAVRFAYPTRPDSALDGVSFTIQPGESVALVGPSGAGKSTIFQLLLRFYDPSSGQITLDGVPLTDMRRETFRAAMALVPQDPVIFAASARENIRFGRPDASDXXXXXXXXXXXXXXFLSPQGYDTYVGERGLMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQQAVTRLTEDRTTLIVAHRLATVKQADRILVFDEGRIVAEGTHDSLVAQGGLYARLAR.. 614
34 0.000e+00gi|491993771|ref|WP_005710842.1| thiol reductant ABC exporter subunit CydC [[Haemophilus] parasuis]  clstr ali  51  1MRSLFPFLALYKTHFGRLTLGIILAITNLTASIGLLSLSGWFLAASALVGSS--LLFNFFYPSSGVRGLAIGRTISRYFERLVTHDATFRVLANLRIAVFSKLIPLSPAGLNRYRHSELLNRLVADVDTLDTLYLNLLSPFISAIMVILFMGIGLSFVSPLLAWVICGTLVALLLIFPTLFYHLGRKLGKIAIQSRATYRSQFIEWIQLNGEFLLFGVLSKATDRLKQTEQQWLRAQSHESQLGGLSNALLMFINGILVTAVIYLSATAVPQADNPEALIALVVFCVLASLEILMPIGMAFLHLGQVIEAAERISEITAQQPAVQFNGTAQTEANQPLITFNQVSFSYSPEHEQVLNHISFEIKKGERIAILGKTGSGKSTIFQLLTRNYDPTSGEILLNGCNIKDYPEKTLRQQIAVLSQRVHIFSNTLRENLRFGNPQATDEALSEALAKVNLSYLLEEQGLDLWLGEGGRPLSGGEQRRLGLARLLLSSADILLLDEATEGLDRDTEQQILKQILSHTQGKTLLMITHRLNGLEQFDRVYRI............................ 548
35 0.000e+00gi|764532576|ref|WP_044409402.1| ABC transporter [Rhodopseudomonas palustris]  clstr ali  26  52LRPLLALAPYVARYRVRXXXXXXXXXXXXXTTLLVPIAVRRLIDFGFS-PEGVALINSYFSVMVAIVAVLALASAARYYLVMT---IGERIVADLRRDVFAHLTALSPSFFDSARSGELISRLTADTTQIKSAVGSSVSIALRNAMMFVGAIAMMVISSPRLSGFVLA--AIPLIVIPLVFGRWVRRLSRNAQDTLANASAYAAELIGAIRVVQAYTNESLAKARFGGEVEQAYDAARSSTKARALLTAIIIFIVFSSVVIILWIGSHDVVSGHITPGRLGQFVLYAVFAASSLGQLSEVWSEVSAASGAAERLFEILRIKPAIAPPAAPRALPERGDVVLDNVCFAYPTRDALVLDHVSLTVRAGEKVAIVGPSGAGKSTLFHLLLRFYDPTSGTISLDGVPISAADPREVRERIALVPQDSVVFAATARDNIRFGREDAADADVERAAAQAHATEFIKPQGFESQLGERGVTLSGGQRQRIAIARAILRDAPLLLLDEATSSLDAESEVLVQTALQELMRHRTTLVIAHRLATVLSCDRIVVMEQGKIVEQGTHAQLVAKGGLYARLAK.. 622
36 0.000e+00gi|495350356|ref|WP_008075082.1| ABC transporter ATP-binding protein [Vibrio sinaloensis]  clstr ali  22  29...LLELTAFIRPYKLKVSAALLALIFTASLTLSVGYGVRILIDEGFAQQSTAELGSAIQFILLITVLISIGTFFRFYLVSSVG----ERVSADIRLAVFNHIIRLHPSYFETNGSGDIMSRITTDTTLLQSIIGSSFSMAMRSALMCIGAIVMLFATNVKLTLIVLAS--VPFVLVPILFYRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSYSYEPQEKQAFAVEVERAYDIGRRRVKQRAILISGVIVIVFSAIAGMLWVGGSDVIQGTMSAGDLGAFVFYAIMVASSVATISEVLGELQRAAGATERLIEILQVKSDITAPEQPIDSFDQVDVQFDQVTFHYPSRPDAAIEGLNLSVQEGKVLALVGPSGAGKTTLFELLQRFYDPQHGTVRIGGIDLRDCEPSQLRQQMALVPQQPALFSNDVMHNIRYGNPNATDEQVIEAAKKAHAHDFILPEGYQSFLGERGVRLSGGQKQRIAIARAILKDPAILLLDEATSALDSESEHHVQQALDQLMQGRTTIIIAHRLSTIQHADQIAVLEHGQLVDIGTHLELMQSCDLYQRLVE.. 596
37 0.000e+00gi|496281603|ref|WP_008993641.1| ABC transporter ATP-binding protein [Novosphingobium sp. Rr 2-17]  clstr ali  27  30..PLRMVWNEMLRYPGRMATAGLALIVTATSTLAIPYGFRHVIDQGFARGADPQVIRWWFLMLLGVVVLALATAVRFYSVSWLG----ERVVADIRLKVQGHLLTLAPSFFEENSPKEISSRMTSDTAIIEQIVGTTVSVALRNAIMAIGGVIYLFMLAPSLTAGLLV--AIPLVILPIAFGRRLRALSRTSQDRVAGIGAITAEVLGALRVVQAFNQEGRELDRFRASVESTFATAKRRMTIRAAMTAVLMFLIFGSITVIMWRGAIGVAEGTITGGTIAAFVVTAGIVAGAFGSLTEVYGDLVRGAGAASRLAELLSENPAIAAPARPQALPQPPRLAFERVTFRYPSRPDPALHDFSLTVEPGETVAIVGPSGAGKSTLFQLAERFYDPQGGVIKIDGVQLASADPAEIRARIALVPQEGVLFAASARDNLRYGNWEADDAAIWDAARAANAETFLRPQGLDTFLGEDGGRLSGGQRQRIAIARALLRDAPILLLDEATSALDAESERLVQDALDRLMANRTTLVIAHRLATVRQADRIIVMDGGCIVEQGTHESLSHAGGLYQRLA... 598
38 0.000e+00gi|923111689|gb|ALB22059.1| ABC transporter [Piscirickettsia salmonis]  clstr ali  40  10.SQLTPFLQPIVAHWRSMSLGLLLGLLTVIAGVGLLSLSGWLISVSAGAGLATALAFNYYLPGGAVRAFSLIRILGRYGERVVTHEATLRILTTLRVWFYQKIEPLAPAGLLTSRSGDLLSRIISDIDTLDEAYLRVVGPFLIAVLLSIILLFFLHFFSIEIAWCVFLLMVLSGFCVPLLALRLGHATGGSLVTELAQLRIHCIDSTQGLMELLSFGHERRAFAQLQTRQGRLLRLQARMNQIDALSQALILLFTGLALWLALYLGAQLVLAQQLNGVNLALIAFAVLAAFEVIMPLPLAFQYLGRTGKAISRLLNLAEQQPVVLFTQDGLDSSGNYSIEFDQVNFAYPGRET-IFNNFNLCIHQGEKVAIVGSTGAGKTTLIQLLTRVFDADSGMIKVGDNNLKDFSEPALRRLMGVVSQRSYLFNMSVRDNLLLAKPTASDKELNQVLKTVQLFDVVQPEGLDTWVGEHGSRFSGGQIRRIAVARALLADHPIILLDEPTEGLDPLTADEFMKNLITLMAGRTVLLITHRLTDVQGMDKIAVMENGQLIECGTEAQLLQANKRYASLY... 587
39 0.000e+00gi|497205879|ref|WP_009520141.1| MULTISPECIES: ABC transporter [Hydrogenophaga]  clstr ali  26  14.RSLTGLLPFMRPYRLQMGXXXXXXXXXXXXXXXFPVALRLLIDDGAGRGDQVLALREHFAALFGVAALGLFSAVRFYLVSWIG----ERITADLRNAVYRHVLRQSPQFFETTQTGEVLSRLTADTTLVQTVVGSSLSMGLRNAVMGIGALVMLVWSHPYXXXXXXXXXXXXXXPA-MWFGRRVRRLSRASQDRIADSSSIAAEVLNAIPTVQSYAAEGRESQRFDQSTQHAFETAVRRTKARAVLVAFIIIANAALILWGMFQGTQAVLDGQLSPGQLGQAVFYVVIFAGAVAVLGEVYGDLLRAAGASERLVELLASESPVKSPPQALAAPLPAALAFEGVHFNYPSRPQAALDGFSLTVEPGQTVAIVGPSGAGKTTVFSLLLRFYDPQQGRIVLDGTPINALQLQDLRERIGIVPQEPVIFSSSAMENIRYGKPGASDEEVKAAARAAFADEFISPEGYDTFLGERGVRLSGGQRQRIAIARAMLKNPPLLLLDEATSALDAQSERVVQAALEAAMRDRTTLVIAHRLATVQRADRIVVLDHGRLVEQGTHAELVARGGVYAGLA... 587
40 0.000e+00gi|746021646|ref|WP_039097395.1| ABC transporter [Porphyrobacter mercurialis]  clstr ali  27  18..PLRLIARTASAYPGFMXXXXXXXXXXXXXXXXIPAGFRLIIDRGFSAPDEIGRWFRYLLLIVGV--LAIGTACRYYFVSVLG----ERVVADIRRAVQANLLRLSPGFFEENSPQEIASRMTADTAQIELVVGATISIALRNLIMVIGGTGYLLWLAPELTAILVVAVPLVMLPL-AWFGRRVRAVSRESQDRVADIGAQVAEVLGAMKIVQGFNQEAREAARFADAVERSFDTARRRILLRAVMTGCAIAVIFGSITALMWRGALQVAEGTLSGGTIAAFVLTGVLVAGAFGALTEVYGDLLRGAGAAERLNELLQEVPAVAAPSRPQALPARGSIAFQNVTFRYPTRPEAAVHGFDLAVEPGETVALVGPSGAGKSTIFQLAERFYDPQVGTVRVDGVPLVQADPQEVRRRIALVPQEGVLFAASARDNLRYGRWDADEADIWQAAEAANAAGFLRPQGLDTYLGEGGARLSGGQRQRLAIARALLRDAPILLLDEATSALDAESERLVQDALEHLMQGRTTLVIAHRLATVRAADRIVVMDGGRIVEQGTHAQLTAAGGLYARLA... 586
41 0.000e+00gi|918940162|ref|WP_052639262.1| ABC transporter [Rhizobium sp. NT-26]  clstr ali  25  15.RPLARLLPYLSRYRGLVMGALFALVLSAATTLALPLAVRRMVDHGFAA-ADGSFINNYFGMLLGLATLLALASALRYYFVIT---VGERVVADLRRDVFARVTSLSPAFFDVNQSGEIVSRLIADTTQIKSAFGSAASQALRNTILCLGAMAMMIYTSPQLSGLALG--AIPVIVFPLVFGRSVRKRSRAAQDTLARTSAFASETIGATRTVQAFNGEAAATARYAATVEDAFAAARAAIRSRALLTGFAIFMVFGSIVGVLWYGAQNVLAGTMTAGTLGQFVLYSVIAASALGQLSEVWGELSQAGGAAERLTELLHEIPAVCEPASPIPLPRPGAVTFENVSFAYPSRENSVLNGLSLDVRPGETVAIVGPSGAGKSTIFSLLLRFYDPVSGTIRLDGIDLREASLSDIRSRLALVPQDVTIFAASIHDNIAFGSTGVSRDAVRAAAIAAQAHEFIEDSGYDTLAGERGVTLSGGQRQRIAIARAILRDAPVLLLDEATSALDAESETLVQKALDGLMKERTTLVIAHRLATVLKADRILVMDEGRIVEEGTHQSLVAKGGLYARLAR.. 584
42 0.000e+00gi|498083948|ref|WP_010398104.1| ABC transporter [Paracoccus sp. TRP]  clstr ali  25  18.SALRALGPFLCPYRGLVAAALGALTLTATISLILPLAVRRVVDG--FDGGAGMLDQYFGAAMIIVVLLAIG-TGMRYF--LVT-RLGERVVADIRKAVFQRVIGLSPAFYERVLTGEIISRITTDTTLIQSVIGSSVPIALRNILLLIGGVAMLVWTSAKLSGXXXXXXXXXXXXX-XXXGRRLRKLSRENQDWIAQSSGAASEVLLSAQTVQAFTHEGPTRARFNEVTERAYDSAMNRVRTRTAMTMIVIFLAFSGVLGVLWIGARDVRLEVMTVGQLVQFVIYAVLVAGAVGALSEIWGELQRAAGATERLSELLTAEDTLSDPADPVTLPQPGAIRFDDVTFHYPSRPRSALDGVTLDIRPGETVALVGPSGAGKTTVIQLLLRFWDPDAGRVLIDGIDLRDMARADFRQSIALVPQDPVIFAATARENIRFGRPDASDXXXXXXXXXXXXDDFLRPEGYDSYVGERGVMLSGGQKQRIAIARAILRDAPILLLDEATSALDAESELLVQHAVDELSRSRTTIIVAHRLATVKKADRIVVFDGGRVVAQGRHDELVAEGGLYARLAR.. 585
43 0.000e+00gi|494215001|ref|WP_007131322.1| MULTISPECIES: thiol reductant ABC exporter subunit CydC [Bacillales]  clstr ali  32  1MSELAILTKAMIQERKDIAIAIVGGFIAGIAGVSLFSASGYLISQTVFAPP----LYTLIVLTSLVKILGLLRAASRYAERLYSHRATFSMLSRLRTSFFAKLIPLTPGILGRNRSGGLLARIVGDVESLQHYFLRVAYPPVIVVMVFLATVIFTSVFSIWIACLFVLGMLITAFVVPGIVLLGQRRRQGRVREKRAELSTEVAEMLYGYRDLKVYGQMKKREQLLQDXXXXXXXXXXXXXRHLLRGQSLHAFVAYLISWGVLVLGAVFIMNGSLAGVFLAMLVMASLTVFEEAAPMATLPAYKQDSEHAANRLAEVLDADRRQPQPSGALSTDKAVSVELCGVSFQYEDECRPALKGITLSIPPGSKTAIVGPSGSGKSTLIDLLLKLRVPTSGLIRLNDISVQELNEASIWQASNVVLQHSHFFRGTIRDNLLLDEESYTDEELAAVLEKA----LLPNKSLDDPVYEKGENLSDGEKQRLALARVMLRKGRLWLLDEPTSSLDYVTEQRVLSHLLTEAADDTLLLICHRLTGLEKMDRIVVLDQGRVVEAGTYTELMEQKGYFYEMK... 563
44 0.000e+00gi|960344292|ref|WP_058240408.1| ABC transporter [Shimia marina]  clstr ali  24  21.SALRGLRPFLKPYRFHAFLALCALTLTASVSLMLPVAVRRVVDN--FGTESDALLDKYXXXXXXXXXXXXVGTALRYL--LVT-KLGELVVTDIRKAVFARVINMSPSFFETLMTGEVLSRITTDTTVIQSVIGSSISIALRNVLLFFGGLALMLFTSTKLTLMVLLVVPMVIVPI-MVLGRRLRRLSRENQDWIAESSGNASEALLSVQTVQAFTHEAQTRAGFDRVTDLSLSAAMRRINTRAVLTMIVIFLIFTGVVVVLWMGARDVRAGGMSVGVLVQFVIYSVMVAGSVGALSEIWSELQRAAGATERLVELLYAEDSVLDPDAPLALPVKGEITFADVSFRYPARPDPALDHVDLTIQPGETVALVGPSGAGKTTIIQMLQRFYDPVSGEVRLDGVPLPQMQREAFRQHMALVPQDPVIFAQSARDNIRFGRLDASDXXXXXXXXXXXXHEFISPEGYDSPLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQAAVDALSQDRTTIIVAHRLATVKKADRIIVMDEGRIVAQGRHDDLVAQDGLYAKLAR.. 589
45 0.000e+00gi|388275317|gb|EIK94905.1| ABC transporter permease/ATP-binding protein [Pseudomonas sp. M47T1]  clstr ali  25  11.RALRLALHFLYPYRWRALGALVALVVTAGITLSMGQGIRLLVDQGFLTQSPELLNRSIGVFMLLVMALAVGTFVRFYLVSWIG----ERCVADIRQQVFDHLIYLHPGFYENNRSSEIQSRLTADTTLLQSVIGSSLSLFLRNALMVVGGIVLLFITNPKLTSIVVIALPLVLAPI-LVFGRRVRGLSRQSQDRIADVGSYVAETLNQIKTVQAYNHQAEDQRRFGVTVEQAFDTARKRIVQRSWLITLVIVLVLGAVGVMLWVGGMDVIAGRISGGELAAFVFYSLIVGSAFGTLSEVLGELQRAAGAAERIGELLQASSEIRPPVQVLPARVSGRLALEQVLFAYPSRPQPAVNGLDLVVEAGETLALVGPSGAGKSTLFDLLLRFYDPQQGRILIDGVDLRHLDPKDLRRHFALVSQSPALFFGTVEDNLRYGQADAPLEQVQQAARIAHAHDFIEPQGYQTHLGEAGLGLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEHLIQQALPSLMHGRTTLVIAHRLATVQNADRIAVIEQGRVVAVGTHRQLIAANALYARLA... 580
46 0.000e+00gi|755143215|ref|WP_042493236.1| thiol reductant ABC exporter subunit CydC [Weissella hellenica]  clstr ali  25  13.....WVFPYLKSYKKLLVLILFLGFMTIFCGAALMFTSGFLISRSAQIPENILMVY---VPIVLTRAFGIGRPSFRYVERLVSHDWVLRIVSKFRKRLYQLVEVGTKSVYAKSQTGEVLGVLDNDLFKIENFYLRTLFPTAIGLFVYVLITIGIGVFDWGFALAVFLMLGMITILTPIITIVVNGARDYKQQQLEGQLYTDLTDSVMGLQDWILSGRTSELFERQQNDFNAINKIKAKQNHFNWWRDMFGAVIIGATAIILLIFATNHFGSDSFGVNWIAAFVLAIFPVQDALTAISTGIGEWPRYKNSIQRLNQMDDQTELQENVTQEKVAITHPEIKFNQVNFGYNDAT--VLENLNLTIKDGQKLAILGQSGAGKTTFLKLLLGDEQPNKGTVTINNYDVKTL-QEERSSIIAVLDQQPYLFASSVANNLRLGNLDATNEELWQALQQVSLADLVKPEGLDTPMTEMGNRFSGGEKQRFALARVLLQNTPIVILDEPTVALDPITELNVLNTIFEVLAYRTIIWVTHHLTGIELVDQLIFIEDKKISMQGTPQQLMVTELRFKKLLE.. 576
47 0.000e+00gi|657037986|ref|WP_029281069.1| thiol reductant ABC exporter subunit CydC [Bacillus indicus]  clstr ali  30  1MKDISHIVRLMWNEKRDIWLTVLLGFLAGITGIALFASSGYLISKAALLPP----LYTLTVMLALLKLAGIARALSRYAERLVSHRATFTILKDVRASFYEKLEPMVPRIFNTYRSGDLLSRIVGDVENLQNFFLRVFYPPVVFLFVFLSTIAFVSFYSVPIAMMLLAGMVLTGMAIPAYFAYRQKKWDDSVRDMRSLFSSEAAEFYYGYRDLKIYGQTAEKEEKLRRLSDLLADKQAQLDNRVNQTQSINTAITVIINCGILALGAYQAAAGELNGLYLAMLVMISLNVFEFAVPMAAFPVYYEESRRASKRLYSFPEEPVLQEEKKQDDITQDGFSIHVKNVHYSY-GAAGSGLKGVTVAFPQGSKTAVVGPSGSGKSTLLMLLMKMYEPESGEITLNEKPLADIISESLWEGCNIVLQDNHFFYGTIRENLLIAKEEAEDADLLHALKEAGL----ENKRLDDLVLEKGDNLSGGEKQKLAIARILLKKAGLWLLDEPTASMDLLSEQSIHNTLFEHARHQTLILVSHRLTGLEKMDQIIVMDQGRILEKGPYEELMRRKGYFYGLKQ.. 563
48 0.000e+00gi|544829022|ref|WP_021244885.1| ABC transporter ATP-binding protein [Sphingobium baderi]  clstr ali  27  20...LGMVWRFARRYPARIAGAALALLVSSAATLAIPAGFRLVIDKGFMGGGDIGRWFEYLFLIVTV--LALATAVRFYFVAWLG----ERVVADIRSATQANLLRQAPRFFEENRPSEIASRMTSDTAVIDQVVGSTVSVALRNIVTGVGGLVYXXXXXXXXXXXXXXGIPAIVLAM-VSLGRRVRKLSRVSQDRLADVGSVTSEVLGAMKIVQAFGQEKREAARFDSTVEAGFATARRRILLRACMTAVVIALVFGSITAVMWQGAVDVAAGRLSGGSIAAFVLTGGLVAGAFGALSETWGDLLRGAGAASRLHELMTARPQILPPARPRALPRPAELEFDKVHFHYPTRPQAALNGVSLDIAPGQTVAVVGPSGAGKSTLIQLALRFYDPDTGEIRLNGVPLREADPAALRDMMAMVPQESIIFAASARDNLRYGRWDATDEDIWAAARAANAEAFLRPDGLDSQLGEGGSRLSGGQRQRVSIARALLRDAPILLLDEATSALDAESEELVKDALERLMRNRTTIVIAHRLATVRAADRIVVLDEGRVVEQGTHAALVAEGGLYARLAR.. 586
49 0.000e+00gi|517518956|ref|WP_018689164.1| hypothetical protein [Ahrensia kielensis]  clstr ali  25  17.RPLAALLPYLTRYKKLVAGAIISLFMAAITTLALPTAVRRVIDHGFS-GEDAALVNSYFTMXXXXXXXXXXXXXCRYFFVIT---LGERVVSDVRRDVFQNVMTLSSTFYDTAQSGEIVSRLTADTTQIKSAVGATASLALRNTILGVGALIMMVITSPSLAGIVVG--VIPLIVLPLIFGRRVRTKSRTAQDTLANASAYASEAIGAVRSFQAFTNETAASNQYSDAVDTAFRAARSAIGARSILTAFAIFMVFSSVVAVLWIGANRVLSDEMTPGTLGQFLLYAIFAAGALGALSEIWGEMQLAAGAAERLSELLVEQSDIKSPEIPLPLPQPGTVGFENVTFAYPTRPQDTLKGLSFDIKSGESVAIVGASGAGKSTLFGLLMRQYDPQTGTIKIDGLDVRDLDLKQAREHMAIVPQDVTILSGTVAENIAFGKPNATAEEIKAAAIAAQAQGFIEPEGYDTQVGERGVTLSGGQRQRLAIARAILRDAPILLLDEATSALDAENETLVQKALEKLMEGRTTLVIAHRLATILKADRILVMDDGQIVETGNHETLSAKNGVYARLAQ.. 587
50 0.000e+00gi|947958305|ref|WP_056618254.1| ABC transporter [Sphingomonas sp. Root241]  clstr ali  26  16LSNLLVVWSFTRHYPLQLAVATLALIASSVATLWIPRTFKQIVDNGFAKGADTSTISVYFGLLLVVLVLAIATAVRFFFVSWVG----ERTVADIRMAVHRNLLRLPPKWFEENRPSEIASRLTSDTAIVEMVVGNTVSTALRNLLTGVGGIVYLFTLAPKIAAFLLVGIPVIVLPIVWLGGR-VRALSRSSQDRVADIGSIASETLGAMRIVQAFGQEKREAERFEGAVTRSFAAAKRRFGLRAVMTAAVIGLLFTAITLIMWDAVYGVAEGRISGGSITAFVITAGLVTGSFGALTEVYGELLRGSGAASRLAELLREQPDIAAPANPVPLPQPGAVAFEHVTFRYPTRPEAVLADYSLDIRPGETVAVVGPSGAGKSTLFQLLQRFYDPEAGVVRIDGVDIRQADPAEVRARMAMVPQETVIFAASARDNLRYGAWDAGDEXXXXXXXXXXXGDFLRPQGLDTFLGEGGARLSGGQRQRIAIARALLRDAPILLLDEATSALDAESERLVQDALERLMENRTTLVIAHRLATVRAADRIIVMDEGRIVETGTHAELVGTSGLYARLA... 586
51 0.000e+00gi|754836184|ref|WP_042198165.1| amino acid ABC transporter ATP-binding protein [Paenibacillus sp. G4]  clstr ali  27  1MKREGWFAPYASSYFWRFLLIIILGSLTIFSASSLMYTSGFLISKSSIPPENILMVY---VPIVGVRTFGTSRAVIHYVERLVGHDTILRILSKMRIRLYNILEPQALFLSSRFRTGDILGMLADDIEYLQNVYLRTVFPSXXXXXXXXXXXXTLGTFNLAFALIIGLYMLVLVVVLPLISLLFTQRRQRQVKQERNRLYQKLTDAVLGMGDWMISGRQAQFVATYEADEREVARTDGALRSWARLRMFIGQAVVGVAVLSMLYWSAGEFADGAIAGTLIAAFVLVVFPVADAFLPVSEAVEKIPQYRNSLDRLNGVEEAQGAVAAQVRGILADGQARIELKSAGYRYTADAAWSVQNLSLDLPQGRKIAVIGRSGAGKSTLLKMVQGVIAPAAGSVTINGADASAY-GEQIPQLIAVLNQSPHLFDTTVANNIRLGDPEASEESIRKAAALAKLDTLISPEGYNTPVREAGQRFSGGERQRMALARILLQNTPVVVLDEPTVGLDPRIERELLATMFEAMAGKTLIWVTHHLVGAEQMDEVIFMEDGRVEMRGTHAQLMEREPRYRKLYE.. 582
52 0.000e+00gi|518295740|ref|WP_019465948.1| ABC transporter ATP-binding protein [Dyella japonica]  clstr ali  25  16..ALTQLWPFVKPHRGLALGWLVFLGISSSATLILPMAVRHMIEQGFGHASASA-INTTFIGLFGVALVLAFATAARYYCITL---LGERALASLRSKLYAHVIRLDVGFFERNRVGELISRLGTDTEVIQALIGSGISIALRSAVMLLGATGLMIWTSPRLAGLTALVIPAVMLPI-IVFGRRVQRLSRASQDRLADTAAIANETLNAAPAVKAYAREDIESTRYAAAITRALATARKRIGMRAALTATVIVLFFGAITLVLWAGARDVLAGTLSAGVLGQFVLYAIFAAGSLAGLSEVWGDVLRAAGAMERISELFEERADIISPATPTPLPVQGELRFENLGFHYPTRPDPALYDFNLVIRPGETVALVGPSGAGKSTVFALLLRFYDPQTGRITLDGVDLRALTLPELRGAIALVPQETVIFGGSAADNIRFGRQDADDDEVHDAARAAEAHEFIMAKAYDEELGERGVRLSGGQRQRIAIARAILRDAPLLLLDEATSALDAQSEAAIQQALERLEKGRTTLVIAHRLATVQRADRIVVMDGGRIVAQGTHQSLLAEGGLYAELAR.. 584
53 0.000e+00gi|503584074|ref|WP_013818150.1| ABC transporter [Methylomonas methanica]  clstr ali  24  16.SVLRNLWPFIRPYRGRMLLAFXXXXXXXXXXXXVPLAFRDLIDFGFGQQPASLSLNGHFAALFGLACLWALAIAGRY---YTVNWVGERVTADLRSAVYARVVQQSPAFFETLQTGEVLSRLTGDTTLIQTVVGSSISMGLRSLFQCVGGMAMLAMTSFYLFSLNLGLMSVLMLPL-FAIGRQVKKLSRESQDKIADASALAGEILNAVPTVQAYTQENSEIQRFAKRAELSFITAIRRSRFRAALSALIIMAVMGSIVFVLWVGAQQVRAGEMSGGQLAAFVLYATLVASGVSTLAEVWGDLMRAIGAAERLMELLRAQTAISDAADGRADADAAEIAFRHVVFSYPSRPQPALAQINFTISAGESVALVGPSGAGKTTLFQLLLRFYDAGQGEILFNGRDIRRLSLQNLRSNIAIVPQDAVIFSENALENIRYGRPAASDAEVLRAAQAAQADEFIRPEGYQTFLGERGVRLSGGQRQRIAIARAMLKNAPLLLLDEATSALDAESEILVQEGLNAAMQGRTSLIIAHRLATVKKVDRIIVLDQGRVVEMGSPEDLRKQGGLYARLA... 594
54 0.000e+00gi|754780237|ref|WP_042144125.1| MULTISPECIES: ABC transporter ATP-binding protein [Pseudoalteromonas]  clstr ali  25  13...LLPIFAFVKPYKIMVASALIALLLTAAVNLSLGQGVKFVIDNGFIAGSQEQLSSAILILIAMISLLAVGTFCRFFLISLLG----ERVSGDIRKAVFNKIVSLHPSYFEENRSGEIMSRLTTDTALLQSIVGSSFSMALRSFLMLIGGIIMLLFTNLKLTLIVLACVPLILIPM-MIFGKKVRKLAASSQDAIADIGTYAGEIIQNIKVVQSYNHEEKEKNAFGSEVEKAFNVAKQRVKQRSFLIAVVIFLTFSAISFMLWIGGMDVLSGKMSGGELGAFVFYAIMVAMSVATIAEVYGELQRAAGSATRLLELLKVKSDISIVEAPLTVSKTVDIEFENVNFSYPSRPDPALKNINLMIPNGKTVALVGPSGAGKTTMFELLQRFYDPQSGEIKLKNSNITQISLTELRHTMGMVPQHPILFSTDVWHNIRYGKPDATDDEVINAAKQAHAHEFIENQGYDSFLGEQGVRLSGGQKQRIALARAILKDPEVLLLDEATSALDAQSEHHVQAALDQLMENKTTVIIAHRLATVLHADLIVVMDKGEIVGTGTHNSLLQSSPLYNRLCE.. 580
55 0.000e+00gi|739395222|ref|WP_037255791.1| ABC transporter [Rhodovibrio salinarum]  clstr ali  23  27.RVLSELWTYLRPYKGYLVLSLLSLVAAAGTTLALGRGLQLLIDQGFAEEDAALLDQAVLVLFAVVAILAGAAFARFYLVTWLG----ERVVADVRRDVFRHVIGLSPGFFETTRTGEVLSRLTTDTTLLQVVVGTSVPIALRNIMTLVGGVALLFATSPKLTGLVFLVVPLVLIPV-IVYGRQVRKLSRASQDRVADVGVYIDESLSNIRTVQAFNHEPIDRARFQERVENAFDTAIKRTIARASLTAMVILLVFGAIAVVLWVGGHAVLDGTITAGQLSAFVFYSVVVAGSVGGLSDVVGDLQRAAGATERLLDLLSTETEIEAPANPATLPSPGRVGFEEVVFHYPSRPDAALEHFDLQVADGEKVALVGPSGAGKTTVFQLLLRFYDPSQGRVMLDGVDLKNADPSELRRHTGLVPQEPVIFSADAMENIRYGRPEARDDEVIAAAEAANARAFIEPEGFKSFLGERGVRLSGGQRQRIAIARAILKNPEVLLLDEATSSLDAESEKVVQEALDHLMQGRTTLIIAHRLATVLKADRLVVMDKGRIVETGTHQELLEKNGLYARLA... 595
56 0.000e+00gi|938259571|gb|KPP94853.1| ATP-binding cassette, subfamily B, bacterial [Erythrobacteraceae bacterium HL-111]  clstr ali  27  49..PLRMVYREAAKYPRQVXXXXXXXXXXXXGTLAIPAALQLIVDRGFQGAGDIGRWFRYLMVIVVVIALG--TAARFYYVSWIG----ERVVADIRRKVHANLMRLSPSFYEANSPKEISSRMTSDTAIIETVVGTTVSVALRNIFLGIGGTVYLFWLLPELTIWLAVGIPAIILPI-VLFARRIRSISRDSQDRVADVGAMVTEVLGAMKIVQSFNQQAREADRFGAAAERTFDTARRRIVLRAAMTALIILAIFGSIVLLLWRGAEGVAAGDITGGTILSFIVGATIVAGAFGALTEVYGDLLRGAGAASRLAELLDAKPAIAAPEKPEQLPEPGSLSFRNVTFRYPARPEAALKDFTLEIEPGETVAIVGPSGAGKSTIFQLVERFYDPQAGTIRIDGVALTRADPAAIRDRLALVPQDGVLFSADARDNLRYGKWDASDEEIWEAARAANAETFLRPHGLDTYLGEGGTQLSGGQQQRVAIARALLRDAPILLLDEATSALDAESERLVQDALEKLMADRTTLVIAHRLATVRAADRIVVLDKGEVVEQGSHVQLASAGGLYARLA... 624
57 0.000e+00gi|653048884|ref|WP_027300478.1| ABC transporter [Rhodospirillales bacterium URHD0088]  clstr ali  25  16.RSLRRVFAFVLPYRLRLVGAMLALIVAAGTVLALGQGLRFLIDDGFRSGSAAPLDHAVFILLGVVLLLATSTYFRFYLVSWIG----ERVVADLRRAIFDRVVSLSLAYFETRRTGDILSRLTADTTLLQTVIGSSLSQALRNALMLAGGLAMLFLTSAKLTSXXXXXXXXXXXXX-XXYGRRVRHLSRDSQDAIANLSAYAEEAINAVRTVQSFTHEAIDRARFGDRAEAAFAVARRRIAMRAILTFLVILLAFGAIAIILWIGGRDVVAGRISAGDLSAFVFYAVVVAGAVGTLSEVWGDLQRAAGAAERIVELLDTEPEIAAPPHPARFPAPGAVAFEGVVFRYPARPRSALDGFSLAVAPGETVALVGASGAGKTTVFQLLLRFYDPQSGAVRIDGVDLRTADPTALRARIGLVPQDPVIFGADAWENIRYGRPGASDAEVRAAANAAHASEFLDPQGFATFLGEKGVKLSGGQRQRLAIARAILRDPAILLLDEATSALDAESEFLVQQALESLSADRTTLVIAHRLATVLKADRIIVIDEGRVVATGTHQELLRQGGLYARLA... 583
58 0.000e+00gi|503700540|ref|WP_013934616.1| ABC transporter ATP-binding protein [Zymomonas mobilis]  clstr ali  27  15LSQLRMIWQFASRYPGWIVAALFALILSSTATISIPAGFRLVIDRGFNDHSNSGDINRYFYLLGIVVVLAFATAVRFYCVSWLG----ERVIADIRTAVDRHLMRMPPVFFEHNRPSEIASRITTDTTLIDQIISSTVSVALRNLITGLGGTLYLLMLAPHLTALLLLGIPVVVVPIIVL-GRRLQKLSRKSQDRIADLSSLIIETLGAIKVVQAFGQETREAIRFHQAVQTAFQVARKRITLRAFMTAIIILLIFTAIILIMWRGTLDVAAGRVSGGTIAAFVLTGGVVAGAFGALSEVYGDLLRGAGAASRLNDLLAEEPAIYSPKHPKKLPAEGTLDFSEVSFYYPSRPDNALKDFNLKVKAGERLAIIGPSGAGKTTLFQLIQRFYDPESGSISLNGIDLREASLSDLRSKIAVVPQETVIFAASARDNLRYGRWDAKDEEIWQAARAANAEEFLKPQGLDSFLGEGGARLSGGQRQRIAIARALLRDAPLLLLDEATSALDAQSEQAVQQALEKLMKGRTSIIIAHRLSTIRSADRIIVMDQGKIVEEGTHDQLIAKAGLYARLAQ.. 586
59 0.000e+00gi|931476467|gb|KPK57757.1| ABC transporter [Gammaproteobacteria bacterium SG8_31]  clstr ali  25  18LRPLKGLLPFLTPYRRMXXXXXXXXXXXXGATLSLPVAVRQMIDLGFSE-ASAETVDRYFLALFGIAAILAFATAARY---YVVTWLGERVVADIRSRVFEHMLTLSAGFYESTRTGEILSRLTTDTTVLQSVVGSGASVALRNALLLIGGFTMLVITSPKLTGLMXXXXXXXXXXX-XXFGRRVRHLSKLSQDRIADTSAIAAEALNAIQIVQAYVRESWESARFRDAVESSFSTALRRLRARALLTAVAILVVFGSIVSVLWIGGSSVVEGRMSGGQLGQFVLYSVLTAGAFAALSEVWGEVQRAAGAMERISELLDTRADIADPPNPQPIPGRGHIRFENVSFSYPSRPDDALDDLSFEVLPGESVALVGASGAGKTTVFKLLLRFYDPDSGLIRLDGTPIAEAALADVRERIGIVPQETVIFSASAGENIRYGRPDADDESVIAAADAALADEFIRPEGYDAHLGERGVRLSGGQRQRIAIARAILKNPPVLLLDEATSSLDAESERKVQEALDRLQENRTTLIIAHRLATVIKADRIIVMDAGRVVATGTHQELLAQGGLYARLAE.. 587
60 0.000e+00gi|500094373|ref|WP_011770380.1| ABC transporter [Psychromonas ingrahamii]  clstr ali  22  13LKPLKALVPFIRPYKNTFIVAIIVLLLASAVTGSLPIAARYLIDSGITSGNADKINFYFKLVLGVILLISLLSATRLYLITWLG----ERIVADIREKIYAQVLKQDPSFFEVTQTGEVLSRLTTDTTLVQAISGVGISIALRSTVMLFISLAGIMYSSPSLTLIIVILIPAVIGPI-IWLARRLRALSRTAQDKVAESSGMANEMLNAIETVQAYTLEKVQNQRFRKAVEAAFIAAIERIKLRFVMSFSSMFLLLGAITLVLWMGTQEVLAGNMLPGELAQFVLFTVLLASSGAMLSEMWGEVQRAAGAMERLVELLNAQPNIVMPENPMPIPAQGEISFNKVNFHYPSRPDSALENINLNITSGETIAFVGPSGAGKSTLFQLLLRFYDPQSGFISINGVNISAADPMDVRSIMAVVPQENVVFATSALENIRYGRPAASDEEVRAAAISASADLFISPEGYHTFLGEKGVRLSGGQKQRIAIARAILKDPPILLLDEATSSLDAESERLVQQSLQKLMHNRTTIIIAHRLATVLKAKRIVVIDNGKIRAIGSHAELMRKDALYAHLAE.. 583
61 0.000e+00gi|738213336|ref|WP_036168998.1| ABC transporter ATP-binding protein [Lysobacter dokdonensis]  clstr ali  27  21...LRGLWPFVQRQRGLFVAWLLALCASSAATLALPVAVRGMIDDGFRSASNIDATFALLFXXXX--XXXXXXXXRFYFVSLLG----ERVVADLRQRLYSHLLGLDPAFFETTRSGELVSRLSADTELLRSLVGSSISIALRSFVMVLGSIAMMFVTSPRLAAYTMIG--IPLFVAPIVIGRRLQKMSRQSQDRVADANALASEVLGNIRTVQSHAREPYERGRFLDXXXXXXXXXXXXISMQAIVTAVAITAFFGAIIIVLWSGAHDVVAGRMSAGTLGQFVLYAMLGGGSVGALAEVWNDVQRAAGGMGRINDLLMENASLVAPAHPTALPNPGDIRLDDVVFHYPSRDAPALEGFTLHVRPGETVALVGPSGAGKSTVFALLLRFHDPQRGGIAIDGVDLRQLDPARLRESIALVPQAPTIFATTAGDNIRYGRLEASDADVEQAARSAEAHEFITPQGYASELGERGARLSGGQQQRIAIARALLKDAPVLLLDEATSALDAQSERAVQHALENLMQGRTTLVIAHRLATVLKADRIIVMDRGRIVAEGTHAQLLAQGGLYADLAR.. 586
62 0.000e+00JCVI_PEP_1096701070137 /source_dna_id=JCVI_ORF_1096701070136 /offset=0 /translation_table=11 /length=611 /full_length=611  ali  23  32..ALSGLLPFLIPYKGLIAAACLALILTAGLSLVLPLAVRRVVD-TFNNG-NESMLDLYFVAILVVAALLAAGTAIRYA--LVT-KLGERVVTDIRETIFERVLKMSPQFYETIMTGEVISRITTDTTLILSVIGSSISVALRNILIFAGGLALMLITSVKLTSLVL--LIVPAVVIPILTGRKLRRLSRENQDWIASSSGNASESLGAVQTIQAYTHENLSINAFNDVSEKAYRSARKRISTRAWMTAIVIFFVFSGIVGVLWIGARDVRLGVISTGVLVQFVIYAVMVAGAVAALSEILGELQRAAGATERLVELLNLRDFVKDPIKEFTVPIRGEIEFNSVNFRYPSRPDPALSELDFKIKPGETVAFVGPSGAGKSTLFQLLLRFYDPMSGCVKIDGIDLKELAREKFRKNIAVVPQDPIIFAMSAIENIRFGRPDASDEDVIAAAKAASAHEFIKPESYQTFVGERGVMLSGGQKQRIAIARAILRDAPILLLDEATSALDSENELAVKRAVESLSKSRTTLVVAHRLATVKKADRIIVMNQGKLVATGTHEELLSAGGLYARLAR.. 599
63 0.000e+00gi|953983672|ref|WP_058068567.1| ABC transporter ATP-binding protein [Pseudomonas sp. TTU2014-080ASC]  clstr ali  24  11.SALSVAWRFISPYRGRVIGALLALMFTAAITLSMGQGIKLLVDQGLATQSADALRHSIALFFVLVFALAIGTYTRFYLVSWLG----ERVVADIRKRVFNHLVEMHPGFYESNRSSEIQSRLTADTTLLQSVIGSSLSMALRNLIMLVGGSILLVVTNAKLSGIVLLALPLVVAPI-LVFGRRVRSLSRQSQDRVADVGSYVGEALGQIKTVQAYNHQSEDMRRFGLSAEAAFDTARKRIAQRAWLITVVIVLVLGAVGVMLWVGGMDVIAGRISGGELAAFVFYSLIVGSSFGTLSEVIGELQRAAGAAERIAELLQARNEITAPTGDLLHPVEGRIELENVQFSYPTRPESAINGISLQIEPGETLALVGPSGAGKSTLFDLLLRFFDPQQGRILIDGQSISQLDPHDLRKAFAWVSQSPALFFGSVEDNIRYGRSEASFAEVESAAKAAHAHEFILPQGYQTHLGEAGLGLSGGQRQRLAIARALLSDAPILLLDEATSALDAESEHLIQQALPGLMKDRTTLVIAHRLATVKSADRIAVIEQGRLVAIGSHSELVSSSPLYARLAE.. 581
64 0.000e+00gi|504014598|ref|WP_014248592.1| ABC transporter ATP-binding protein [Azospirillum lipoferum]  clstr ali  25  31LSPLRRLVPFLLPYKWRILGAMVALTVAAGTVLGLGQGMRVLIDQGFAGGDTSLLDRALLVLLGVIALMAASTYGRFYLVSWIG----ERVVADIRRAVYDHVLTLSPGFFETTKTGEILSRLTTDTTLLQVVVGSSASIALRNTLLFLGGTGMLLITSPKLTGLVALVVPLVVAPI-VFFGRRVRKLSRDSQDRIADVGSFVEETLAAIRTVQAYTHEAIDRALFGKRVEEAFDVAIRRVRVRALMTVIVIVLVFGAVGIILWIGGHDVVAGRLTPGELSAFVIYSVVVAGSVGAISEVIGDLQRAAGATERLFGLLAIESDIRXXXXXXXXXXXGALSFDAVRFHYPSRPDWALEGFSLDVRPGERVALVGPSGAGKSTVFQLLLRYYDPQAGSVRLDGVELRDADPVAVRRRLGLVAQDPVVFSANAWENIRYGRPDASDXXXXXXXXXXXXLDFLDPEGLGTFLGEKGVRLSGGQRQRLAIARAILRDPPVLLLDEATSALDAESERMVQDALDRLMHGRTTLIVAHRLATVLNADRIVVMDKGRVVETGTHAELVAQGGLYARLA... 600
65 0.000e+00gi|797180420|ref|WP_045849269.1| thiol reductant ABC exporter subunit CydC [Domibacillus enclensis]  clstr ali  31  1..........MMEEKRDVLLSVLFGVLAGLTSVALFGLSGFMISKSALQPP----LYIITIMTALLKLFGAAKAGSRYAERYVSHRATFTILSNLRVSFYEKLEPLAPRIFGKYRSGDLLARIVGDVETLQNFFLRVFYPPLVLVIVFLSTVLFTMFYSVWIALVLLAGLLFTGFIIPGLLSLKQRNVMRGVRAKRAQLSTETTELLYGFRDLKLHQKLDKKQGQLLEMANSYAGEQEKEGVXXXXXXXXXXXXXXFVSFMVLVLGAYFVTIGELDGLLLAMLVMISLTVFDNAVPMALFPAHFEETRQASSRLFSVVDEPAP-APKKQRLDEERAFSIELKNVTFTYPGEERPALQDVSFKLPAGTKTAIVGPSGSGKSTVLQLLLDMYAVEHGDLFIGETSIRDIQSESIWSQTNVMLQANHFFYGTIKDNLQIAREDVTDEEMKEALRVVEL-----PFSLDDPVLEGAENVSGGEKQRLALARVLLKRARIWLLDEPSSSLDVLTEGRMFNHLLKAAEKDTLLLISHRLTGLEKMDQIIVMENGRIAEAGSFGELMAKQGYFYELKQ.. 551
66 0.000e+00gi|1011341161|ref|WP_062255186.1| ABC transporter [Burkholderia megalochromosomata]  clstr ali  23  14...LFTLAPFLRPYAGRWALAFLALVTSAGATLALPMAFRYLIDRGFASGDRT-HIDRYFIALFVVSLVLAGATALRFY--WVS-WLGERVTADLRRAVYDHIMGMSPQFFETTQTGEVLSRLTADTTLIQTVVGTSLSLGLRNALLTVGGIAMLVTTSPVLSGYIIAVLIVVVAPI-VFFGRRVRRLSRASQDKVANASALAGEVLNAMPTVQSYTQEAFEARRFGAAVESAFETALTRIRARAGLTXXXXXXXXXXXXXXLWLGAQAVLAKQMTAGQLSQFILYAVFTAGAVGTLAEVWGDLQRAAGATERLMQLLAARSPVMEAATTMPMPAAGEIRFDNVGFSYPSRDGIALSGFSLDVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQSGSILINGVATRHMSLGTLRRTVGVVLQDSVIFSGSVFDNIRYGMPEATLAQVQRAAGMAAAAGFIEPGGYDTFLGERGVRLSGGQRQRIAIARAILRDPPILLLDEATSALDAASERLVQTALDNAAQNRTTLVIAHRLATVQQADRIVVMEQGRIVAQGRHAELLQSSPLYAQLA... 579
67 0.000e+00gi|326412257|gb|ADZ69320.1| ABC transporter, ATP-binding/permease protein [Polymorphum gilvum SL003B-26A1]  clstr ali  25  36LRPLRQLLPYLARYKAMVXXXXXXXXXXXCVTLVLPIAVRRMIDSGFGA-DDPALINNYFLMLIGVAAALALASATRYYLVM---WIGERIVSDVRTDVFAHLTRLSPAFFDTAKSGEILSRLTADTTQIKSAFGASASIAMRNLVMFVGAVTLMIVTSPRLSVIVLA--AIPIIVLPLIFGRAVRRRSRTAQDTLAAASAFAAEMLGAVRTLQAFTSERFAARRFGQSVEXXXXXXXXXXXXXXVLTGFAIFIIASSVVAVLWIGAADVFAGRMTGGELGQFLLYSILAAGALGELSQVWGEISQAAGAAERLSEILRIEPEIQPPRDPILLPEPGAIAFEGVSFAYRGSGAPVLHDIDLAVAPGETVAVVGPSGAGKSTLFHLLMRFYDPTKGTVRLDEIDLRAAEPEDVRRRIALVPQDTMIFGASAAENIAYGRPEASPAEIRKAAEAALAGDFIMPNGYDTAIGERGITLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQMALERLMAGRTTLVIAHRLATVLKADRIVVMNEGRIVESGRHDDLVAAGGLYAKLAR.. 606
68 0.000e+00gi|518884896|ref|WP_020040771.1| ABC transporter [Salipiger mucosus]  clstr ali  25  23...LGALWPFVRPYRGLMALAVLALFATAAVSLTLPLAVRRVVDNFNAEG---GLLDLYFSXXXXXXXXXXXXTALRYA--LVT-RLGERVVADIRKSVFDRVIGLSPVFYEKIMTGEVLSRITTDTTLIQSVIGSSVSIALRNLLLFVGGLGLMLFTSPKLTGMXXXXXXXXXXXXXTL-GRRLRTLSRENQDWIAASSGNAAEALTAVQTVQAFTHETISRSAFADVTEKSFDAARRRLWTRALMTAIVIFLVFTGIVGVLWMGAWDVRAGEMSAGALVQFVIYSVMVAGAVAALSEIFGELQRAAGATERLVELLQAEDSIRDPAQPVAPPARGEISFEGVRFSYPSRPGAALDGIDLDIRPGETVALVGPSGAGKTTIVQLIQRFYDPDAGTVRLDGVALPDMARDAFRRQIALVPQDPVIFAASARENIRFGRPDASDTEIEXXXXXXXXHEFIEPEGYDTWLGERGVMLSGGQKQRVAIARAILRDAPVLLLDEATSALDAESERAVQRAVDVLAEGRTTIIVAHRLATVKKADRIVVMEQGRIVAQGGHDALVAEGGLYARLAR.. 588
69 0.000e+00gi|806830078|ref|WP_046178886.1| thiol reductant ABC exporter subunit CydC [Domibacillus tundrae]  clstr ali  31  1..........MMEEKRDIWLSVLFGVLAGLTSVALFGLSGFMISKSVLQPP----LYIITIMTALLKLFGAAKAGSRYAERYVSHRATFTILSNLRVSFYEKLEPLAPQIFGKYRSGDLLARIVGDVETLQNFFLRVFYPPLVLVIVFLSTIFFTLFYSVWIALVLLGGLVLTGFVIPGLLALQQRKVKQGVRERRAGLSTEVTELLYGFRDLKLHQKLDEKEEKLLQIADAYVQEQEKESVXXXXXXXXXXXXXXSVAFVVLALGAYFVTIGELNGLFLAMLVMISLTIFDNAVPMAVFPAHLEDTRQAAGRLFSVVDEEPP-APKMGMIERDDAFSIELKDVTFRYPGETRPALQNVSISIPAGSKTAIVGPSGSGKSTVMQLLLNMYTVNAGTILLDGNSMGEIQAENIWSKTNVVLQENHFFYGTVRDNLKIAGDGLTDREMEDTLRLVEL-----PFSLDDPVLEKAENLSGGEKQRLAIARVLLKRAPVWLLDEPSSSLDVLTEKRIFGHLHEAAQKDTLVLISHRLTGLEKMDQIVVMERGNVVEAGTFNELMERKEYFYEMKQ.. 551
70 0.000e+00gi|755106630|ref|WP_042457404.1| ABC transporter [Rhodovulum sulfidophilum]  clstr ali  25  19..ALSALWPFLAPYRRMLAAALAALVLTSIVYLAMPVAVRHVVD--AFDTETAALLDRYFGFALIIVALLAVGTALRYY--LVT-RLGERVVADIRSAVFDRMIGMSPSFYEKTMTGEVLSRITTDTTLILSVLSSSASFALRNILVFFGALVLMLATATKLSGLVL--LLVPAVIVPILLGRRLRQLSRENQDWIAASSGNASEALLSVQTVQAFTNEARARAQFRGVTEQSFQSARQRIGTRAVMTVIVIFLVFAGIVGVLWVGAHDVRAGEMSVGQLVQFVIYSVMVAGAVAAMTEIWGELQRAAGATERLVELLTAQDSVTDPERPAPLPEPGEIRFEDVRFSYPTRPDPALNGIDLTVRAGETVALVGPSGAGKTTVMQMILRFYDPQQGRVLFDGADLRSLGREAFRNRLALVPQDPAIFAASARENIRFGRPGATDXXXXXXXXXXXXHDFLSPQGYDTEVGERGLMLSGGQKQRVAIARAILRDAPVLLLDEATSALDAESERAVQQAVDRMAATRTTIIIAHRLATVKKADRIVVLDRGRIVAEGTHDALVAEDGLYARLAR.. 586
71 0.000e+00gi|503462758|ref|WP_013697419.1| ABC transporter [Burkholderia gladioli]  clstr ali  22  11LTPLLAMLPFLRPYAGRWALAFLALVTSAGATLGLPVAFRYLIDRGFASGERVHIDRYFIALFVVSLILAAATALRFYWVSWLG----ERVTADLRRAVYDHVMRMSPQFFETTQTGEVLSRLTTDTTLIQAVVGSSLSLGLRNLLLALGGVAMLVTTSPVLSAYIIATLVVVVVPI-VTFGRRVRKLSRASQDKVANASALAGEVLNAMPTVQSYTQEVHEAQRFGAAVESAFDTALTRIRARASLTAVVIVFVFAAIVFVLWLGAQAVLAGRMTAGQLSQFILYAVFTAGAVGAIAEVWGDLQRAAGATERLLQLLAARSPVEQAAETTALPARGAIRFDAIGFSYPSRPGTALADFTLEVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQSGRILINGVPTSQVPLVDLRRAIGIVLQESVIFSGSVLDNIRYGRPDATLAEVQRAAGMAAAAGFIEPEGYDTFLGERGVRLSGGQRQRIAIARAILKDPPILLLDEATSALDAASERLVQTALDNAAQNRTTLVIAHRLATVQQADRIVVLDHGRIVAQGRHAELLQHSPLYAQLA... 579
72 0.000e+00gi|692173285|ref|WP_032092001.1| amino acid ABC transporter ATP-binding protein [Necropsobacter rosorum]  clstr ali  50  1MRALLPFLSLFKHARWVXXXXXXXXXXXXAASIGLLTVSGWFLAATAIAGVGTL--FNYFYPSASVRGLAIGRTVTRYFEKIVTHDATFRVLATLRVQVFRKIIPLSPAVLNRYRNSDLLNRLVADVDTLDSLYLRLLAPFVSALTVIVLLTIALSLFNVTLALFIGISLFLLLLCVPTVFYHLGRRFGSKLTHARARYRTQFVEFIQAQAELLLFNAEQPLKQKLQHTEQQWQHYQQREANLSGLSTALLLFANGLILSATLWFAAADFGSGQYRXXXXXXXXXXXXXXXEILMPLGAAFLHIGQVIASAERVSEITEQPPLVTFNGTQTEKTTALSLQITHLSFAYPQRSDTALDNINLTVEAGQKVAILGKTGSGKSTLLQLLVRNYDPQQGDILLGGKPIAAYSEHSLRTQMCFLTQRVHVFSDTLRNNLQLAAAQIDDHRMLAILEQVGLDKLAQEQGLDIWLGDGGRPLSGGEQRRLGLARILLNDAPMLLLDEPTEGLDRETERRMLALILRHCESKTLLMVTHRLTAIERFDKLCVIDQSRLIEQGSYQELIHKDGCFRRLAQRI 576
73 0.000e+00gi|759417809|ref|WP_043141756.1| ABC transporter [Ponticoccus sp. UMTAT08]  clstr ali  25  23...LRALWPFMRPYRXXXXXXXXXXXXXXXISLILPLAVRRVVDNFNTQ--DGALLDKYFGAALGIAAALAVGTALRYA--LVT-RLGERVVADIRKAVFDKVIGLSPAFYEKIMTGEVLSRITTDTTLILSVIGSSISIALRNTLLFLGGLVLMLFTSAKLTGLVLLIVPVIVVPI-LVLGRRVRKLSRENQDWIAASSGNASESLGAVQTVQAYTHEVQSRGAFADVTEKSFDAARKRITTRAAMTMIVIFLVFTGIVGVLWIGAWDVRAGGMSAGTLIQFVIYSVMVAGAVGALSEVFGELQRAAGATERLVELLQAEDTVSDPVTPLPAPDPGEITFDHVSFAYPARPGSALDAVDLSIAPGETVALVGPSGAGKTTIIQLLQRFYDPAEGRILLDGVALTDMARHDFRRQLALVPQDPVIFAASAKDNIRFGRPDASDXXXXXXXXXXXXHEFLSPDGYNTWLGERGVMLSGGQKQRVAIARAILRDAPVLLLDEATSALDAESERAVQQAVDLLAEGRTTIIVAHRLATVKKADRIVVMDQGRIVATGTHDALVSEGGLYARLAR.. 589
74 0.000e+00gi|567391804|ref|WP_024018596.1| ABC transporter ATP-binding protein [Sphingobium sp. C100]  clstr ali  28  20...LTMLWRFARRYPGRIAGALTALIVSSAATLAIPNGFRLVIDKGFMGGGDISRWFEYLLLIVL--VLALASALRFYFVSWLG----ERVVADIRSATQANLLRQAPRFFEENRPSEIASRMTADTAIVEQVVGSTVSVALRNMVTAVGGLVYLFALAPKLAGLLLLGIPVILLVL-IGLGRRVRQSSRASQDRLADIGSVATEVLGAMKIVQAFGQEMREAQRFKATVERGFATARQRIRLRAAMTAVAFTLVFGAITGVMWLGAIDVAAGRLSGGSIAAFVLTGGLVAGALGSLSESWGDLLRGAGAASRLGELMAAEPDIGPPTAPAPLAHGARLTFADVHFHYPTRPQAALHGIDLDIAPGETVAVVGPSGAGKSTLIHLALRFYDPDSGSVALNGVPLPDADPGALREMMAIVPQDSVIFAASARDNLRYGRWDASDEQIWAAARAANAEAFLRPEGLDSFLGEDGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQDALGKLMQGRTTVVIAHRLATVRAADRIIVLDEGRIVEQGDHAALMAQAGLYARLAR.. 586
75 0.000e+00gi|763171164|ref|WP_044050816.1| ABC transporter [Planktomarina temperata]  clstr ali  26  24...LQALLPYFAPYKIWVVLALAALTITASVSLILPVAARRVID-GFSVGDVSLLNQYFMGAIAVAAIFALG-TGLRY---YVVTRLGERVVADLRKAIFDRMIGMSPAYFEKLMTGEVLSRITTDTTLILSVIGSSASWMLRNMLMMSGGLIMMLWTSPKLTGLVLLIVPLILGPI-LALGRKLRGLSRQNQDWIAASSGKASESLLSAQTVQAFTHEARSSTEFSNVTEKAYDSARARIKTRALITMIIIFVAFSGVMGVLWIGAIDVRSGATTAGQLVQFVIYAAIVASSTAALSELWSELQRAAGATERLVELLEAEDSIADPQEPIPA-KPGALVFEDVKFAFPSRPQPALNGVNFTINPGETVALVGPSGAGKSTIIQLVQRFFDPQAGHITFGGVALPQMRRSDFRQFMALVPQDPVVFASSAYDNILFGRPSASRDEVIXXXXXXXXDDFIRPDGYDSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDGESEALVQKAFEALSKHRTTLVVAHRLATVKNADRILVMDQGQIIAQGTHASLVAEGGLYARLAK.. 587
76 0.000e+00gi|916539156|ref|WP_051146280.1| MULTISPECIES: ABC transporter [Novosphingobium]  clstr ali  26  1.....MIWREAIKYPGQVAAALIALVTTSTATIAIPARFKGIVDQAFAQPGVIDQAFHTLLLIVVV--LGFATAIRFYYVSWLG----ERVVADIRARVQSNLLRLPPAFFETNSPKEISSRMTSDTAIIEQVVGTTVSIALRNTITALGGLIYLFFLAPKLTAGLVIGIPVVIFPI-AWFGSRLRKVSRSSQDRVADIGAMTAEVLGAIRIVQSFGQEGRERARFAGAVERTFDTARRRILIRAVMTAVVIFLVMGGITALMWQGALGVSNGSLTGGTIAAFVLTGGIVAGSCGALTEVYGDLLRGAGAAGRLNELLLEQPDIAPPARPITLPSPGALAFQNVAFRYPSRPESALADFSLTVEPGETVAIVGPSGAGKSTLFLLAQRFYDPQGGVVRIDGVPLPQADPSEIRARMALVPQEAVLFAASARDNLRYGAWDATDEAIWAAARAANAEEFLKPEGLDTFLGESGARLSGGQRQRMAIARALLRDAPILLLDEATSALDAESERLVQDALDHLMQGRTTLVIAHRLATVRAADRIVVMDGGRIVEQGNHASLMAADGLYARLAR.. 567
77 0.000e+00gi|505092276|ref|WP_015279378.1| thiol reductant ABC exporter subunit CydC [Thioflavicoccus mobilis]  clstr ali  39  1MRELARLLRLMRPYAGWMVLGLLAALVTLVANVGLLAVSGWFIAAMAAAGASGTPI-NYYTPAALIRAFAILRTGGRYVERLVTHEATLRLLARLRVWLFEHLEPLAPAGLQDARSGDLLSRIGADIDALDRLYLRLLVPLLVAVVGGTAAVVFLAFYDWXXXXXXXXXXXXXXXFVPWLVGRLGAEAAARQVTTAAELRTAVVDGLQGMAELAIYGRAEAQAQAVDRLSVAWIADQRRLAGLDGLSLAAVGLAANLTLWGGLLIVIPLVGSGQLAGPELVMIALFLLACFEAVAPLPAAFQSLATTLTAARRLFAIVDAQPAVVDPQTASPEPERLDLIFDEVALRYAPERPWALHGVSFRVEPGERVAVVGATGSGKSSLVNLLLRFWDYQAGSIRLGGHELRRYRAADLRRRIAVVSQHAHLFHTSIRDNLLLANPNATDEALQRACSVAQLDAFIAPEGWDTLVGEAGIGLSGGQARRLAIARAVLRDAPILILDEPTEGLDSTTAHDLMTAIHRLMAGRTVLLITHRFADLGAMDRILVLDRGRLVDQGRHEELIGRCEGYWEMFERV 574
78 0.000e+00gi|1011040493|emb|CUX96281.1| putative multidrug resistance ABC transporter ATP-binding/permease protein YheH [Enterobacteriaceae bacterium symbiont  clstr ali  53  1MRVLFHFILLYQRHRIQLSLGILLAISTLFASIGLLMLSSWFLASTATVGVFGLYTFNYMLPAAGVRGAAITRTISRWAERVVNHDATFRVLQNLRCYIFTYIL-FSPGTIVSLERGKVLNRLVADINTLEHLYLRVISPFIVAMVVTLTVSTSLCLLYRQAGLLLSIIILAILVLFPPLFYIISKPVGEALTTLRSDYRLKLTTWLSNNAELTLYGAEKYYRYRLDITEQRWQVQQCRQNCLSASIKSLLILVTGLTLTLMLWLVSGNLGSDGLSGPLVALFAFATLAVFEALSPLAGAFQYLGQVIACAIRLNSIIQQPKEVTFPENGAMLPASVSIKINRIRFCYPKQTSPAINELTLQVSAGEHIAFLGHTGSGKSTLIKLLTRAWDPQKGEIKFNNILLREWSESALRSMTTVVEQRIHIFSATLRDNLLLAAPNADDNQLKVAIQQVGLDKLLRHKGLNTWVGEGGHTLSGGEQRRIGIARALLHDAPLWLLDEPTDGLDSVNEKQILQLLSKLKKRRTVILITHRLLGLEHFDRIYILDRGALIEQGNHQMLMALRGRYYH..... 569
79 0.000e+00gi|654566334|ref|WP_028033612.1| ABC transporter [Chelativorans sp. J32]  clstr ali  26  16LKPLRGLLPYLRTYKWLVAGAGFFLLLAAIATLILPIAVRRMIDHGFSEADSG-FIASYFSMLVIVAAVLAVASAGRYYFVIT---LGERVVADLRRDVFTHVTRLSPAFFDQALSGEIVSRLTADATQIKSAVGATASTALRNTIMGLGAVAMMVVTSPTLSALVVV--AIPVIVFPLVFGRSVRKRARRAQDTLADATAFAGEQIAAVRVLQAFTNETVVAKRXXXXXXXXXXXXRSSIFARSILTFVAIFATSASVVAVLWAGSHAVLNGTMTAGTLGQFLLYAVLGAGALGALSEVWGELAQAAGAAERMTELLAQKPAIAAPAQPLPLPPRGSVSFRNVSFAYPSRPRSALHDLSFDVAPGETVAIVGPSGAGKSTVFSLLLRYYDPDQGAVLIDGVDIRRADPQAVRERLAIVPQDVTVFAATAADNIAFGRPGATREQVEAAARAALAHDFIRENGYDTQVGERGVTLSGGQRQRLAIARAILRDAPILLLDEATSALDAESETLVQEALEHLMRGRTTIVIAHRLATILKADRILVLEEGRIVEEGRHAELVARGGVYARLA... 585
80 0.000e+00gi|498230140|ref|WP_010544296.1| ABC transporter ATP-binding protein [Sphingomonas elodea]  clstr ali  28  14LSSLLVIWQFTRRYPLQIVIASIALVTSSLATLWIPRTFKQIVDNGFAAGADTSRIGVYFGLLAVILVLSIATAVRFFFVSWV----AERTVADLRVAVHRNLLRLPPKWFEENRPSEIASRLTSDTALVEQVVGSTVSIALRNLLTGVGGVIYLFVLAPKIAAYLIVGMPLTVLPIVWLGGR-VRQYSRNSQDRVADIGAIASETLGAMRIVQAFGQEPRESQRFQDAVVRSFAAAQKRFALRAVMTALVIGLLFTAITLIMWDAVSGVAAGQITGGAITAFVITAGLVTGSFGALTEVYGDLLRASGAASRLAELLQQEPDIAPPAHPVALPSPGAIAFDAVTFRYPTRPESALQDFSLFVAPGETVAVVGPSGAGKSTLFQLLQRFYDPEAGEIRIDGVAIPRADPAEVRARMAMVPQETVIFAASARDNLRYGNWNASDDXXXXXXXXXXXXEFLRPDGLDTFLGEGGARLSGGQRQRLAIARALLRDSPILLLDEATSALDAESEKLVQDALERLMQGRTTLVIAHRLATVRAAGRIIVMDGGRIVETGTHAELVALGGLYARLA... 584
81 0.000e+00gi|748791728|ref|WP_040039739.1| ABC transporter [Herbaspirillum sp. TSA66]  clstr ali  27  14...LRGLQPFLAPYKKQFVLAGIALVIAAGATLAIPYAFKQMIDXXXXXXXXXXXIDLYFIALFGVAVLAVATAARFYMVSWLG----ERVTTDLRGAVYSHVITQSPQFFETTQTGEVLSRLTTDTTLIQTLVGTSVSMALRNALLFIGGLVMLFVISVKLSSVIIVLLAAVVLPI-VVFGRRVRKLSRASQDRVADASALAGEILNAMPTVQAFTHEGDEAHRFRSSVERAFETAMQRIRARAALTVIAILLVFGAIVFVLWLGAHAVVRGSMTGGELGQFILYAAIVAGAIGALSEVIGDAQRAAGAAERLLELLSVRSPIRSPAQPEPLPARAALTLRDVGFRYPSRPQPALSHLSLDIRPGETVAVVGPSGAGKSTLFQLLLRFYDPQQGQIMLDGVDIRRLDLHALRGAIGVVPQDTVVFSANALENIRYGRAGASDEEVIAAAKMAAAHEFIEPQGYQSFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERLVQGALQAAMAGRTTLVIAHRLATVQRADRILVMEHGQVIESGTHAELIAQGGLYASLA... 588
82 0.000e+00gi|493230771|ref|WP_006207043.1| amino acid ABC transporter ATP-binding protein [Paenibacillus vortex]  clstr ali  28  1MKQESWFRPYVTANFWRFLLIVVLGVLTILFAGMLMFTSGYLISKSALRPENILMVY---VPTVGVRTFGIGRAVVHYVERLVGHDTILRILSQMRLRLYRILEPQALRLSSRYRTGDLLGALSDDIEYLQDVYIRTVFPSIVALVLYAGIILAVGQFDPAFALLLALYVAXXXXXXXXXXXXXTKRKNREMKQARNNLYQKLTDAVLGIHEWYVSGRQTEFLAGYEADEAEVDRTDRSLKRWSRLRGWIGQCIVAVTVVSMVYWSGRQYADGSMDVTLIAAFVLVVFPLMDAFLPVSEAVERIPQYGQSVARLKGIADESDEKQAPETEAVIRGGVHVKADGIMFSYAGEAGHTLTEVSLDIPPRAKVAVIGRSGAGKSTLLQLIQGVLAPSSGSLTLGGVEAARF-GDEISSVIAVLNQSPHLFDTTLANNIRLGRPEATEEEIRDAAAMARLEPLVAPGGLDTRMQEAGQRFSGGERQRVALARILLQDTPIVILDEPTVGLDPITERELLSTIFSSLQNRTLIWVTHHLVGVEQMDEIIFMEHGRIAMRGTHDELMRHYPRYQQLYR.. 592
83 0.000e+00JGI.Meta 7009674315 SRS018149_Baylor_scaffold_9315__gene_9509 thiol reductant ABC exporter, cydC subunit [Human Buccal mucosa microbiome fro  ali  48  1MKPLFPFLSLYRNHFGRLLLGTILAITSLSASIGLLSLSGWFLAASFLVGSTIL--FNFFYPSSGVRGLAIGRTISRYLERLVTHDATFRVLAELRISVFKKLIPLSPSGLNRFRNSELLNRLVADVDTLDTLYLNLLSPFISAIIVIAFMAIGLSFVSGLLTIIICGILLTLLFIFPAIFYRLGQKSGKKIIQARAEYRSQFIEWVQLNAEFLLFGLVPQMTEKLEKTEQTWLSSQSKESQLTGFSNALLTFMNGVLVCVVILLVATAIDAPSADTPLVALVIFCVMASAEILMPIGIAFLHLGQLITAAERLNDVIEQRPLVAFNGSASIAENQPLVRFENITFSYPASHQPALNALSFEVNKGEKVAILGKTGSGKSTIFQLLNRHYDPASGQILLANCNVADYPEATLRSHLVTLSQRVHIFSQTLRNNLLMGNPHSTDEQLKLVLEQVELAYLLQEQGLDLWLGEGGRPLSGGEQRRLGLARVLLSNAELVLLDEPTEGLDRETEQQILTLIFTHCQTRTLLMITHRLQGLKRFDRVYRIDNGQLLA..................... 555
84 0.000e+00gi|516285112|ref|WP_017688419.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. PAMC 26794]  clstr ali  31  1MNELTILSKAMIQERKDILLSILGGFIAGIAGVALFSASGYMISQTVFAPP----LYTLIVLTSMVKLLGFLRAASRYGERLYSHRATFSMLSRLRTSFFAKLIPVTPGILNKNRSGDLLARIVGDVESLQNYFLRVAYPPIMVVMVFLATMLFTSAFSIWIACLLVLGMLITAFVVPGIVLLGQRKIHGRVRQQRALLSTEVTEVLYGFRDLKVYGQLEQREQQLQQASAALATEQKQAASHLLRGQSMHVFVTYLVTWGVLALSAFLIVNGSFAGVFLAMLILATQTVFEEAAAMAILPLYKQDSEHAAQRLSEVPTSGVQPVQPSGEVSADQAISIKLSSVSFQYEGEWRPALRELSLQLAAGSKTAIVGPSGSGKSTIIDLLLKLRAPTSGNIRLNDVPLQELNEESIWQNANVVLQQSHFFRGTIRDNLLLNGEEHSDEQLSAVLDKVQLPNKL----LSDLVYEKGENLSDGEKQRLALARAMLRNGRLWLLDEPTSSLDYVTEKHVLQHLLAQAAEDTLLLICHRLTGLEEMDRIVVMDQGKIVESGSFSELMEQKGYFYEMKQ.. 564
85 0.000e+00gi|557843868|ref|WP_023466713.1| thiol reductant ABC exporter subunit CydC [Exiguobacterium sp. MH3]  clstr ali  33  1MKELLGVFRLMVHQKRDIAWSIFFGVLAGVTAVGLFAASGYLISKAALLPP----IQTLAVLIALQKISSLTRAVSRYAERYYSHRATFTILSDIRTSFYRRLEPLAPGIFGKYRSGDLLARIVGDVESLQNTFLRVLYPPIVLLLVFFCTIFFVSFFSWTIAGILLLGLILTGFLIPGWFAYREQRFARSVRVRRGDLSTEVTELFQGYRDLKIYQQLDQKEQDLNAVAKRYVEEEKRNGLHAVSNLALNTMVTLIISWLVLGVGAYLVASGQLEGVFLALLVMTSLTVFENAAPMAILPGFFEDSRHAAKRLDEVVEQEEPIYD---TFVLDQAPSFETNALTFTFPDAPRPVLRDVTVSIPAGKKTAIVGASGSGKSTLLQLMLRMY-PTDG-LTIAGQDSRTVDPEGLWQHANVVLQQNHYFYGTLRDNLLLANEAATDEAMRQALDDVGLTTFE----LNDRVFEKGENLSGGEKQRLAIARVLLREASLYLLDEPTSSVDALTEQMILNRLFARAADATLVLVSHRLAGLEAMDQIIVMDQGHVIEVGTYTELMARQGAFYELKQ.. 559
86 0.000e+00gi|939229629|gb|KPU83748.1| ABC transporter [Marinosulfonomonas sp. PRT-SC04]  clstr ali  26  20..ALSGLIPFLHPYKHMVILSGLALIFTATISLILPLAVRRVVDGFAE--DNAALLDQYFGXXXXXXXXXXVGTGLRYY--LVT-RLGERVVADIRKAVFERVITLSPAFYERIMTGEILSRITTDTTVIQSVIGSSVSVALRNVLLFFGGMALMLYTSAKLTGLVLLIVPAVVVPIIVL-GRRLRKLSRENQDWIAASSGSASEALTSVQTVQAFTQERAITNAFDEVTEKAFAAARKRIGTRAVMTVIVIFLIFSGVVGVLWIGARDVQADVMTAGQLVQFLIYAILVSGAVAALSEIWGELQRAAGATERLVELLHTEDTVTDPATPKVLTANGAIEFSDVTFSYPARPQTALKAANISITAGETVALVGPSGAGKSTIIQLLLRYYDPQQGSISIDGIDLRDMQRGAFRQNISLVPQDPVIFATSARENIRFGRPDASDSEVEDAARAAAAHDFLSPEGYDTYVGERGVMLSGGQKQRIAIARAILRDAPILLLDEATSALDAESELAVQQAVEVMAADRTTLIVAHRLATVKKADRILVFEDGQIIAEGTHDELVAAGGLYARLAR.. 587
87 0.000e+00gi|737537434|ref|WP_035510979.1| MULTISPECIES: thiol reductant ABC exporter subunit CydC [Halobacillus]  clstr ali  29  1MKDLRDVIQLVVLEKRDIVRSILFGFLAGISAVGLFASSGYLISKAALIPP----LYALTVLIAFLKLFGFARALGRYAERYYSHRATFTILSNLRLAFYKRLEPHAPRIFQKYRSGDLLSRIVGDVESLQNFFLRVYYPPVVLGIIFLATIVFTSIFSISVAVVLLLGLVITGLFIPAWYSVKQRKYAHRVREARGALSTEAAEFLYGYRDLRIYQQLAKKKEILLKTADDYLDEEERDGRQRLSNHSWNTFVTLIISWVVTGLGAFLVAEGDLNGLFLAMLVMISLTVFENAAPMAVLPSHLEDSKRASARLFSIVE-KEKVDKGIWTLEDHQAPSIKMSGVYFRFPDDEREALREVTLSIPEGSKTAIVGASGSGKSTLMQLFMKFHTPSFGELSVNGVDIRKLSEESVWKNSNVVLQENHYFYGTIRQNLQLAGDILTDEEMEQALEEVGLR-----FDLGQKVLEKGENLSGGERQRLAIARAFLKGERLWLLDEPTSSVDALTERMIFEHLYQRAKGDTLVLISHQLNGLEKMDQIIVMEEGSVREAGTYHELIEKQGYFYEMKQ.. 561
88 0.000e+00JCVI_PEP_1096683053207 /source_dna_id=JCVI_ORF_1096683053206 /offset=0 /translation_table=11 /length=640 /full_length=640  ali  25  59.RPLRALWPFLRPHRRLVWAAGFMLLLAACFTLLLPLALRRVIDLGFD-PENVAKIDQYFAALIGVXXXXXXXXXXRY---YFVTKLGERVIADARSAVYDRVIGMSPVFYERLQTGEVLSRLTTDTSVIQSVVGSSASIALRNALILVGGIAMLLVTSPKLTGLVLLCVPLTVFPI-LLLGRRVRALSRESQDRVADASAQASETLQAAQTVQAYTHEDRSRARFGGLVEQAYDAARRRIVARAALTVVIIFIAFTAIVGVMWMGARSVISGETSAGELGQFIFYAVFVAGAVAALSEVWGELMRAAGATERLVELLEAEDPIRAPARPVPPPARGAIAFEGVSFRYPSRPDSALDAVSFAVRPGETVALVGPSGAGKSTLFQLLLRFYDPEAGRVLVDGVDAAAMEPSALRARFALVPQEPAIFADTARENIRFGRPXXXXXXXXXXXXXXXXHGFLKPEGYDTYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQQAVERVSEGRTTLVIAHRLATVKRADRIIVLDRGRIVAEGPHDRLVSEGGLYARLAR.. 628
89 0.000e+00gi|517333518|ref|WP_018509010.1| ABC transporter [Thiobacillus thioparus]  clstr ali  24  15LSALAGLWPFLRPYRARLALAFVLLCLGSGTILLVPLAFRDLVDFGFFGKPAALSLNGYFIVLFGLACIWALAVAARY---YTVAWIGERATADLRSAVYARVLTQSPQFFETLQTGEVLSRLTGDTTLVQTVVGSSISMGLRSLFQFIGGMIMLAVTSLYLFSLNLGLMALLTLPI-LAIGRKVRKLSRESQDKIADASALAGEILNAMPTVQAYTQEQQEARRFTARTETSFVTAIRRTRVRAALTALIITAVMGTIIFVLWIGARQVHDGIMTGGELASFVLYAALVAGGVGTLSEVWGDVMRAAGATERLLDLLHAESAIHEVPSPQAPAQPARIRFDHVTFRYPAHPDDALHDIRLDIPPGESVALVGPSGAGKTTLFQLLLRYYEVSEGAIRLNGQDIRQLSLHDLRQGIAIVPQDPVIFSANALENIRYGRATASDEDVLQAARAALVDEFIEPEGYQTFLGERGTRLSGGQRQRIAIARAILKGAPLLLLDEATSALDAESEALVQQGLGAAMQGRTTLVIAHRLATVQKVDRIVVMDGGRIVETGTPQDLRKQGGLYARLA... 593
90 0.000e+00gi|498093578|ref|WP_010407734.1| ABC transporter ATP-binding protein [Sphingomonas echinoides]  clstr ali  27  17LSSLAMVWRYASRYPVQLTIALCALFVTSATTIYIPWTFKSVIDRGFSHGSDMAHVDTFYLLFAVVLVLGIATAIRFYFVSWLG----ERTVADVRIAVQNNLLNLTPRWFEENRPSEIASRLTADTGQIEMAVGTTVSVALRNAITGIGGIVSLFVLAPKLAGMILIGIPLTLLPI-ILLGRRLRTHSRTSQDRIADIGAMAVEVFSAMKIVQAFGQERREAQRFADAVTRSFAAAKRRIFLRALLTALFITLIFGAITLLLWSTVADVAAGRLSAGSLTAFLATSVLVSGAFGSLSEVYGDLLRASGAAERLAELLDERPEIAAPAKPITLPQPGTIEFDHVEFRYPTRPDAALHDFSLSVAPGETVAIVGPSGAGKTTLFQLIQRFYDPSTGAVKIDGVDLRTADPAEVRARIAMVPQETVIFGATARDNLRYGRWDARDDELWXXXXXXXXXXFLRPEGLDTFLGEGGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQEALERLMAERTTLVIAHRLATVRAAERIIVMSDGRIVEQGTHGTLVDQNGLYARLA... 587
91 0.000e+00JGI.Meta 7027273197 SRS047335_WUGC_scaffold_122__gene_691 thiol reductant ABC exporter, cydC subunit [Human Posterior fornix microbiome from  ali  26  12....RWVKPYLAQYKWNFILAIFLGVVMFFCGGALMFYAGYTIDKAATRPENILMIY---VPIVLMRAVGIGRPLFRYLERLVSHNWILRVTSSLRRRLFYIVERNTSAVGSSFQTGSILSLLTDDIGHLQNLYLRTIFPAILSYLVGFIVVILLGLFSWPLAGVIAILLVAELVLVPFFSLLKQAAVRTKEKEEKAQLYTEFTDQVLGAGDWKISGRRDAFFNQTKETLKSLGQHEKKSGKFDWARDFGLEFIFGLMAVALLYFTNQTLTNNQEAANYVGAVVLALFPLSDAFIPVGQGIEEWHTYSDSVKHLNEL--KVPENRLPAQQYLDPAAGTLRVSNISFTYPGEDYPIIQNFSLTLKRGQKAALIGPSGAGKSTILQLILGDLKPSQGTVTLDNFNVLEL-QKERSKLFSVLNQEPFLFNTTIYENLKMANPDASADQMMQILEKVQLADFVLPKKLDTEVAEAGARFSGGQKERLALARVLLQDTPIVLLDEPTVGLDPLTEQKLLNLVFDVLKNKTVVWVTHHLQGVKYMNEVLFFKDGKVTMQGDPHELFKHNEHFHQLY... 574
92 0.000e+00gi|916637073|ref|WP_051244164.1| ABC transporter [Thalassobaculum salexigens]  clstr ali  23  27...LKRIVGFVAPYRGRVALAVVALVTTAAAMLAVGQGLRILVDRGFASGDPGQLDQALVALIGLAVVLSIGTYSRFYLVSWLG----ERIVADLRNAIFRRVIALHPGFFEVTRTGEVLSRLTTDTTLLQSIIGSSASMALRNLLALIGGLIMLFITNAKLAGLLMXXXXXXXXXX-XXXGRRVRRLGRESQDRVADIGAYAEESLGAIRTVQAFTHEAEDRQRFGREVTNAFATAIRRIHLRGLLSSTVILLVFASVGFVLWVGGNDVMAGRMSAGELTAFVFYGVTVAFSVGIISEVYGELLRAAGATERLVELLEAEPEIRAPEHPVALPSPGRVAFEHVVFRYPSRPESALNDFSLTVSPGETVALVGPSGAGKTTVFQLLLRFYDPAQGRVVIDGVDARTAEPTDLRRRIALVSQDPVVFAASAMENIRYGRPDATDAEVIAAARDAAAHDFITPDGYDSFLGEKGVRLSGGERQRISIARALLRDPAILLLDEATSALDAENERLVQNALDRLMQGRTTLVIAHRLATVVEADRICVIETGRLVADGPHAELMRSSPLYRRLAE.. 594
93 0.000e+00gi|519000182|ref|WP_020156057.1| amino acid ABC transporter ATP-binding protein [Caldibacillus debilis]  clstr ali  27  6.....WIFPYLRQYRGLLALAVLLGSLTVFFGGALMFTSGYLISKAAARPESILMVY---VPIVGVRAFGIGRAVLRYAERLAGHQFALKILSAMRVRLYKIVEPQALFLRSRFRTGDVLGALADDIEHLQDFYLKTLIPSIVSLAVYTAVLIAAGLFSAPFAILLGVFLGLLIFVGPIISYVYMKIKNEQLKRGRHRLYRQFTDAVFGISDWIFSGKYADYIRRYESQEQELFELETKKFSFVNGRDVLNQMVLGAVVILAVYWANGETISGTFPPTLIAACALAALSLTESFLPVAEAIAETSTYQDSIRRLEAIRAASPASSEGEKRHAAPDQVTIEINRLSFGYDP-KTPLLSDIRLKIDQGEKIAIIGRSGSGKSTLLKLIQGALVPSGGEVRINGIPAHELAP-AIPKMMAVLNQKPYLFHTSVMNNIRLGNPEASDEKVFEAAKKVQLHEMIRPEGYETNMHETGQRFSGGERQRIALARILLQNTPVVIMDEPTVGLDPITEADLLADIFDLLEGKTIIWVTHHLLGAEKMDRILFLEKGKITMAGSHQQLLAREERYRRLY... 570
94 0.000e+00gi|930615800|ref|WP_054267919.1| ABC transporter [Janthinobacterium sp. CG23_2]  clstr ali  24  24..AFKGLFPFLRPYRRQFLMAGVALVVAACATLAIPAAFKQMIDLGFGAPKSIRHVDATFLALFGVASVLAVATAARF---LTVSWLGERVTADIRSAVYKHVVEQSPEFFETTQTGEVLSRITTDTTLIQAVVGTSISMALRNVLLFLGGLVMLFVTSVKLSAIILGLLVLVIVPI-VLFGRRVRKLSRDSQDRIADASAMAGEILNAMPTVQAFTHEKIEATRFGKSVEGAFQTAMRRIRARALLTLIAIVLVFGTIVFVLWLGAHAVLQGTMTGGDLGQFILYASIVAGSIGALSEVMGEAQRAAGATERLLELLSVQSSIQNPAKPMALPARAATGLNDVTFSYPSRPEAALGHLTLSIAPGETVAVVGPSGAGKTTLFQLFLRFYDPQSGTITLDGVDIKRLDLHTLRDAIGIVPQDTVIFSADAMENIRYGRADATDAEVIAAARMAAAHEFIEPQGYKSFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERLVQSALEAAMVGRTTVIIAHRLATVQRADRIIVMEDGRIVETGTHASLVALGGIYANLA... 597
95 0.000e+00gi|504454380|ref|WP_014641482.1| thiol reductant ABC exporter subunit CydC [Halobacillus halophilus]  clstr ali  31  1MKDISQMIKLVALEKKDVLLSILFGFLAGMSAVGLFASSGYLISRAALVPP----LYALTVLIAFLKLFGFARALGRYAERYYSHRATFTMLSNIRVAFFEKLEPYAPRVFQKYRSGDLLARIVGDVESLQNFFLRVYYPPVVLVVIFLSTIVFTSIFSTSIAIVLLLGLVLTGVFVPYLFSLRQRTIENRVRESRGELSIDVTEFLFGFRDLKIYQQLEDKEERMHESSASYIREQEREGMQRIFSHSVNTLVSLLVSWVVLGLGAYLVARGDLNGLFLAMLVMISLTVFENATPMAVLPSHLEDSKRASGRLFSIGDE--MIEDKGRHLGGGESYGFELSGVDFHFPEEERQTLQQVNLKIPAGSKTALVGPSGSGKSTLLQLLLKIHTSDQGDIWLNDHPMERIDEESIWNRSNVVLQENHFFFGTVRENLQLAKDDLTDEQMLDALRDVELGSF----RLDYPVFEKGENLSGGEKQRLAIARAMLKGEQLWILDEPTSSIDALTERKIYERLFNQAERDTLILVSHRLTGLELMDQIIVMDEGTIVEKGTYHELMHKQGYFYEMKQ.. 562
96 0.000e+00gi|1011711810|ref|WP_062555694.1| ABC transporter [Rhizobium sp. Root149]  clstr ali  25  11.QPLLRLMPYVMRYRKMXXXXXXXXXXXXXTTLMLPLAVRRMVDHGFAA-ADGSFINSYFAMXXXXXXXXXXSSAMRYYYVIT---IGERVVADLRTEVFQRVTALSASFFDVNQSGEIVSRLTADTTQIKSAFGSAASQALRNVILCLGAMAMMILTSPKLSLLVLG--AIPLIVFPLVFGRSVRRRARAAQDTLAATSAFASETISANRTVHAFGAEQAASARYTSTVEAAYDAARVAIRSRAFLTGFAILMVFGSIVGVLWYGAQSVLNGTMTAGTLGQFVLYSVIAASSLGQLSEVWGELSQAGGAAERLSELLSEVPAIRDPQHPVSLPSPGEVSFDKVGFIYPTRTAAAIEQLSFTVAAGETVAVVGPSGAGKSTLLALLMRFYDPTSGAIRLDGVDLREARLAELRSRLAIVPQDVTIFAASIHDNIAFGQPNATREAVRQAAIAAQADEFISENGYDTMAGERGVTLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQKALDGLMQNRTTIVIAHRLATILKADRILVMENGRIVEEGTHQQLVAKGGLYASLAK.. 580
97 0.000e+00gi|923001530|ref|WP_053402970.1| thiol reductant ABC exporter subunit CydC [Bacillus koreensis]  clstr ali  27  1MKEKGWVIPYIKEQKHLFGFVLILSVVAMAATAALLFTSGYLISKSATRPENILLVY---VPIVAVRTFGILRSVSRYVERLASHGLILSIVSRMRPRLYRLLAPHA--LKRRVKTGEMLGVLANDIEHIQNMYVKTIFPSLAALFLYMICIMLLGLFSWPFAGLMAIYGLILVLVLPIFSLLVVKAKQVRMKEGRHGLYERLTDGILGISDWTFSGRQASFVSSIQAEDRMLTELENSQTRFVRSRTFFAQLTVGVLVVTMLLWTGMQAETGELSKTLIAAFILVIFPLAEAFLPLSDAMSDVPTYQNSIHRLSQLPEAEEQVS--KTIINTEDGVHLQMQNVSFGY--EDRLTVNDVSFELPSGKKLALIGPSGAGKSTIVKLLLGAERPMAGSVLLNDVPTHHVDE--IARYIGVLNQQPYLFDTSIVNNIRLGNPKASDEEVYEAGKQVGLHDYIAPDGYHTSMLETGLRFSGGERQRIALARLLLQKTPVVILDEPTVGLDARTEKELLRTIFNVLQGKTVVWITHHLAGMNVMDEILFLEEGAIKMRGDHQALLREE-RYRHLYE.. 561
98 0.000e+00gi|896209964|ref|WP_049214463.1| cysteine/glutathione ABC transporter ATP-binding protein/permease CydC [Pasteurella multocida]  clstr ali  48  1MRVLFPFLRLFKYAKFPLILGVILMITGLAASIGLLTLSGWFLAATAIAG--IGTLFNFFYPSSGVRGLAIGRTVARYFEKIVTHDATFRVLAKLRVQVFSRIIPLSPAVLNRYRHSDLLNRLVADVDTLDSLYLRLIAPFISAIVVIALITFGLSFIHIPLAVFIGSTLLTFLLVIPTLFYHLGNKFGDKLIQSRAIYRIQFVEFIQAQAELLLFDAEKPLKEKLNKTEQDWQDYQQKEANLAGLSSAILLFVNGLILATTLWIVADDLGTGMYKAALIALFAFSALAAFEILMPIGAAFLHIGQVIASAERVNEIIEQAPLVKFEGTAQNTTTQPLIQAHSLFFTYPDRKNLALNNLSLTIEQGKKVAILGKTGSGKSTLLQLLVRHYDANKGQLLLSGMPIQEYSEQALRQQICFLTQRVHVFSDSLRNNLQIANPDITDEKMIAILQQVGLAKLVEEEGLNLWLGDGGRPLSGGEQRRLGLARILLNNAPILLLDEPTEGLDRETERQILHLILMHAKNKTLLMVTHRLTLIEQFDKIYIIDEAKLIEQGTYNELIQQNSYFKKLVARI 579
99 0.000e+00gi|560219386|ref|WP_023605827.1| amino acid ABC transporter ATP-binding protein [Vagococcus lutrae]  clstr ali  25  17.....WVRPYFKKYRGXXXXXXXXXXXTFFSASALMFTSGYLISRSLTRPPRPDNVMRVYVPIVLTRAFGIGRPTFRYLERLGSHNWVLKMTSDIRLRLYRSLESRAAHSKESFQTGRIMGILAEDIEHIQNLYLRTIFPTIIGLLLYTLVVIGLGYFSWPFALFILLMFGVMVIVVPLASVAVNNARVYRRKYKRHAMYQQLTDAVLGVGDWQYSGRQADFLTRYTQAEKEVRVEDASLNKQTRMRNFITQLLFGIIIVAMFYWASDYFLS-RQQANWIAAFVLAVFPLMDAFGPISEGITETPMYEDSVQRLHELPEVNDDXXXXXXXXXLPVSADIQLEEVSYRYHPQSRELLTSFNLTIPAGQKIAVLGKSGTGKTTLSKLIRGDLTPVAGQITIGGIPVSELHG-QMSQVIGVLNQAPHLFDTTLMNNVRLGNLNASDEDVLKAIEQAGLKELVDPEGAHTMVEEGGKRFSGGEQQRIALARILLQDVPIVIIDEPTIGLDPITERALLATVFSVLKGKTIIWITHHLMSIEQADRVIFLEDGQLKMDGTPADLRAENEHYQHL.... 588
100 0.000e+00gi|56679577|gb|AAV96243.1| ABC transporter, ATP binding/permease protein [Ruegeria pomeroyi DSS-3]  clstr ali  25  67...LSALWPFMMPYKALMAGALMALVLTASMSLALPLAVRRVVDN--FRIENGDLLDVYFLAALGIAAVLALGTGIRYA--LVT-RLGERVVADIRKAVFDRVIGMSPEFYERIMTGEVLSRITTDTTLIQSVLGSSASIALRNMLLFAGGLVLMLLTSAKLTGXXXXXXXXXXXXI-LVLGRRLRAISRENQDWIAASSGNASEALSAVQTVQSYTNETASRAAFAEVTETAYDVSRRRIATRAVLTVIVIFLVFSGIVGVLWMGANDVRAGVMTEGTLIQFVIYSVIMAGAVAALSEIWSELQRAAGATERLVELLNAADSVNDPVQPLALPVQGEIAFDNVTFRYPARPDQALDGMSLTVRPGETVAFVGPSGAGKTTVIQLIQRFYDPQSGRVLLDGQDLTTLSRADFRRHIALVPQDPVIFAASARENIRFGRPSASDXXXXXXXXXXXXXXFIAPEGYDSFVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVERLSADRTTLIVAHRLATVKKADRIVVLEAGRIVAQGTHDELVAGGGLYARLAR.. 633
101 0.000e+00gi|490879011|ref|WP_004741005.1| ABC transporter ATP-binding protein [Vibrio splendidus]  clstr ali  21  29LSILLELIKFIQPYKGRVIAALIALIFTASLTLSVGHGIRLLIDQGFSQQSLSDLGSAIQFIMVVVVLISIGTFFRFYLVSSVG----ERVSADIRLSVFNHVVTLHPSYFETNGSGDIMSRITTDTTLLQSIIGSSFSMAMRSALMCLGAIIMLFATNIKLTLIVLASVPFILIPI-LVYGRRVRALSRKSQDSMSDVGSYAGEAIEHIKTVQSYSREAQEKASFALEVEKAYEIGRQRVKQRAILISGVIVIVFSAIAGMLWVGGTDVINGTMSAGDLAAFVFYAIMVASSLGTISEVMGELQRAAGATERLIEILQVKSHIVAPENPKSLDNTPEVAFDDVTFCYPSRPQPATSNLSLTAHEGKVLALVGPSGAGKTTLFELLQRFYDPQMGKVTLGGVELNQFDPNELRKQMALVPQQPALFSNDVFHNIRYGNPEATDEQVIEAAKKAHAHEFIQPDGYHSFLGERGVRLSGGQRQRIAIARAILKDPNILLLDEATSALDSESEHHVQQALEELMRGRTTIIIAHRLSTIKHADQIAVLDQGQLVDIGNHQSLINSCELYQRLVE.. 599
102 0.000e+00gi|948043113|ref|WP_056702203.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. Root52]  clstr ali  29  11.RKWDWITPYVKQYRWRFVGVIALGTAAMLCAVLLLFTSGYLISASALRPENILMVY---VPIVGVRAFGIFRAVFRYVERLAGHDAVLRVLADQRVKLYRILEPQALFLRSRMQTGDVLGALAEDVERLQDIYLRTIFPAITALVIYGAAVITFGTIDVGFACWMGLYMLFLIGVWPAISLQVTWKLNVRLKRENSKLYTRLTDGVLGLGDWMASGRAVEFVQQHDEEEGRADAIXXXXXXXXXXXDLVAQLVIGLMVVSVTVWAGGEVAAMQLPAVMIAAFVLVLFPLTEAILPVADAVEHIPQYRESLNRLHWLEAPEEQVLSKRTTISPNLRADIEINRISHRYTSSDADAVQEVSLDLPQGKRLAILGRSGGGKSTLLKLIQGAIVPTSGQVLINGLAVPTLR-EDMTDAISVLNQSPHLFDTTVANNLRIGRLDATNEEIRQVAAQVGLAELIEPQAYDTPMLETGLRFSGGERQRIALARVLLRETPIVIFDEPTVGLDPMTERALMRTILDSMQGKTMIWVTHNLMGAEQMDELIFMEKGKIVMQGSHEQLLAREERYRRLIE.. 596
103 0.000e+00gi|738179832|ref|WP_036136471.1| ABC transporter ATP-binding protein [Lysobacter daejeonensis]  clstr ali  26  21...LRTLWPFVSRHRGLFTAWLVALACSSAATLTLPKAFGTMIDQGFAQGGGAAIDRAFLLLFXXXXXXXXXXXXRFYFVSLLG----EKVVADLRERLYGHLVGLDLGFHDRNRSGELVSRLTADAELLRSVIGSTMSVALRSVVTFLGSLTMLFVTSPRLAAFALLGIPLAVLPI-VLGARRLQKISRASQDRVADANALAAETLGAVPTVQAHAREPYERGRFASALQTAVATAGRRIRAQAWVTAIAIVLVFGAITLVLWSGAHDVASGRMTAGTLGQFVLYALIGGGSVGALAEVWNELQRAAGGMGRISELLEETPAISAPAAPTGLPAPGDIVLDHVTFHYPQRPDPALEDFSLHVQPGETVALVGPSGAGKSTVFSMLLRFHDPQAGQVKVDNVDLRQLDPAALREAIALVPQHPTIFATNARDNIRYGRLDASDAEVDAAVRAAHAADFVAPERLDTQLGERGARLSGGQQQRIAIARALLKDAPILLLDEATSALDAQSERAVQQALETLMEGRTTLVIAHRLATVLKADRIVVMDHGRIVAEGRHEQLLAQDGLYAELAR.. 588
104 0.000e+00gi|738639019|ref|WP_036548393.1| thiol reductant ABC exporter subunit CydC [Nitrincola lacisaponensis]  clstr ali  42  1MSSLAPFIRLMKPHLGWVLLGSFLGLLTLFASIGLLTLSGWFIAATALAGVATAQAFNYMTPGGGVRGFAIARTAGRYFERITTHEATFRLLADLRSWFYGHLEPLNPARLHHYRSADLLNRIITDINSLDNLYLRVLSPSLIAAVTTLLVSGFLWWVAPSLGVLILVALLSAGILIPMLGHRLGATLGQSQVAKASALRQASLSYVQGMSELHLYQALDTQQALLEQRQQSLLDTQLRMSLITGLVTGLMXXXXXXXXXXXXIIGVSLVTEGSLAPAWLALVVFCVLASFEAVAPLPMAFQYLGKTRAAAANLLEITEQRSDIVFPAQPVQPTAPGEIRLQEVSFAY--DSTSVLQQLSLHIKPGEKIALTGHTGSGKSSVINLLTRFWLYQQGQIYLGGVPVEAYPEAQLRQQLSVLSQPVQLFAGSVRDNLRLGNPDATDVEMMQLLEQLELVDMLGSEGLEREVGEGGNRLSGGQRKRLGVARALLKPAPVLILDEPTEGLDMDTAQQVLDTLLNYRPGQTVLMITHHRQGLERFDQCIQLDRGR........................ 549
105 0.000e+00gi|550923185|ref|WP_022671657.1| ABC transporter ATP-binding protein [Sphingopyxis baekryungensis]  clstr ali  28  21...LKIVFRYLLRYPKQXXXXXXXXXXXXXXXXXIPRQLQQMVDKGFSQTGNIAPYFHYMFMIVGV--LAIATAARFYFVSWLG----ERVVADLRRDVHANLLGQAPRFFEENRPSEISSRLTADTSVIEQTVGTTVSIALRNVVLGIGGIIYLFVLAPGLATMLVIGIPLIIVPI-VLIGRKVRDVSRASQDRIADVGAMTSETLGAMKIVQAFGQEARERGRFAQAVEASFETACRRITWRAALTLVVITMIFSAITGIMWEGAADVVAGRLTGGTITAFIFAGVLTASSFGALTEVWGDILRGAGAAGRLGELLQAAPDISRGPKAVAMPAPGSLSFDSVTFRYPTRPDDALDDFTLTVEPGETVAVVGPSGAGKSTLFQLALRFYDPQRGTVRIDGVPLSSADPAELRQRIAYVPQETVLFAASARDNLRYGRWDAADEELWETARLANAETFLRPEGLDTYLGEGGARLSGGQRQRIAIARAMLRTAPILLLDEATSALDAESERLVQDALERLMVDRTTVVIAHRLATVRSANRIIVMDQGRIVEQGSHDALEAGGGLYARLAK.. 586
106 0.000e+00gi|518107778|ref|WP_019277986.1| ABC transporter ATP-binding protein [Vibrio coralliilyticus]  clstr ali  23  31...LLELIKFIRPYQWKVIAALVALVFTASLTLSVGQGVRLLIDEGFAQQSTQELSSAIQLILALTVMISIGTFFRFYLVSSVG----ERVSADIRLAVFNHVITLHPSYFETNGSGDIMSRITTDTTLLQSIIGSSFSMAMRSALMCVGAVIMLFATNIKLTLIVLAS--VPFILVPILFYRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSYSHEAQERASFATEVERAFEIGRQRVKQRAILISGVIVIVFSAIAGMLWVGGSDVISGTMSGGDLGAFVFYAIMVASSLATISEVLGELQRAAGATERLIEILQVESHIVAPSDKVVSTQQLEVIFDDVTFHYPSRPEAAIEHLALKAEEGKVLALVGPSGAGKTTLFELLQRFYDPQSGQVTLGGVDVRQMDPNELRLQMALVPQQPALFSNNVLHNIRYGNPDATDEQVIEAAKKAHAHDFIMPEGYDSFLGERGVRLSGGQRQRIAIARAILKDPNILLLDEATSALDSESEHHVQQALEELMRNRTTIIIAHRLSTIQHADQIAVLDHGKLVDVGNHNELLQSCELYQRLVE.. 598
107 0.000e+00gi|759466353|ref|WP_043187675.1| ABC transporter ATP-binding protein [Pseudomonas rhizosphaerae]  clstr ali  25  10.RGLRLAWRFVRPYRWQAFGALLALLVTAGITLSMGQGIRLLVDQGFMTQSAHLLNRSIAVFMVLVLALATGTFARFYLVSWIG----ERCVADIRKQVFDHLVHLHPAFYENNRSSEIQSRLTTDTALLQSVIGSSLSMFLRNLLMVIGGVVLLFVTNPKLTSIVVVALPLVLAPI-LMFGRQVRRLSRQSQDRIANVGSYVAETLTQIKTVQAYNHQAEDQRRFAVTVEQAFDTARQRIVQRAWLIALVIVLVLGAVAVMLWVGGMDVIGGRISAGELAAFVFYSLIVGSAFGTLSEVVGELQRAAGAAQRIAELLQARSDIQPPAHQLPSRVTGALALQDVVFAYPTRDAPAIQGMSLTVRPGETLALVGPSGAGKSTLFDLLLRFYDPQQGRLLIDGVDLREVDPQDLRRHFAIVSQTPALFFGSVEDNIRYGRADATAEQVEAAARIAHAHDFILPQGYQTPLGDAGMGLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEHLIQQAMPTLMQGRTTLVIAHRLATVQNADRIAVIDQGCLVALGTHAELVASNALYARLAH.. 580
108 0.000e+00gi|783168097|ref|WP_045681765.1| ABC transporter [Martelella endophytica]  clstr ali  25  15LRPLAAILPYFASYKGLVAGALAFLLIASAVTLTLPVAVRRVIDHGFSADDATLVNNYFLVLGVMALALGVA-SALRYFFVMI---LGERVVADLRRDVFAHVIRLSPAFFDVNQSGEIVSRLTADTVQIKSAFGASASIALRNLIMGLGALGMMIYTSPRLSVMV--IIAIPIIVLPMIAGRNVRGRSRKAQDELADATAFAGEAISSTRTLQAFTAEAMAGTRYAGAVEKAFNATRSALRARAGLTAVAISLVFCSITAILWFGARNVLSSSMSGGTLGQFLLYSVLAAGALGQLSEVWGELSLAAGAAERLSELLEEPLGIAAPSHPAALPEPGAIAIDTLAFRYPTGGTKALNGISLTVNAGETVAVVGPSGAGKSTLFSLLLRFYDPDAGTIRLDGVDLRDADPEALRRRFALVPQDVAIFAASIHDNIALGRPDATREEVRAAAIAAQADGFIEESGYDTLAGERGITLSGGQRQRIAIARAVLRDAPVLLLDEATSALDAESETLVQQALGTLMTGRTTLVIAHRLATVLSADRIVVMDEGRIVEEGTHETLVAENGLYARLAR.. 586
109 0.000e+00gi|916548192|ref|WP_051155283.1| ABC transporter [Herbaspirillum massiliense]  clstr ali  26  17...LRGLRPFLVPYRKQFILAGIALVVAAGATLAIPYAFKQMIDAGAVRAGDTSHIDLYFLALFAVAVLALATAARFYMVSWLG----ERVTADLRSAVYQHVVMQSPQFFETTQTGEVLSRLTTDTTLIQSLVGTSISMALRNALLFVGGLAMLFVTSAKLSSIILVLLAAVVLPI-VIFGRRVRKLSRESQDRVADASALAGEILNAMPIVQAYTREQQEAGRFRSAVEQAFRTALARIRARSLLTVIAILLVFGAIVFVLWLGAHAVVRGDMSAGDLGQFVLYAAVVAGAIGALSEVLGEAQRAAGAAERLLDLLALRSPIQPPAQVRPLPPRAALRLEHVTFHYPSRPQPSLADLSLNIAPGETVAVVGPSGAGKTTLFQLLLRFYDPQQGSIRLDGIDIRELDLHALRGAIGIVPQDTVIFSANAMDNIRYGRLDASDEEVVAAAKMAAAHEFIEPQGYQSFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERLVQGALEAAMAGRTTLVIAHRLATVQHADRIIVMEHGRIIESGTHASLSAQGGLYASLA... 588
110 0.000e+00gi|917465892|ref|WP_052072310.1| ABC transporter [Sphingopyxis sp. MWB1]  clstr ali  27  33...LRMIWRYASRYPLQLLVAAIALGVAALATLAIPYQFKEMIDSGFIAGGDVAPHFRLFYAIVLI--LAVATALRFYFVSWLG----ERTVADIRQAVQQNLLRLAPGFFEENRPSEIASRMTSDTAIIEQVVGTTVSVALRNLVIGIGGIIYLFTLSPKLTGGILLGIPLIIMPI-VLLGRRLQNVSRSSQDRVADIGATTAEQLGAMKIVQAFGQEAREAGRFTTAVEANFATAKRRIRLRATITAVVIGLLFGAITTLLWYGAEGVAAGTITGGTIAAFVLTGGLVAGAFGALTEVYGDLLRAAGSAERLSELLSVEAAIAPPANPRALPEPGTLAFEGVEFRYPTRPDPALHDFTLRIAPRETVAIVGPSGAGKSTLFQLAERFYDPQQGRILLDGVPLTEADPAAIRARIALVPQEMVIFAATARDNLRYGNWDATDDQLWEAARAANAEDFLRPEGLDTYMGEGGARLSGGQRQRIAIARALLRQAPLLLLDEATSALDAESERLVQDALDALMHDRTTIVIAHRLATVRAADRIIVMDEGRIVEEGRHEDLVRAEGLYARLAR.. 599
111 0.000e+00gi|746725422|ref|WP_039682744.1| ABC transporter [Tateyamaria sp. ANG-S1]  clstr ali  25  26..ALRALWPFVVPYWKLMCAAIAALVSTAIVSLTLPLAVRRVVDN--FNTEHSEILDLYFLAAIGIAGLLAIGTAVRYM--LVT-RLGERVVADIRKAVFDRVIGMSPSFYENIMTGEVLSRITTDTTLILSVIGSSISIALRNMLIFIGGLVLMLLTSAKLTGLVLLIVPAVVVPI-LVLGRRLRVLSRENQDWIAASSGSASEQLSAVQTVQAFTHEATSRTMFSDVTELSFGAARRRIAVRALMTAIVIFLVFVGIVGVLWIGANDVRSDAMTMGALIQFVIYAVMVAGGVAALSEIIGELQRAAGATERLVELLQVEDAVQDVSAPVAVPAPGHIRFEDVRFAYPARPGKALDGVTLDIQPGETVAFVGPSGAGKTTIIQMLLRFYDPQEGRVLLDGVDVAEMAREAFRQEIALVPQDPIIFAASAAENIAFGRPGASQTEIEXXXXXXXXHDFISPDGYDSPLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQEAVDTLAQGRTTLIVAHRLATVKMADRIVVLDQGRIVAQGPHHQLVAEDGLYARLAR.. 593
112 0.000e+00gi|915469197|ref|WP_050808730.1| ABC transporter [Collimonas fungivorans]  clstr ali  24  38...LVGLVPFLAPYKRQFVMASLALLVAAGATLAIPYAFRQMIDLGFSAGGGANHIDMYFLALFGVAVLGVATAARFYMVSWLG----ERVTADLRSAVYSHVVTQSPQFFETTKTGEVLSRITTDTTLIQALVGTSISMALRNALLFVGGMVMLFITSVKLSAIILVMLALVVLPI-VWYGRRVRKLSRDSQDRVADASAMAGEILNAMPTVQAFTHESIEAQRFGVSIENAFGTAMQRIRARSVLTMMAILLVFGAIVFVLWLGAHAVVQGRMSGGELGQFILYAALLAGSIGALAEVLGDAQRAAGATERLLELLAAQSPVQSVLLPDTLPQGAALTLENIGFRYPSRPEAALSALSLDIRPGETVAVVGPSGAGKTTLFQLLLRFYDPQQGSIKLDGVDIKYLDLHTLRSAIGIVPQDTVIFSANAMENIRYGRVGASDAEVIAAAKMAAAHEFIEPEGYQAFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERAVQGALEAAMVGRTTLVIAHRLATVQRADRIIVLEHGHIVETGSHAELVAQNGLYASLA... 609
113 0.000e+00JGI.Meta 7016130307 SRS063288_LANL_scaffold_6413__gene_10547 thiol reductant ABC exporter, cydC subunit [Human Tongue dorsum microbiome from  ali  50  1MKSLIPFLSLYRTHWGRLLLGVILAITSLSASIGLLSLSGWFLAASFLAGS--ALVFNFFYPSSGVRGLAIGRTVSRYFERLVTHDATFRVLANLRVTIFKKLIPLSPSGLKRYRNSELLNRLVADVDTLDTLYLNLVTPFVSALMVIAFMAIGLSFVSGLLAIIICGTLLALLAIFPTIFYHLGRKLGQNTVQSRAQYRAQFIEWIQLHAEFLLFGLVPEMTSKLQKTEEQWLEQQSKESHLTGLSNALLVFSNGILLCVVIYLISSAIHAPTYPQALIALVIFCVMASTEILMPIGVAFLHLGQVIAAAERLNEITEQPAQVSFNGSATVVLNQPLIEFDSVSFCYPMQSEMATKSISLSIKAGEKIAIVGKTGSGKSTLFQLLNRNYAPTSGRILLNHCEIADYPEAVLRQHLVTLSQRVHIFNASLKQNLLMGNPTASDAQLLEVLETVGLA-YLNEEGLSLWLGEGGRPLSGGEQRRLGLARVLLSQADVILLDEPTEGLDRETEQLILRLILSHCANKTLLMITHRLKGLSEFDRIYQIDNGRLV...................... 553
114 0.000e+00gi|748251701|ref|WP_039807058.1| thiol reductant ABC exporter subunit CydC [Jeotgalibacillus malaysiensis]  clstr ali  29  1MRELSIVLRQIAVERKNVWYSVLFGYIGGVTAAGLFAASGYLISKAALIPP----VYTLTLLIAFIKVFGLVKAGSKYGERMVSHRATFNILAGIRVRFFEKLEPLAPGIFQKFRSGDLLARITGDVESLQNFFLRVYYPPLVLILVFISAMLFTTFYSFWFPLIFAAGLLLTGLIIPALFALRRQKIEEKVRESRAILSTDTAEVLYGFRDLKIYQQLDEKGASLRTSSAAYIANQEKSSSQSMFNQSVNQAAGLLISWVVLAAGVYLVQQDQLDGVFLAMLVMLSLNIFENAAPMAVLPPHLEDSRKASSRLNEVTDMVPATASEPYETLTDEAPSISFQSVSYTHEGEERPAVDQTSFEVKAGSKTAIVGASGSGKSTIFQLLLGVLRTNDGDIAIQDRSIRHIKSEDIWEKANVVMQENHFFYGTIRDNLQIAREGLTDEEMQWVLEKVQLSRFT----LDDAVLEKGENLSGGERQRLAIARALLRKRSLWLLDEPLSSIDNVTSADIMRYLEERTEDATVCLISHQLNGLEKMDQIIVMDGGQIAEKGSYEELMTAKGMFYEMKK.. 563
115 0.000e+00gi|766744320|ref|WP_044831134.1| ABC transporter ATP-binding protein [Thalassomonas actiniarum]  clstr ali  24  27...LLELLQFIRPYKARGLAAIIVLIFTAAVMLSVGQGVRMLIDQGFVQQSLEQLKNAVFFILGITVLIAAGTFARFYLVSWIG----ERVSADIRLAVFNHVITLHPSYFETSGSGDIMSRITTDTTLLQSIIGSSFSMALRSALMFLGALVMLFATNIKLTLIVLTS--VPFILVPILFYRKVRKLSRKSQDSMADVGSYAGEAIEHIKTVQSYTREVEEKISFYGEVEKTFQIGRRRIQQRATLIAGVIVIVFGAITGMLWVGGSDVISGKMSGGDLGAFVFYAILVASSLATISEVLGELQRAAGATERLIEILQVESHILPPVKNAVPAAPAEISFKNVTFNYPSRPDPATDALTLSVEQGKVLALVGPSGAGKTTLFELLQRFYDPQSGTIALGGTDIRQLDPKDLRQQMALVPQQPALFSSDVFHNIRYGKPDASDEEVIEAAKKAHAHEFILPEGYNSFLGEKGVRLSGGQRQRIAIARAILKDPHILLLDEATSALDSESEHHVQQALEELMRGRTTLIIAHRLSTIQHADQIAVLDQGKLIEMGDHKSLMASCELYQRLVE.. 594
116 0.000e+00gi|497351989|ref|WP_009666202.1| ABC transporter [Oxalobacteraceae bacterium IMCC9480]  clstr ali  25  30...LAELLPFLKPYLRQFLLAGLALLVAACATLAVPYAFKQMIDLGFGGNGSADHINLYFLALFGVAVLAIATAARFYMVSWLG----ERVPADIRSAVYAHVVTQSPKFFETTQRGEVLSRLTTDTTLIQSVVGTSISMALRNVLLFFGGMVMLFITSVKLTAIIFGALFLVVAPI-VIFGRRVRKLSRDTQDRIADASAMAGEILNAMPTVQAFTHEKIESQRFSKLVEDAFVTAMRRIRARSLLTMIAILLVFGAIVFVLWLGAHAVIEGTMTGGSLGQFILYAAIVAGSIGALSEVLGEAQRAAGATERLLELLAEESPIQSPAVPKPLPQGATLSLKDITFHYPSRPDPALAHLSLTIPAGETIAIVGPSGAGKSTLFQMLLRLYDPQQGSILLDGVDITELDLHTLREAIGIVPQDTVVFSANAMENIRYGRAGATDDEVIAAAKMAAAHEFIEPEGYQSFLGERGVRLSGGQRQRIAIARAMLKNPPLLLLDEATSPLDAESERLVQSALEAAMVGRTTVVIAHRLATVKRADRIVVLEHGQIVEMGTHAELVALDGLYASLA... 601
117 0.000e+00gi|797177501|ref|WP_045848415.1| MULTISPECIES: ABC transporter [Aquitalea]  clstr ali  24  15.SPLLGLLPFLRPYRHRAWLALLALTVAAVSTLVLPMAFRVLIDQGFSS-RNAGHINQYFLMLFGVAVLALATAGRFYLVSWLG----ERVTADVRSAVYRHVISMSPQYFETTQTGEVLSRLTTDTTLVQTVIGTSLSMGLRNVLLMLGGLVMLAMTSPSLTGYILVTLLLVVLPI-VLFGRRVRALSKSSQDRIADSSAMAGEVLNAIPTVQAFNQQAAEASRFVGSVELSFATALARIRARSLLTVAVIMLIFGAIVFVLWLGAQQVLAGQMSGGLLAQFILYAVVTAGAIGAVAEVWGDVQRAAGATERLMELLQLASPVTEPQHPHALPTAGRLRLQQVSFAYPSRPQPSLSQIDLELAPGEHVALVGPSGAGKSTLFQLLLRFYDPQQGQISLGGIDIRQLALADLRQHIGVVLQDSVIFGSSALENIRYGRPDATDEEVYXXXXXXXXHDFIQPQGYATYLGERGVRLSGGQRQRIAIARAILKNPPILLLDEATSALDAESEQLVQGALERAAANRTTLVIAHRLATVKEADRIVVLEGGRIVAQGRHEELLHSSPLY....... 577
118 0.000e+00gi|949500099|ref|WP_056942111.1| thiol reductant ABC exporter subunit CydC [Lactobacillus kimchicus]  clstr ali  26  1MKSIRWVMPYLRKYKWLLTLVLFLGLMTFFSAGALMFNSGYLISEAARRPDAMIYIY---VPVVLARAFGIARPTFRYAERLTSHNWVLKIVSDFRKKLYETVEQKAVAIHQSHQTGDLLSILADDIDHIENLYLRTVFPIVIGWLLYLVVIIGVGVFSWQTGVLMLLLLGVIVVLMPLISVSVNGAREFQQRQIQHAFYTNLTDEVLGLSDWVISGRHDDFMALQEKPIKEIANLRRKDHFFQWWRGFWVQVFFLAAVVALLIWAGMAFTGSKMAANWVAAFVLALFPVVDPFLEISQGASEWPVYQQSIDRVNHLSHAP--VTQTPQQSLPTTFETLAIEDLSFAYKGEESAVLQDVSLTVKAGEKLALLGPSGTGKSTLLKLILGDERPTKGHVQVNGIDIASL-QDERANLFGVLDQQPYLFDTTVMNNVRLGNLNATDAEVKQAIEAVALKPLIEPNGYDTEVQEAGARFSGGERQRLSLARILLQDAPVIILDEPTVSLDPITERQLLDTLFEVLHDKTIIWVTHHLAGINHVDEVRFLEAGQFDMQGTPADLYATEPRFKQLY... 573
119 0.000e+00gi|493980536|ref|WP_006923464.1| ABC transporter [Bartonella washoensis]  clstr ali  25  21.SSLSTFAPYMMRYRWLFIFAFLALSVAALVTLALPVAIRQMLDHGFSSSSPGNINF-YFGILFVLALLLALASACRYYCVIT---LGERIVADLRRDVFSHITQLSPAFFDHSHSGELVSRLLTDTTQIKLAVGSTASIALRHLIVVIGAIVMMVITNAKLSSLVL--LAIPFVAIPLVFGRKVRTRTRVAQDRLADANALATEQVSAIRTVQAFTAEKFVSARFSKLVERAFKTARASVILRSFFTGFAIFLVFSSVVAVLWIGSHDVLSGAMSGGTLGQFVLYAVFGASTFAQLSEVGAELMQAAGAAERLAELLQEQPTVAPPKVPLPLAQPGAIAFDYVDFTYPSRPQKILRSLSFSVKPGETVAFVGASGAGKSTIFSLILRFYDPKSGKIRFDGVEINRLSLQDLRSSISYVPQDVAIFDGTLRDNIVFGSENVREEQIIAAAKTANAFEFIKPNGFDTKVGERGTMLSGGQKQRIGIARAVLKNAPLLLLDEATSALDANSEMLVQQALDGLMQNRTTLVIAHRLATILKADRIFVMDKGALVEEGTHAELIAQNGIYAHLAK.. 590
120 0.000e+00gi|653008346|ref|WP_027260506.1| ABC transporter [Sedimentitalea nanhaiensis]  clstr ali  24  26...LGALWPFMVPYRGLIVASGMALVLTACVSLTLPLAVRRVVDN--FRVQDGAILDQYFXXXXXXXXXXXVGTGLRYA--LVT-RLGERVVADIRMAVFDRVIGMSPEFFEKIMTGEVLSRITTDTTLIQSVLGSSISIALRNFLIFFGGLVLMLLTSGKLTGMVLLIVPAVIVPI-LVLGRRLRVISRENQDWIAASSGNASEALGAVQTVQSFTHEAASRVQFAEMTETAFEVSLRRIRTRALMTVIVIFLVFTGVVGVLWMGALDVRMGVMTEGALVQFVIYSVMVAGSVAALSEIWGELQRAAGATERLVELLHSVDTVQDPAQPRLLPDPGQITFCDVSFRYPARPEAALQDVSLDIAPGETVAFVGPSGAGKTTIIQLIQRFYVPDRGRILLDGVDLGELTREVYRKHIALVPQDPVIFAASARENIRFGRPDASDSEVEXXXXXXXXXXXXXPQGYDSFVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAQSERAVQHAVDELSAGRTTLIVAHRLATVKKADRIVVLDQGRIVAMGPHDQLVAEDGLYARLAR.. 592
121 0.000e+00gi|749690475|ref|WP_040286227.1| amino acid ABC transporter ATP-binding protein [Sporosarcina koreensis]  clstr ali  27  1MNHVTGFVPYVKKYWKLMSSSVXXXXXXXXXXXXXIFVSGYLISRSSERPETILLVY---VPIVLVRAFGLSRAVFSYAERMTGHNAVLKVLSDMRIRLYRALEPQALFIRSRFKRGDLLGTLADDIEHLQDVYIRTIFPVVSGLVLFLFATVSLSVFDWKFGLFIGLCLSVFVFVYPLYSLRIRKRHMQRSKQQHTRLYHTLGDAVYGIRDWLISSRSADFLEKFGAERDASYSTDLDITRKDQARTLQLQLFSGIITVVVGIWAGIQAADGVITPVYIAAFTLVTLPIIEALIPISNAMERIPAYEEAFTRLRFTEETASQIRETEDPLPVPAPVGISISGASYSYQEGARKALSDMTLSIGQGERIAVLGKSGAGKSTFLNLLLGALEPDAGTIAIAGQPPSSY-GDHIHQLVSVLNQKPYLFGTTIENNLRLGKPDASAEELDAAIRQVGLEEYIRPDGLQTQTEEAGRRFSGGERQRLALARILLNDTPVVIVDEPSVGLDPETERNLIRTMLDSLKGKTVIWITHHLMGMELMDRIIFLEDGRIAQEGTHEELLRKSGRYHRLVE.. 571
122 0.000e+00gi|516078605|ref|WP_017509188.1| hypothetical protein [beta proteobacterium L13]  clstr ali  24  20LTPLGGLLPFMRPYRGRFVLAGLSLLVAAAATLLLPVAFRYLIDHAFTQ---RQAVDGYFLALFGLAVLALFTALRFYLVSWLG----ERVTADLRSAVYRHVVGMSPEYFETLQTGEVLSRLTTDTTLVQTVVGTSLSMGLRNVLLMLGGLVMLAVTSPSLTGYILLTLLLVIVPI-LVYGRRVRALSRSSQDRIADSSAMAGEALNAVQTVQAFAQEGHEVARFDASVTRSFDTALARIVARSQLTALVILLVFGAIVFVLWLGAHAVLAGQMSSGQLAQFILYAVVTAGAIGAVAEVWGDLQRAAGATERLLALLAQRSPVQPPAQPQWLPPEGELQLDSVTFAYPSRPQPSLQGLNLQVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQVGRIRLNGVAIDQLDPAALRRHIGIVLQDTVIFAASALENIRYGRPDASDDEVIAAARAAAAHDFIEPEGYHSFLGERGVRLSGGQRQRIAIARAILKNPPILLLDEATSALDAESEQLVQQALEHAAAGRTTLVIAHRLATVKQADRIIVLEGGCIVAEGRHEQLLQTSPLYARLA... 586
123 0.000e+00gi|737182813|ref|WP_035168734.1| amino acid ABC transporter ATP-binding protein [Lactobacillus curieae]  clstr ali  25  1MKNLRWVMPYLRKYKALLALVLFLGFMTFFSAGALMFNSGFLISEAARRPDSIIYIY---VPVVLARAFGIARPSFRYAERLTSHNWVLKIVSDFRKKLYQTVEKRATTIQRSHQTGDILSILADDIEHIENLYLRTVFPIVIGWLLYLFIVIGIGVLNWQVAILMAILLGVIVILLPLLSVVTNGAREFKQHQVQHEFYTNLTDQVLGLSDWKISGRYDDFLKMQQAPIEEIATLRRQDHYYQWWRGLFVQFIIFLAVLVLTVWTGIQFGATKGQANWVAAFALALFPAVDPFLSISQAASEWPIYKRSIDRVNEL-DRSVEKQLPEQVELGSVFETLNVDDVDFHYQGADEMVLKKLTLEVKQGEKLALLGPSGTGKSTLLKLLVGDETPTSGEITINGIPVAKL-QHERANLFGVLDQKPYLFDTTVMNNVRLGNPSATDDEVKQAIAAVGLQELIEPDQYDTEVKEAGQRFSGGERQRLSLARLLLQDAPIIILDEPTVSLDPITEKQLLDQVFTLLKDKTIIWVTHHLAGVAHVDQVRFLEAGKFEMVGTPKELYMNNEHFRKLY... 574
124 0.000e+00gi|655115862|ref|WP_028563485.1| thiol reductant ABC exporter subunit CydC [Paenibacillus pinihumi]  clstr ali  31  1MKELAILTKAMIQERKDIALAIIGGFIAGLAGVILFSASGYMISQTVFAPP----LYTLIVLTSLVKILGLLRAASRYAERLYSHRATFSLLSRLRTSFFSRLVPLAPGILGKKRSGELLARIVGDVESLQHYFLRVAYPPVIVVMVFLATVVFTSAFSFWMAGLFVLGMLTTAFVVPGLVLLGQRKIHGRVIRQRALLSAEVTEFLYGFRDLKVYGQLNKRDHQLQRASAALAAEQETAARNLLRGQSLHTFVSYLISWGVLALGSYLIMDGSLAGVYLAMLIMASLTVFEEAAPMATLPAYKQESEHAAKRLSETVHAAPILPSPSGVLSVNQGISIELDGVSFQYEDEWRPALRDISLHFPAGSKTAIVGPSGSGKTTIIELLLKLRTPTGGQIRINGVLTEELDEASIWRASNVVLQQSHFFRGTIRDNLLLDEEEYPDEVLSAILDKAQLPN----KSLDDRVFEKGENLSDGEKQRLALARAMLRKGRLWLLDEPTSSVDYITEKHIFRHLMKEAANDTLILICHRLTGLEEMDCILVIDQGRVVEAGTYTELMEQQGYFYEMK... 563
125 0.000e+00gi|631491824|ref|WP_024271179.1| ATP-binding protein of ABC transporter [Shinella sp. DD12]  clstr ali  26  20.RPLGRLAPYIGRYRGLVAGALVALVMAAVTTLILPLAVRRMIDHGFS-GADAGFINTYFMMLFALAGLLALASAMRYYFVIT---LGERIVADLRRDVFSHVTRLSPAFFDVNQSGEIVSRLTADTTQIKSAVGATASVALRNLILCFGAIAMMVYTSPKLSSLVIA--AIPVIVFPLVFGRSVRRRSREAQDTLAAASAYAGEAIGATRTLQAFNAEDAARARFFGAVEQAYGAARSAIRARSLLTGFAIAMIFGSVVAVLWFGARDVLAGTLSAGTLGQFLLYAVFAAGSLGALSEVWGELSQAAGAAERLTELLAEPPAITAPANPVPLPARGELTFRDVHFSYPARPGRSINGLDFAVRQGETVAIVGPSGAGKSTILSLVLRFYDPDTGTVLLDGVDLRAADPEELRRRIALVPQDVTIFAATIRDNIAFGMTGVSDXXXXXXXXXXXXXXFIADKGYDTMVGERGVTLSGGQRQRIAIARAILKDAPLLLLDEATSALDAESETLVQKALDGQMGKRTTIVIAHRLATVLKADRILVMEAGRIVEEGTHQSLIRQDGLYARLAR.. 589
126 0.000e+00gi|800969951|ref|WP_045996616.1| ABC transporter [Loktanella sp. S4079]  clstr ali  27  18.SALKALWPFLKPYRLNIIGAGLALIFTATVSLILPIAARLIVDNSATDGAILSEHFNTMLTFAGLLALG---TAVRYY--LVT-RLGERIVADIRKAVFGRMISMSPAFYERVMTGEVLSRITTDTTLILSVVGSSASIALRNILIFMGGVVLMLLTSVKMSIMVL--WPIPVVLFPMILGRRVRSLSKENQDLIAESSGGASEQLLSAQTVQAFTNEDRSRAKFNEVTEQSYRSARRRILTRAFLTALVIFMVFSAIVLFLQMGSQDVRTGETTEGGLVQFMIYTIMVGGAVAALSEVWGELQRAAGATERLVELLTMEDTVQDPEQPASVTAPGALQFDDVHFSYPSRSDPALHGVNLDIQPGETVALVGPSGAGKSTMIHLVQRFYDPQIGAVRLDGQDLRDMERTEFRKHIALVPQDPVIFADTARENIRFGRPNATDXXXXXXXXXXXXHDFLSPDGYDSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESEHAVQVAVEELAKTRTTLIVAHRLATVKKADRIVVFEEGAIVAQGTHDSLVAQGGLYARLAK.. 586
127 0.000e+00gi|695754730|gb|KGK78777.1| ABC transporter [Thalassobacter stenotrophicus]  clstr ali  26  35...LQALWPFMAPYRTLLFAAIGALVLTACVSLTLPLAVRRVVD-GFQMGSSELL-DKYFLAALGIAGLLAIGTGLRYY--LVT-RLGERVVADIRTAVFARMITMSPSFFEKIMTGEVLSRITTDTTLLLSVIGSSVSIALRNILIFLGGLGLMMWTTPKLSXXXXXXXXXXXXXX-IVLGRRLRRLSKENQDWIADSSGKASENLLSAQTVQAFTHERQTANLFASVTEASFESAKTRIKTRAVMTVIVISLIFVGIVGVLWIGARDVRAEIMTIGELIQFLIYAIMVAGAVGALSEIWGELQRAAGATERLVELLEEQDAVADPVVPQALPDRGALEFDNVTFRYPARPEAALNGISLRVEPGETVALVGPSGAGKSTIIQLIQRFYDPSEGEIRLDGLNLQSMNRAAFRKAMALVPQEAVIFAASARENIRFGRPEASDXXXXXXXXXXXXHGFLSPEGYDTYVGERGVMLSGGQKQRIAIARAILRDAPILLLDEATSALDAESERLVQEAVTAMSKDRTTLIVAHRLATVKQADRILVFEDGQIVAEGTHDSLVAQGGLYARLAR.. 601
128 0.000e+00gi|501020168|ref|WP_012072839.1| cysteine/glutathione ABC transporter ATP-binding protein/permease CydC [Actinobacillus succinogenes]  clstr ali  50  1MRTLLPYLKLFRHAKISLIFGVILMITGLAAGIGLLSLSGWFLAA--TAIAGAGTLFNFFYPSAGVRGLAIGRTAARYFERLVTHDATFRILAKLRVRVFEKIIPLSPAVLNRYRNSDLLNRLVADVDTLDSLYLRLIAPFISAVAVIIFMTFGLSFFNLSLALFIGGTLLILLLIMPVVFYRLGRQFGAKLTQSRARYREQFVEFIQAQAELLLFHASSALQDELVQTERHWQAYQQRESNLSGLSTALFMFFNGLLVVLTLWLAASVEFGSELEQAFIALFTMSALAAFEILMPLGAAFLHIGQVIASAERVSDIVRQKPPVDFSGTQSAVNTRVLFDIQQVTFRYPERTHIALNQLNLQILRGTKVAVLGKTGSGKSTLLQLLVRHYVPDSGDILLAGQPISAYSESALRAQTAFLTQRVHIFSDSLRNNLQLANTKLTDQQMLNALNQTGLQNLAE-QGLEQWLGDGGRPLSGGEQRRLGLARILLSDAPILLLDEPTEGLDRETERHILQLIFEHAKEKTLIMVTHRLTAIEQFDQICVVDDSRLIENGHFDELMERENLFKQLMERI 574
129 0.000e+00gi|408750270|emb|CCM76340.1| Lipid A ABC exporter family, fused ATPase and inner membrane subunits [Rhizobium mesoamericanum STM3625]  clstr ali  25  23LKPLGRLTPYVARYRGMVAGALASLALAAITSLALPLAVRRMIDHGFTQ-ADGSFINSYFLMLMIMAIVLAIASALRYYFVI---SLGERVVSDLRRDVFNHVTRLSPSFFDVNQSGEIVSRLTADTTQIKSAVGATASVALRNLILCLGAMGMMIVTSPKLSSLVIG--AIPLIVFPLVFGRSVRKRSRSAQDTLADASAFANETIAASRTVQAFGGENVAASRYGTAVETAYDAARAAIRSRALLTGIAITLIFGSVVAVLWVGAHNVLAGTLSPGTLGQFLLYAVIAAGSLGALSEVWGELSQAAGAADRLTELLDEVSPIXXXXXXXXXXXXGHVQFTDVHFAYPSRPRSALHGLSFDVAPGETVAIVGPSGAGKSTVFSLLLRFYDPQQGAVKIDGIDARSTDPDGLRKRLAIVPQDVTIFAASIHDNIAFGRPEASREEVRAAAIAAQADEFIADKGYDTQVGERGITLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQKALDGLMTGRTTLVIAHRLATVLKADRILVMDQGRVVEEGTHQTLIRGGGIYAKLAK.. 593
130 0.000e+00gi|489417187|ref|WP_003322989.1| thiol reductant ABC exporter subunit CydC [Bacillus alcalophilus]  clstr ali  32  1MRHLSMVISIMLQEKRDILLSIVFGFIAGITAVGLFSASGYLISQAALVPP----IYTLMIIVAIVKLLGITSAVSRYGERYFSHRATFTMLSNIRVFVYQKIEPLSSTILQRYRSGDLLARIVGDVESLQNFLLRVFYPPVVTATVFIATIAFTTIFSIGTAFILLSGMLLLTLIIPALFLIKQSRVDQKNRQIRGNLSSEFTEFLYGYKDLKINQQATSQRNQLIITVQAYEKEQKRAHEVQLFNESVIGFLSLFISVLVLAFAGYQVVQGNLEGILLAMLFMISITVFEQTAPMALVPHFLQQSNVATKRLVQVWNQEESEQESYVKWENHHIPSIQFEDVSFTYMDETRPTLDRISFELPAGSKTAIVGASGSGKTTILQVLLKVQPLDSGKVTFNDWDIDKIKEEEIWKASNVSLQSNHFFFGTIRDNLEIANPEASDTELTQALRDVQLAHL----NLEDAVQEKGANLSGGEKQRLALARLFLKEAQIWVLDEPTSSMDALTEERMLSNLFEKAGTATLVLVSHRLTGLEKMDQIIVMDHGKIVESGSYKQLMDKNGYFKQMK... 563
131 0.000e+00gi|654629378|ref|WP_028093568.1| ABC transporter [Pseudodonghicola xiamenensis]  clstr ali  23  27...LGALWPYMRPYLGLIVAALLALVFTSTVSLILPLAVRRVVD--SFRDGQTQLLDQYFXXXXXXXXXXXXXTGLRYA--LVT-KLGERVVADLRKAVFDRVIGMSPEFFEQIMTGEVLSRITTDTTLIQSVLGSSVSIALRNMLLFLGGMVLMLLTSAKLTGLVLLIVPAVVVPI-LVLGRRLRKVSRENQDWIAASSGNASEALGAVQTVQAFTNEAASRARFGEMTETSYQVSQRRIVTRALLTVIVIFLVFTGIVGVLWIGARDVRAGMMSDGMLVQFVIYAVLVAGSVAALSEIWSELQRAAGATERLVELLNAEDKVQDPATPRTLPQPGEIAFEGVTFRYPARPEAALSDISLHIRPGETVAFVGPSGAGKTTIIQLALRFYDPDQGRVTLDGIDLRDMARDDFRRAVALVPQDPVIFADSARENIRFGRPEATDXXXXXXXXXXXXXXXXXPQGYDSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQLAVDELSQSRTTLIVAHRLATVKKADRIVVMEAGHIVAIGTHEELVAQGGLYARLAR.. 593
132 0.000e+00gi|446989903|ref|WP_001067159.1| amino acid ABC transporter ATP-binding protein [Bacillus cereus]  clstr ali  30  4.....WIGPYIKQNKGRMTLTLILGLLGISSGAMLLFISGYLISKSSLQPENVMAVY---VPIVATRAFSIGQAVFHYVERLVGHDVVLRILEKMRTKLYRIVEPQALFLRSRFQTGDVLGVLSEDIEHLQNLYLRTIFPSILALAVYSIFVVILGAFDWMFALIAGSMLAVIVFLLPFVSLFMMKQQHVRLKQGRNRLYQQLTDAVFGLSDWQASGRTTEFVKEYTEQNVQLVKIEKKMKRWHHIRDGIIHLIVGIVVISMIIWTGNQAGSGQIAPTVIAAFILMTLSITNALIPVSDAIDRIPSYVESAHRLHNVESAIVAEERRETCEEVPKDVEIELRNVSYSYPESNELILKDISLKMKAGKKIAILGRSGTGKSTLLKLLTGALNPVNGQVLLNGK-LAHTNL--LSKYISVLNQKPHLFDTTIGNNVRIGRPEASDQDIWKALEQAQIASHIQPNGLQTKMHEMGKRFSGGERQRVAFARTLMQEAPIIVLDEPTIGLDPKTEVALLETMFAATKDKTVIWVTHHLMGIEHADETIFLDGGQIVMQGSHKQLLMSNEKYRKLYE.. 569
133 0.000e+00gi|822629962|ref|WP_047003856.1| ABC transporter [Erythrobacter luteus]  clstr ali  27  22..PLRMIFREALKYPWHYTAAMIALLVTAVTSLALPSALKLIIDRGFGGEEDVGRWFRYLLILVGVLG--LGTAVRFYFISWLG----ERVVADVRTRVYDNLLRLSPSFFEENSPKEISSRMVADTAIIEQVVGTTLSVALRNTIMVILGVGYLFWLAPQLAVWLVLGLPLVMIPL-VVFGRRLKGVSRDSQDRVADVGGITTEVLSAMKIVQGFNQEGRESGRFAAAVERTFATAKVRIMLRAVMTALLITLIFGGLVLLLWRGAVLVTTGEITGGTIGAFIFAGVIVAGSAGALTEVMGDLLRGAGAASRLGELMAEEPVITAPARPQALPHPGSLAFSGVTFSYPTRPENAIADFTLTVEPGETVAIVGPSGAGKSTVFQLAERFYDPQAGTVRMDGVPLTQADPAEVRRRMALVPQEGVLFAANARDNLRYGAWDASDEAIWEAARAANAEQFLRPDGLDTFLGEGGARLSGGQRQRMAIARALLRDAPILLLDEATSALDAESERLVQDALERLMAERTTLVIAHRLATVRAADRIVVMEGGRIVEIGDHASLSAEGGLYARLA... 588
134 0.000e+00gi|1021342489|gb|KZN28941.1| hypothetical protein N480_09240 [Pseudoalteromonas luteoviolacea S2607]  clstr ali  26  15...LLPIVSFIKPYKWVAALALCVLVVTAGLNLSIGQGVKFVIDSGFIAGSEEQLTQAIGGLVILISLVAIGTFCRFYLMSWLG----ERVSADIRKAVFSQIVHLHPSYFEDNRSGELMSRLTTDTTLLQSIVGSSFSMALRSGLVLIGGLIMLLVTNLKLTLLVVACVPLVLVPI-MMFGKRVRKLSENNQSAIADISTYAGEIIQHIKVVQSYTHEEKEKQAFGGEVEKAFDVAKQSIKQRSFLIAAVIFLNFGAISIMLWVGGMDVLEGRMTGGELGAFVFYAIMVAMSVATIAEVYGELQRAAGAASRLLELLKIKSAIQSVADPAAMHQSEDIAFNNVDFYYPSRPDAALRAINLRIRQGQIVALVGPSGAGKTTLFELLQRFYDPQVGDIQCNGEDIKALSLTDLRQSMGMVPQQPVLFSSDVWHNIRYGNPNASDEQVIEAAKRAHAHEFIEPEGYNSFLGEQGVRLSGGQKQRIAIARAILKDPELLLLDEATSALDAQSEFHVQAALNELMHTRTTLIIAHRLATVTHADMIVVMDQGQIVATGTHHSLLEESPLYQRLCE.. 582
135 0.000e+00gi|947224545|ref|WP_055984346.1| ABC transporter [Sphingomonas sp. Leaf412]  clstr ali  28  16...LSIVWKHVVRYPGRIAIACAALAVTSGATIAIPYSFKRVIDRGFTGGANEAAVFHYMLMIVAV--LAIGTAVRFYFVAWLG----ERVVADIREDVQRHLLTLAPRFYEENRPSEIASRLTADTAQIELVVGSCVSIALRNFFTAVGGLIYLFAISPKLAGMLLVGIPLIILPI-ALLGRRIRTLSRTSQDRVADVGSMVTETLGAMKIVQAFGQERREADRFAGAVEATMAAAQKRVLLRAVMTAIVIGLVFGSITLVLWEGAEDVASGRLSGGAIAAFVLTGGIVAGAFGALTEVYGDLLRGAGAAGRIAELMAERPEIAAPPAPRALPHEGRIAFDHVAFRYPTRPEAALQDFSLSVAPGETLAVVGPSGAGKSTLFQLLQRFYDPSTGTVSVDGVDLREADPAAVRARIAMVPQDNVIFGTSARDNLRYGAWDADDAAIWRAAEAAHAGEFLRPDGLDTYLGEGGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQDALERLMQNRTTIVIAHRLATVRAADRIVVMDAGRIVEEGTHATLMTRGGLYQRLA... 583
136 0.000e+00gi|746232433|ref|WP_039281048.1| ABC transporter [Novosphingobium malaysiense]  clstr ali  27  30..PLRLVWGQLFNYPTRALVALCALIVTATSTLAIPWGFRRIVDRGFAEGADPSAIGKWFLLIAIVCVLALGTAVRFYTVSWLG----ERIVADIRLRVQRHLLTLSPSFFETNSPKEISSRMTADTAIIEQIVGTSVSVALRNAIMAVGGTVYLFILAPWLT---AGLLGTIVIVLPILFSRRLRSVSRSSQDRIADIGAMTTEVLGALRVVQAFNQEAREYERFSGGVERTFATAKRRITIRAIMTAVIMVLIFGSITLLMWRGAVGVAEGTITGGTIAAFVITGGLVAGAFSSLSEVYGDLVRGAGAASRLAELLDERPMISSPARPQALPEPGKLAFERVTFRYPSRPDAALHEFSLTVDPGETVAIVGPSGAGKSTLFQLAERFYDPQNGVIKVDGVPLPSADPEAIRKRIALVPQEGVLFAASARDNLRYGNWSADDEAIWKAARAANAEQFLRPEGLDTFLGEDGARLSGGQRQRIAIARALLRDAPILLLDEATSALDAESERLVQNALEHLMAHRTTLVIAHRLATVRKADRIVVMENGRIVEDGNHDSLTAAGGLYARLA... 598
137 0.000e+00gi|550978608|ref|WP_022726727.1| ABC transporter ATP-binding protein [Fodinicurvata sediminis]  clstr ali  26  27...LGYLWRFVRPYRLQVAGAMIALTVAAATLLTFGFGIRQLVDRGFTAGDAALLDQALLVLAIAIVILAVS-SFARYF--LVS-WIGERVIADIRKAVFNHVVSLSPAYFETTRTGEILSRLTTDTTLLQTVVGTSVSIALRNFLLLTGGLVLLMVTSPRLTGLVLXXXXXXXXXX-XXYGRRVRKLSRESQDRVADVGAYVDETLLGIRTVQAFNHEDLDRARFAQRSEQAFQTAVRRIRARAWLTALVILLVFGAVAAILWIGGQDVLAGRMSGGELAAFVFYAVVVAGSVGAIGEVIGDLQRAAGATERLVDLLATQPDISAPENPEELPDPGSLAFEHVSFHYPARPDAALNDFTLAFNRGERVALVGPSGAGKTTVFQLLLRFYDPEEGRILIDGVDLGKADPEAVRQRIGFVSQDPVIFSENGWENIRYGRPDASDEEVLEAARAAACLDFLQPEGLDTFLGERGVRLSGGQRQRLAIARAILRNPAILLLDEATSALDAESERMVQDALEHVMKDRTTLVIAHRLATVQKADRIVVMDKGRIVDSGPHSKLIQREGLYARLA... 594
138 0.000e+00gi|589085605|gb|AHK42361.1| putative ABC transporter, ATP-binding protein, ATPase [Ensifer adhaerens OV14]  clstr ali  23  15.RPLATLLPYLKRYRHLVIGAGISLVIAAVTTLTLPLAVRRMVDNGFSNSDSG-FINTYFSMLMMLAIILALASAARYYFVIT---LGERIVADLRRNVFQHVTRLSASFFDVNQSGEIVSRLTADTTQLKSAVGATASVALRNLILCLGAIGMMVYTSPKLSSLVLA--AIPVIVFPLVFGRSVRRRSREAQDTLAMASAYAGEAIAASRTVQAFNSEDIANNRFGNAVEDAFGAARAAIKARSVLTAFAITMVFGSVVAVLWFGARDVLAGNLSAGTLSQFLLYSVFAAGSLGSLSEVWGELSQAAGAAERLNELLTEVPEIEAPANPVAMPAPGAISFDEVYFAYPARPDKSLNGLSFAIKPGETVAIVGPSGAGKSTVFSMLLRFYDPAKGAITVDGVDIRTVDPKDLRDRLAIVPQDVTIFASSVHDNIAFGLPGXXXXXXXXXXXXXXXDEFIMEKGYDTLVGERGITLSGGQRQRIAIARAILRNAPILLLDEATSALDAESETLVQKALEGLLHERTTVVIAHRLATVLKADRILVMEHGRIVEEGTHASLIRQDGLYAKLAR.. 584
139 0.000e+00gi|922778931|ref|WP_053376639.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. FJAT-27812]  clstr ali  30  1MNELVILFQAMIRERKDIILSILGGFVAGIAGVILFSASGYLISQTVFAPP----LYTLIVLTSLVKLLGLLRAVSRYGERLYSHRATFSMLSRLRSSFFTKLIPLTPGILNKNRSGDLLARIVGDVESLQHYFLRVAYPPIIVVMVFLTTMLATASFSFWMACLMLLGMLGTVLVVPGIVLLGYRKINGHVRKQRALLSTEVTEVLYGFRDLKVYGQLAQREQQLRQASATLAAEQQRAAGQLLRGQSMHAFVTYLISWGVLALGAYLISDGTLAGVYLAMLVMTSLTVFEEAAAMATLPAYKQDSEHAAKRLTEVLTPAMQPVHPSRTLNTDHAVSIELSGVSFQYEGEWRPALKNFSLQIPPGSKTAIVGPSGSGKSTLIELLLKLRTPTDGDLRLSGISVQELEESSIWKTANVVLQQSHFFRGTIRDNLLMDGENHSDGDLLDILAKVQLPTI----SLTDPVYEKGENLSDGEKQRLALARAMLRKGKLWLLDEPTSSLDYVTEQRVLTHLYEQASEDTLLLICHRLNGLEGMDRIVVMEQGRVIETGSYSELMEQNGYFYKMKQ.. 564
140 0.000e+00gi|739677248|ref|WP_037532147.1| ABC transporter [Sphingomonas sp. RIT328]  clstr ali  29  14..DLRLVWDRVLCYPRQLTVALLALATTSAATIGIPYGFKRVIDRGFAPGGSVAASFHYLLMIVAV--LAVATAIRFYCVSWLG----ERVVADIRTRVHAHLLALTPRFFEENRPSEIASRLTADTVLIEGVVGSTVSIALRNTFTGVGGMIYLFALSPKLAGMLLLGIPLIILPVTIL-GRRIRNLSRASQDRVADVSALATEMLGAMKIVQAFGQEPREAQRFAGAVDATFAAAKRRIGLRAVMTAIMIFLIFGSITLVLWEGATDVAAGRISGGAIAAFVLTGGIVAGAFGALTEVYGDLLRGAGAAGRLAELLREQPEITRPAAPIPLPVPGALTFDHVRFHYPTRPDAALDDVTLAIRAGETVAVVGPSGAGKSTLFQLAERFYDPAEGRILLDGVDLREADPAAIRAQIAIVPQDNVIFGASARDNLRYGRWEAGDDELWXXXXXXXXXDFLRPEGLDTNLGEGGARLSGGQRQRITIARALLRDAPILLLDEATSALDAESERLVQQALQRLMEHRTTLVIAHRLATVRAAQRIVVMDAGRIVEEGNHASLITRGGLYARLA... 581
141 0.000e+00gi|519021649|ref|WP_020177524.1| hypothetical protein [Methylopila sp. M107]  clstr ali  26  21LRPLAALRPFALAHKGRVVGALLALTVASAATLAIPVAIRRLIDFGFSHPDMVNQYFAAMLAVVSVLALA---SAARY---WFVTTLGERVVADLRTAVFRHLTELTPAFYDGQRSGELVSRLTADTTQIKSAFGATASQALRNLFLFLGAAVMMAVTSPKLSA--CVLLAIPVIVLPLAFGRSVRRRSRAAQDTLAEASGLAGEALGAMRTVQSYNAEGLVAGRFGAAVERAYRAAESSITARAILTAIAIFLIFASVVGVLWYGASAVLAGAMSAGQLGQFVLYAVFAAAAIGELSNVWGEISQAAGSAERLDELLKIEPSVKSPAQPRPLPSPGALAFENVGFAYPGVERAAVERLSFVASPGETVAIVGPSGAGKSTLFQLALRFFDPASGRVTLDGVDLREAALGDVRARIALVPQDPVIFAATAADNIRFGRDGASDGEVTAAAKLAGADRFILPQGYDTVLGERGVTLSGGQRQRIALARALLKDAPALLLDEATSALDAESETLVQEALAATASGRTTLVIAHRLATVLAADRILVMDQGRIVEQGSHAELVARRGLYARLAE.. 590
142 0.000e+00gi|640411789|ref|WP_024895727.1| ABC transporter [Ochrobactrum rhizosphaerae]  clstr ali  24  59LKPLKRMIPFLSRYKILVVGALFSLVLAAVTTLAVPVAIRRMIDHGFT-GANAIFVNNYFGMLVALALILAVASGLRYFFVI---SLGERVVADLRNAVFSHVTSLSPEFFDRSQSGEIVSRLSVDTTQIKSVVGATASVALRNLILGIGALIMMVITSPKLSALVIG--AIPLIVIPLIFGRSVRRRSRMTQDMLAHANAYASEQIGAMRTLQAFTNENMVVGRFAGAVEKAYQAARSSIKARAILTGFAIFLIFSSVVAVLWFGSRDVLSGTMTAGTLGQFVLYAVFAASAFGALSEVGGELAQAAGATERLAEILDENPDIAAPLKPVALPEPGEISFDKVHFSYPTRPDPSLNGVSFTVKPGETVAIVGPSGAGKSTIFSLVMRYYDPQAGSVLMDGVALPEADPVAVRARIAVVPQDVAIFATSIRENIGFGRPGASDADIEAAAKAALAHDFILDKGYDTEVGERGVTLSGGQRQRIAIARAILRAAPILLLDEATSALDAESEMLVQKALDSLMDNRTTLVVAHRLATVLKADRILVLDKGQIVEEGTHQTLVAQGGIYARLAK.. 629
143 0.000e+00gi|497278316|ref|WP_009592533.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. HGF5]  clstr ali  30  1MNELTILTKAMIEERKDIAMAIIGGFIAGIAGVCLFSLSGYLISQAVFAPP----LYTLIVLTSLVKILGLLRAGSRYAERLYSHRATFSLLSRLRTSFFAKLVPLTPGILGKKRSGELLARIVGDVESLQHYFLRVAYPPIIVVMVFLATVLFTSAFSIWIACLFVAGMLATAFVVPALVLLGQRRIHGRVRRQRAAFSTEVTELLYGFRDLKVYGQLKQREKLLQHASAVLSAEQQASAVHLLRGQSLHTFVTYLISWGVLILGAYLIMDGSLAGVFLAMLVMASLTVFEEAAPMATLPAYKQDSEHAAKRLAEIVHAADVMSPPSGFLSGNEAVSVELRRVSFQYEDEWRPALQNVSLHFPAGSKTAIVGPSGSGKTTIVELLLKLRTPTEGEIRLHDVSIQELDEASIWQASNVVLQHSHFFRGTIRDNLLQDAEHHDDHELSAILDKVQLPN----QSLDAAVYEKGENLSDGEKQRLALARAMLRKGRLWLLDEPTSSLDYITEQRVFRQLLAQAQDDTLILICHRLTGLEEMDRIVVMDQGRIMEAGSYSELMEQKGYFYEMKQ.. 564
144 0.000e+00gi|495365092|ref|WP_008089809.1| amino acid ABC transporter ATP-binding protein [Streptococcus ictaluri]  clstr ali  29  9LKEDKWVKPYLKQYKFSLALALFLGFATFFAAAALMFNSGFLISKSATRPYNILLVY---IPIVLTRAFGIARPVFRYMERLTSHNWVLRMTSKLRVRLYKSVEQDAIFLKRNFRLGDVMGLLSEDINHLQNLYLRTIFPTFIAWLLYVFLVVALGFFSIWFSLFMAFYLLILLLVFPLWSVLVNGARQKKEKLLKEALYTDLTDNVMGIADWIFSQRSQEYVQLHEASQTQLAATQAAMRRFNHLRNLLFELLYGGLVLVTLFWTSSRFGGGSQEANWIAAFVLSLFPLVDAFAGLSAAAQESNSYADSIERLNALP--EVNVSEKVVPVVTP-PFDIAIEDLTFRYQLDSKKVLDHLSLTIKEGQKLAILGRSGSGKSTLAHLLRGDLLPCQGPIRLAGIPVQEL-GDKVADYMGVIQQSP---NTSLGNNLRLGNEAASDEALWEVLERVGLKAMVEPNGLETMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTVGLDPITEQHLLTTFMEVLKDKTLIWITHHLKGIEYADQVIFIEDGKLEMSGSPEDLYYNNSRYRQLK... 571
145 0.000e+00gi|496114461|ref|WP_008838968.1| ABC transporter [Mesorhizobium alhagi]  clstr ali  25  16LQPLRRLFPYIIRYRKMXXXXXXXXXXXXXXTLTLPLAVGRMIDRGFGTADSGLVANYFAILGALVAVLAVA-SACRYYFVVT---LGERVVADIRRDVFAHVTELSPSFFDTAQSGEIVSRLAADTTQVKSAVGATASVALRNIILVFGAVAMMVVTSPKLSALVIV--AIPMILLPLVFGRSVRRKSRAAQDMLADATAYASEQIASVRTLQAFTNEGLVTTHFSQAVEAAFKAARSSVFARSVLTFFAIFTIFSSVVAVLWFGSRGVLAGTISPGTLGQFLLYSVFAAGALGALSEVWGELSQAAGAAERLAEILAEKPAIEAPPNPTAMPTPGLVEFRDVSFSYSANPEPTLQRLSFSVERGETVAIVGSSGAGKSTLFSLLMRFYDPQSGSIMVDGVDIREVDPKELRSRLALVPQDVTIFAATARENIAFGRPEASGAEIEQAASTAVADEFIADKGIETQVGEHGVMLSGGQRQRIAIARAILRDAPIMLLDEATSALDAESEMLVQRAVERSMRGRTTIVIAHRLATVLKADRILVMHEGEIVEEGTHHSLVAEGGVYARVAK.. 586
146 0.000e+00gi|501059660|ref|WP_012111014.1| ABC transporter [Parvibaculum lavamentivorans]  clstr ali  25  26.RPILRLMPFLVHYRGMLTLALVSLVLATLATLAIPMAGRRLIDNGFNRESAAFVDQYFIALVLVALVLGVASAARFFFVSWIG----ERVVADIRRAVYEHVLQLSPAFFEVTRTGEVLSRLTADTTLIKTVVGSSASIALRNIFLFFGAGAMMAATSPYLSSLVL--LAIPAILLPLVFGRWVRRLSRSAQDRLADTSAFGTESLNAIQIVQAFTHEPIDNERFGSTVESAFDTARSRILARAILTALIFFFGLSSVVGVLWVGANAVLAETMTGGELLEFILYAVFAASALAALSEIWGDIQMAAGATERLMELLDVEPEIXXXXXXXXXXXRGEIAFDNVTFAYPTRPHSALHGFSLAVAPGETVALVGPSGAGKSTVFQLLLRFYDPQSGHVRLDGVDIRDAEPRDVRGRLAVVPQETVVFGTTVVENIRYGRPEASEDEVRAAARAARIDDFIMPDGYQTQVGERGVTLSGGQRQRIAIARAILRNAPVLLLDEATSALDAESETLVQQALEGLMADRTTLVIAHRLATVLKADRIVVMEEGRVVASGTHDELVRQGGLYARLAR.. 594
147 0.000e+00gi|930054121|ref|WP_054157150.1| ABC transporter [Rhizobium sp. AAP43]  clstr ali  24  15LKPLASLLPYLKRYRGLVAGAVIFLGLAAATTLALPIAIRRMLDHGFSGADTGFVDKYFAMMIVMALVLAVA-SALRYYFVIT---IGERVVADLRGDVFAQVTRLSPSFFDVNQSGEIVSRLTADTTQLKSAVGATASLALRNSILCLGAIAMMIATSPKLSVMVLA--AIPVIVFPLVFGRSVRRRSRAAQDTLAEASTFAGEMIGAARTLQAFNGEQTARNRYMSAVESAYEAARAAIKSRSLLTGVAITLVFGSVVGVLWYGAHSVLAGTMTAGTLGQFLLYSLIAAGSLGTLSEVWGELSQAAGAAERLTELLAEHPAISAPANPVALPKPGAVNFEAVQFAYPSSPKSALKGLTFSVAPGETVAIVGPSGAGKSTIFSLILRFYDPASGTIRLDGIDLRDADPEDVRARIAIVPQDTTIFASTIHDNIAFGSPNASRAMVXXXXXXXXXSEFILEHGFDTMVGERGITLSGGQRQRIAIARAILRDAPLLLLDEATSALDAESETLVQKALEILMRDRTTVVIAHRLATVLKADRILVLDQGVIVEEGTHQSLIRDGGLYAKLAR.. 585
148 0.000e+00gi|497815715|ref|WP_010129871.1| thiol reductant ABC exporter subunit CydC [Haemophilus sputorum]  clstr ali  50  1MKSLIPFLSLYRTHWGRLLLGVILAITSLSASIGLLSLSGWFLAASFLAGS--ALVFNFFYPSSGVRGLAIGRTVSRYFERLVTHDATFRVLANLRVTIFKKLIPLSPSGLKRYRNSELLNRLVADVDTLDTLYLNLVTPFVSALMVIAFIAIGLSFVSGLLAVIICGTLLALLAIFPTVFYHLGRKLGQNSVQSRAQYRAQFIEWIQLHAEFLLFGLVPEMTSKLQKTEEQWLEQQSKESHLTGLSNALLVFSNGILLCVVIYLISSAIHAPTYPQALIALVIFCVMASTEILMPIGVAFLHLGQVIAAAERLNEITEQPAQVSFNGSATVVLNQPLIEFDSVSFCYPMQSEMATKSISLSIKAGEKIAIVGKTGSGKSTLFQLLNRNYAPTSGRILLNHCEIADYPEAVLRQHLVTLSQRVHIFNASLKQNLLMGNPNASDAQLLEVLETVGLA-YLSEEGLSLWLGEGGRPLSGGEQRRLGLARVLLSQADVILLDEPTEGLDRETEQLILRLILSHCANKTLLMITHRLKGLSEFDRIYQIDNGQLV...................... 553
149 0.000e+00gi|540738670|dbj|GAD48727.1| putative ABC transporter permease/ATP-binding protein [Novosphingobium tardaugens NBRC 16725]  clstr ali  29  46..PLKMVWQAALGYPGKLALAALALCITAAATLAIPSGFRLIIDRGFGSGGDAQDVGRWFYLLVIVVVLAIGTALRFYFVSWLG----ERVVADIRLKVQANLLRQAPGFFEENSPSEIASRMTADTTLIEQVVGTTVSVALRNLIIAIGGTAYLFVLLPRLAA--GLLILIPLVVVPLLFGRRLRSVSRTSQDRVADIGATISETLGAMKIVQAFNQEARESARFAGAVEQTFATARRRILIRAIMTAIIIVMVFGAITLLMWRGAIGVAEGTITGGTIAAFVITGGLVAGAFGALTEVYGDLLRGAGAASRLSELLHTKPEITAPARPQELPEPPRLAFQNVSFRYPTRETAALRDFSLVVEPGETVAIVGPSGAGKSTIFQLAERFYDPQSGTVRLDGVPLVSADPAEIRRRIAYVPQEGVLFAANARDNLRYGNWAASDEDIWEAAHAANAEAFLKPQGLDTFLGEGGARLSGGQRQRIAIARALLRDAPILLLDEATSALDAESERLVQQALERLMRDRTTLVIAHRLATVRAADRIVVMDGGQIVEQGRHGELIAAGGLYARLA... 614
150 0.000e+00gi|736605525|ref|WP_034614148.1| thiol reductant ABC exporter subunit CydC [Chelonobacter oris]  clstr ali  48  1MRTILPFLAMFKYNAFRLLFGVVLMICGLAASVGLLTLSGWFLAAASLAGAN--MLFNFFYPSAGVRGLAIGRTAFRYFERVVTHDATFRVIARLRMMVFGKLIPLSPAVLARYRNSDLLNRLVADVDTLDSLYLRLLAPFISAGMVILFLFLGLSLIDRTLATMLALTLFGLMILIPLVFYHLGKKFGERLTLQRADYRVRFIDWMQNQAELLLFDVARPQRDKLEQSERQWQQLQAKEANXXXXXXXXXXXXNGVILLAMLWFAGTTHFADQLRLANIALFTFAALASFEILMPLGAAFLRLGQVISSAQRVSEIIEQPPLVTFPEQPPSIAEQPLLAFDNVSFRYPTTSSAVLHHFCWQLAPGEKVALLGKTGSGKSSLLQLILRNYDPQQGEVRLGGHHLKAYSEVFLRSQIGFLSQRIYVFSATLRDNLLLANDKATDPQLCEVLRQVGLSHLLQQDGLALWLGDGGRPLSGGEQRRLGIARILLNESPLILLDEPTEGLDRETERDILDLILQHCRDKTLIMVTHRLTALERFDRICVMDAGELQQQGHYSELVKNQGLFYRFLNRL 583
151 0.000e+00gi|494467275|ref|WP_007256775.1| ABC transporter [Oceanicola granulosus]  clstr ali  26  22...LRELWPFVAPYKLMLAGALGALVLTAMVSLVLPLAVRRVVDN--FNSANADIVDQYFXXXXXXXXXXXVGTALRYY--LVT-RLGERVVADIRKAVFDRMIGMSPAFYERVMTGEIISRITTDTTLILSVIGSSVSVALRNVLILFGGILLMLATSVKMALMVL--WPIPVIVLPILLGRRVRALSKENQDWIATSSADASERLLSAQTVQAFTNERASRGRFGEVTERSFVAARRRIGTRALLTAIVIFIVFSAVVGFLWMGAHDVRQGELTAGELIQFMIYAVMVAGAVGALTEIWSELQRAAGATQRLAELLEAEDSVPDPAAPAEVPAQGRIDFEAVSFAYPARPGAALDGVSLAVAPGETVALVGPSGAGKTTIIQLLLRFYDPQAGAVKIDGIDLRDVRKADFRRHVALVPQDPVIFADSARENIRFGRPDATDXXXXXXXXXXXXHDFLSPEGYDSQLGERGVMLSGGQKQRVAIARAILRDAPILLLDEATSALDAESERAVQAAVDELAESRTTIVVAHRLATVKKADRILVFDEGRIVAQGTHDELVAGGGLYARLAR.. 588
152 0.000e+00gi|297182105|gb|ADI18278.1| ABC-type multidrug transport system, ATPase and permease components [uncultured Chromatiales bacterium HF0200_41F04]  clstr ali  24  16LQPLRRLAPFLNPYWVTIIIAFATLIIAAGATLGMPIALRHLIDAGFSTDQARSIDRYFIVLFGLAIVLAVFAATRFYLVSWIG----ERIVADLRSAVFQHVLRMTPTFFEVTRAGEILSRLTADTTLIQTVVGSSLSVALRSFVTLIGGLIMLTVTSPKLTGMI--ILLVPVIVFPIMFGRRIRNLSRDTQDRIADTSALAAEVLNAIQVVQAFTLEKLHSDRYDAAIANSFKAALRRVRTRAFITVYAILVIFCGIVVVLWVGAQNVVTGHISGGELGQFLFYAVIVGSSTAGLTEIWGSLLQAAGAMERIAELLDTKPRQT-PISPTPLPDIGTVVFEHVTFNYPSRPEPALKDFCLNVRPGETIALVGPSGAGKSTVFQLLLDFYQPSSGLIRVDGIDIRHADPAEVRNRVGIVPQETVLFADNVMENIRYGKSGATDDEVVAASQSSGADEFIEPHGYGAFIGERGARLSGGQKQRIAIARAILRQPSILLLDEATSALDAASEKFVQEALHKLMQNCTTIIIAHRLSTILNVDRIVVMEQGEIVTIGSHAELLSRGGLYARLAK.. 585
153 0.000e+00gi|944174013|ref|WP_055662894.1| ABC transporter [Jannaschia seosinensis]  clstr ali  25  19...LARLAPFFRPHLGMVVAALGALVLTACVSLVLPLAVRRVVD-GFESGEAQLL-DSYFAAALGIVGLLAVGTGLRYY--LVT-RLGERVVADIRKAVFSRMIRMSPDFYDGILTGEVLSRITTDTTLLLSVIGSSVSVALRNVLIFAGGLVLMLWTAPKLSGXXXXXXXXXXXXX-XXXGRRLRSLSRENQNWIAESSGRASEWLLSAQTVQAYTFEGEASRRFDDVTERSFRSARTRIGVRAVMTMIVISLIFAGIVGVLWIGARDVRAEGMTVGELVQFLIYAIMVAGAVAALSEIWGELQRAAGATERLVELLEVDDAVRDPERAGTAPVGEGVALEGVTFRYPTRPDPTLDDVTLRVEPGETVALVGPSGAGKSTIIQLLQRFYDPDTGRVTLGGVDLRDMTRAEFRRHMALVPQDPVIFAASARDNIRFGNPDATDEQVEXXXXXXXXHDFLTPDGYDTYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQDAVARLAEGRTTIIVAHRLATVKQADRILVMEGGRIVAQGTHDELVGQGGLYARLAR.. 584
154 0.000e+00gi|1016457952|gb|KZD03362.1| ABC transporter [Oceanibaculum pacificum]  clstr ali  25  25..PLRHLLRFLAPYKKQLAGAAVALVIAASTVLGLGMGLRHLVDGAFGSGDPALLDRAVVVLLGVVFLLAIASYARFYLVSWIG----ERVVADIRKAVFDHVLTLSPGFFEITRTGDVLSRLTTDTTLIQVVVGSSASIALRNTLLFIGGTAMLIVTSPKLTGLVFLVVPLVVAPI-IIFGRRVRRLSRDSQDRLADVGVYIEESLNAIRTVQAFTHEPMDRGRFSDRVEDAFATSVRRIAARAMLTATVIVLVFSAVSAILWLGGRSVLDGTMSGGDLSAFVFYAVVVAGAVGAISEVVGDLQRASGATERLMELLSVASPVVAPALPVALPEPGRVEFDRVRFRYPARPRPALEDFSLTVQPGEKIAIVGPSGAGKTTVFQLLLRFYDPESGAVRLDGVDVRHAAPAALRGRIGLVPQEPVIFSADAMENIRYGRPDASDAEVRXXXXXXXXTDFLDPDGFATFLGEKGVRLSGGQRQRIAIARAILRDPALLLLDEATSALDAESERAVQVALDRLMVGRTTLVIAHRLATVLKADRIVVLDQGRIVATGTHAELTRQGGLYARLA... 592
155 0.000e+00gi|763075844|ref|WP_043957315.1| ABC transporter ATP-binding protein [Lysobacter sp. A03]  clstr ali  26  24...LKALWPFVSRHRGLFAGWLIALACSSAATLSLPVAFKTMIDRGFAQGGGSAIDQAFMXXXXXXXXXXXXXXXRFFFVSLLG----ERVVADLRGRLYSHLIGLDAGFHDRSRSGELVSRLTADAELLRGVIATSMSVALRSVVTFLGSIVMLFVSSPQLAAYALVGIPLAVLPI-VIGGRRLKKISRDSQDRVADANTLANETLGAVSTVQAHAREPYELGRFSDALKVAVATARRRIQAQAWVTAIAIVLIFGAITLVLWSGAHDVAEGRMSAGTLGQFVLYAMIGGGSVGSLAEVWNEVQRAAGGMGRIGELLAEKSSVTAPEHPEALPAPGDIVLEGVTFHYPMRPHPALEDFSLHVHPGETVALVGPSGAGKSTVLSMLLRFHDPAHGSITVDGIDIRRFDPADLRGAIALVPQQPSIFATTARDNIRYGRLEASDADVDAAVEAAHASDFISPEGLDTELGERGARLSGGQQQRIAIARALLKDAPILLLDEATSALDAQSERAVQQALDTLMEGRTTLVIAHRLATVLKADRIVVMDRGRIVAEGTHDQLLQEDGLYADLAK.. 591
156 0.000e+00gi|700657509|gb|KGO99706.1| ABC transporter [Lysobacter defluvii IMMIB APB-9 = DSM 18482]  clstr ali  27  32...LKTLWPFVRRHRGLFTAWLVALAASSTATLTLPHAFRIMIDQGFAQGGGGAIDRAFMXXXXXXXXXXXXXXXRFFFVSLLG----ERVVADLRGQLYAHLVSLDAGFFDRTRSGELVSRLTADAELLRGVIATSMSVALRSAVTFLGGIAMLFVTAPHLAAYTLVGIPLAVVPI-VIGGRRLQKISRSAQDRVADANALANETLGAVRTVQAHAREPYELGRFGEALKVAVATARRRIQAQAWVTAIAIVLVFGAITLVLWSGAHDVADGRMSAGTLAQFVLYALIAGGSVGALAEVWNELQRAAGGMGRISELLVEQPAIREPAHPVALPRPGEITFDGVTFHYPMRPDPALDGFDLRVRPGETVALVGPSGAGKSTVFSLLLRFHDPESGIVSVDGHDIRSLPLAGLRGAIGLVPQQPVIFAASARDNIRYGRLEASDAELQAAVAAAHSTDFLEPEGLDTELGERGARLSGGQQQRIAIARALLKDAPILLLDEATSALDAQSERAVQQALETLMEGRTTLVVAHRLATVLKADRIVVMDHGRIVAEGTHEELLAQGGLYAELAR.. 599
157 0.000e+00gi|495703563|ref|WP_008428142.1| thiol reductant ABC exporter subunit CydC [Planococcus donghaensis]  clstr ali  30  1MIELKGVLKLTLLEKKDVLIAIFFGFLAGVASVALMGSSGYLISKAALTSQMTTLV----VMAACLKLFGFASALSRYAERLYSHRATFTMLSHLRVSFFERLSPLAPGIFSKYRSGDLLSRIVGDVESLQNFLLRVFYPPVVLGIVFLSAVFFTSFFSLGIAIVIFIGMLLTVVVVPALFSSRKRRMDGQVRAQRGNLAIESTEFLYGFRDLKIHQQLNAKEQQLKNDAAQYNEGQRQEGLEENLAQSMNAFVALLVSFFVLGVGAYFVAAGELNGLYLAMLVMISIAAFENVAPMAAFPTYFEESRKASVRLEEIVAEPAALQ--GTEGMPNGPLDIRLDKASFQYPGDSSLAVNCVSLHLKPGTKTAIVGPSGSGKSTLMQLLLTVFPLNQGQLSIGGKSVEALKQEEIWQQMNIVLQENHFFYGTIRSNLLMANSEVTEEQMIRVLAQVQLNNF----SLNMTVEEKGQNLSGGQKQRLAIARAMLRGKPLWLLDEPVSSVDSLTAQVIYQQMFQQHKDDLFVIISHDLTGLENMDQIVVMEKGCIVESGSYDELMEKKAYFYQLKE.. 561
158 0.000e+00gi|573018419|gb|AHF73956.1| cysteine/glutathione ABC transporter membrane/ATP-binding component [Candidatus Sodalis pierantonius str. SOPE]  clstr ali  64  1MRALLPYLTLYRRHGGQLALGVALAIVTLLASIGLLTLSGWFLXXXXXXXXXXLYSFNYMLPAAGVRGAAITRTAGRWAERVVSHDATFRVLQHLRLYTFSRILPLSPGAIARFRQAELLNRLVADVDTLDHLYLRVISPLAGALVVTLAVTAGLCLLDPRSGLALGTVMLVILALFPPLFYRAGKPVGEALTALRAEYRLRLNAWLSGNAELMLYGAAERYRKQLDATEQRWQGHQRRQSGLGAGAQSXXXXXXXXXXXXXXXXAAGGVGGDGSSDPLIALFAFATLAAFEALGPVAGAFQHLGQVMASAARLNVVINQSPEVVFPTAGPAPAASVALSASRVRFRYPGQAAPTIDELSLTVAAGEHIALLGHTGSGKSTLLQLLTRAWDPEEGDIALNGVPLREWSESALREMTAVVPQRVHIFSATLRDNLRLAAQDVDDEQLCAVLRQVGLEKLLVGEGFNAWLGEGGRALSGGEQRRMGIARALLHAAPLWLLDEPTEGLDAVTEQQILQLLTTLGQGRTVIIVTHRLRGLERLDRICIMDRGNLIEQGSHQALMAQRGLYYHYHRPL 573
159 0.000e+00gi|495746942|ref|WP_008471521.1| amino acid ABC transporter ATP-binding protein [Lactobacillus hominis]  clstr ali  27  10....RWIKPYLAKYKWVLLLAIFLGIVMFFCGGALMFYAGYTIDKAATRPENIFMIY---VPIVLMRAVGIGRPLFRYLERLVSHNWVLRVTSDLRRRLYDIVEKNSSAVGSNYQTGSLLSLLTEDIGHLQNLYLRTIFPAIVGYLVGFFAVILLGLFSWPLAGXXXXXXXXXXXXVPLFSLLKQAAIRSKEKAEKASLYTEYTDQVLGAGDWQISGRQKAFHDQTQKTVTTLGKKQKKSGEFDWARDFILEFVFGLMAIALLYFTNKSLTYNQEAANYVGAVVLALFPLSDAFIPVAQGAEEWHTYSDSVKRLNAMHPKKEDL--PTQQTLNPADFELQVDNVRFTYPGEKVPIIKNFSLKLAKGQKAALIGPSGAGKSTILQLVLGDIAPQAGEVKLNDINVRCL-QDERPKLFSVLNQEPFLFNTSIYENLKMANKNATADDMMDALEKVQLADFVKPDKLDTQVAEAGARFSGGQKQRLALARILLQDAPIVLLDEPTVGLDPLTEQKLLNLVFKVLKDKTVIWITHHLQGMKYIDQVLFFKDGVVEMSGNPHELFETNEHFHNLY... 572
160 0.000e+00gi|495872196|ref|WP_008596775.1| ABC transporter [Nitratireductor pacificus]  clstr ali  25  20LKPLRRLVPYVARYRGLAFGAGVFLVMAAIATLTLPLAVRRMIDHGFSESDSV-FIANYFSMLIVIAAVLALASAGRYFFVIT---LGERVVADLRRDVFAHVTRLSPAFFDTVQSGEIVSRLSADATQVKSAVGATASVALRNLIMGLGAVGMMVVTSPRLSLIVVA--AIPVIVLPLVFGRSVRRRSRFAQDTLADATAYASEQIGAVRTLQAFTGENAVTKAFAGAIETAFAAARASILARSFLTFFAIFLTFASVVAVLWFGSRDVLSGAMTPGTLGQFLLYSVLAAGALGALSEVWGELSQAAGAAERMSELLAETPAIVAPARPVALPARGAVTFDAVSFAYPTRPRSALHGLSFTVEPGETVAIVGASGAGKTTVFSLLLRYYDPDTGRILVDGVDARDADPQALRAHMAIVPQDVTIFAATAAENIAFGRPDXXXXXXXXXXXXXXXHDFISEQGYDTEVGERGVTLSGGQRQRVAIARAILRDAPILLLDEATSALDSQSETLVQKALEHLMRDRTTVVIAHRLATVLKADRILVMDDGRIVEEGTHAALVAKGGAYAKLA... 589
161 0.000e+00gi|499202556|ref|WP_010900096.1| thiol reductant ABC exporter subunit CydC [Bacillus halodurans]  clstr ali  32  1MKALMPYVKMMFVEKKDIFLSIFAGFMAGITAVGLFSASGYLISQAALTPPIA----TLMVIVAIVKLLGITSAISRYGERYFSHQATFTLLSNIRLRVYEKLEPVSSKILHHYRSGDLLSRIVGDVDSLQNLLLRVVYPPVVMVSVFLATIAFTSIFSVGTAVLLFIGLLATLLIIPTAFYVGHRAMNHHIRETRGNLSSTFTEYVYGFRELTIHQATDERQEQVLADIRTYEKQKQQSQAIHMWSDATVHFFSLFVSVAVLAYAGLQVVDGNLAGILLAMLLMISLTVFEQVTPMALLPYHLQESAHSAKRLEAITAEPMEQPEHVDYNGQTAP-DLSLQHVTFTFDGEQRPALQDVSFYVKPGSKTAIIGASGSGKSTIAHLILKSFPYSKGSITVNGTELKHIDEKKWWKTINMSLQSNHFFVGTLEENLRTANENASVEEMARALQQVELSHL----QLGDRVDEKGANLSGGEKQRLAIARLLLRHATLWILDEPTSSLDALTEERMLQLLFNQAKDATVLFISHRLTGLEDMDQILVVDQGKIIETGTYEQLMEQNGYFRRMKE.. 563
162 0.000e+00gi|750425352|ref|WP_040707245.1| ABC transporter [Oceanibaculum indicum]  clstr ali  25  18..PLRHLLRFLAPYKGQIAGALTALVIAASTVLGLGMGLRYLVDGAFGAGNPALLDQAVIVLFGVVLVLAVASYVRFYLVSWIG----ERVVADIRKAVFDHVLSLSPGFFETTRTGEVLSRLTSDTTLVQVVVGSSASIALRNTLLFVGGTVMLVITSPVLTGLVFLVVPLVVAPI-LIYGRKVRRLSRDSQDRLADVGAYIEESLNAIRTVQSFTHEGEDRANFAGEVERAFATSVRRIAARAMLTATVIMLVFSAVAAILWLGGRSVIDGTISGGELSAFVFYAVVVAGAVGAISEVIGDLQRAAGATERLMELLAAPSPVAVPSLPVALPEPPRIEFDRVRFHYPARPRAALEEFSLTVQPGEKVALVGPSGAGKTTVFQLLLRFYDPESGTIRLDSVDVRQADPRALRSRLGLVPQEPVIFSANAFENIRYGRPGASDEDVRXXXXXXXXXXFLDPDGFNTFLGEKGVRLSGGQRQRLAIARAILRDPAVLLLDEATSALDSESERLVQSALDRLMAGRTTLIIAHRLATVLKADRIVVLDQGHIAATGSHAELMRQGGLYARLA... 585
163 0.000e+00gi|960423694|ref|WP_058315614.1| MULTISPECIES: ABC transporter [Thalassobius]  clstr ali  25  22..ALRQLAPFIKPYRFLAIFAGMALVLTATISLIMPMAVRRVVDN--FRAADAALLDQYFLSAIAIAGLLAIGTALRYM--LVT-KLGERVVADIRKAVFERVMGMSPAFYEKIMTGEVLSRITTDTTLILSVIGSSISVALRNXXXXXXXXXXXXFTSAKLTGLVLLIVPMVIVPIVVL-GRRLRKLSRENQDWIAESSGNASETLTAVQTVQAFTHEADSRQKFVDITDLSLGAALRRVNTRALMTSIVIFLIFSGVVGVLWIGAHDVRVGDMSPGVLIQFVIYAVMVAGSVAALSEIWGELQRAAGATERLVELLQAEDTVLDPESPVELGDRGEITFENVNFNYPARPDPALQDVSITIRPGETVAFVGPSGAGKTTIIQMIQRFYDPLSGQVRLDGVALNEMERTHFRQNIALVPQDPVIFADTARENIRFGRPDATDGEVEXXXXXXXXHEFIAPEGYDSYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQQAVEGLAETRTTIIVAHRLATVKKADRIIVMDQGRIVAQGRHDELVAEDGLYAKLAR.. 589
164 0.000e+00gi|150836414|gb|ABR70390.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Marinomonas sp. MWYL1]  clstr ali  26  21...IKTFLPFLRPYRRHIVLALVALMVTAGTMLSLGKGVQLLIDQGLASGSEAGLTQALMIFIGLVFLLGIGSFCRFYLVSWIG----ERVVADIRQAVFAHLLTLSPSFFEDNSPSEIQSRITSDTTLLQSVIGSSLSIALRSSLMLIGGVLFLLVMHFKLTLILLTC--VPFVIVPVVFGRRVRRLSRDSQDEVANVGRYLSQALRHIKVVQAFTHEKHDAQRFSATVDRAFNVSVKRIQQRSWLTLMVILLSMSGIGVMLWFGGKDVISGAISAGDLASFLFYSIIVAGAVGAISEVMGELQRAAGAAERIMELLTAKSAVVFPSQRMADIRQGEIKFDNVEFRYPTRPDAALKNLSFSIKQGEMLALVGPSGAGKSTLFELLLRFYDPQQGGIYLAGENIKAYSLDDLRQHFALVPQETVLFDQTVYDNLGYANRNASKESIQYAAEQANAHEFIMDQGYETRLGEDGVRLSGGQRQRVAIARAILKDAPILLLDEATSALDAESENKVQGALEPLMKGRTTLVIAHRLATVLNADRIIVMDQGEIIAQGTHGELLETCALYKRLA... 592
165 0.000e+00gi|742901193|ref|WP_039019977.1| ABC transporter [Halocynthiibacter namhaensis]  clstr ali  26  19.SALQGLSPFVKPYKMQVVLTLIALTATAALSLILPIAVRRVVD-GFTAGDAHLL-DEYFGXXXXXXXXXXXGTGTRYF--LVT-RLGERIVADMRKAVFSRVIGLSPEFFEKTLTGEVLSRITTDTTIIQSVIGSSLSVALRNILMFIGGMILMLFTSAKLTGLVL--LIVPGVLIPIVLGRRLRVLSRENQDWIAASSGSASEALSAVGTVQAYTHEARTIAQFDDVTEKAFGSAAKRIFTRAIMTVIVIFLIFSGVVGVLWVGARDVQDDLMSTGALVQFVIYAILVAGAVGSLSEVWSELQRAAGATERLVELLETQDQVNDPVSPVKSLDRGNIRFDDVTFHYPSRPDAALKDLTLDVKAGETVALVGPSGAGKSTILQLLLRFYDPDQGDVYLDGHALGDMERADFRRHIALVAQDPVIFAGSAMENIRFGRPDASEDDVIXXXXXXXXHDFLQPEGYQSELGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQHAIDDLAKDRTTLIVAHRLATVKKADRIVVFEEGQIVASGTHESLVKEGGLYARLAK.. 587
166 0.000e+00gi|655026871|ref|WP_028475770.1| ABC transporter [Nevskia ramosa]  clstr ali  24  16LSALAGLLPFLAPYRGRLIMATVTLILSSGAMLMVPLAFRDLIDKGFVANAAASHINAHFAALGLLAIFAMATAGRFYFVSWIG----ERVTADLRSAVYRRMLAQSPEFFETTRTGEVLSRLTGDTTLVQTVVGSSVSMGLRSLLQFIGGLVMLGVTSPRL-FVITXXXXXXXXXXXXXIGRGVRRMSRDAQDRLADTSAVAGEILNAIPTVQAFTQEGRESARYDASVDDSFKSAIRRARLRALMTASVIAGVFGAIVFVLWLGAHAVIAGTMSAGQLASFVLYAVLTAGGVGVIAEVWGDVLRAAGATERLIELLHAESRIQPPANPKPLPQQARIEFQNVHFHYPSRPDTALDGLTLDIREGETVALVGPSGAGKTTIFQLLLRYYDVDSGSIRFNGIDLRDLDPAELRAQIGIVPQDAVIFSADASANIRYGNADATDEQVQQAARTARADEFLDPDRYKTFLGERGVRLSGGQRQRLAIARAILKNPPLLLLDEATSALDAESEAFVQRGLEAAMVGRTTLIIAHRLATVQRADRIVVLEAGRIVEIGTPAELLHSGGLYARLA... 589
167 0.000e+00gi|808564925|emb|CEP69128.1| ABC transporter type 1, transmembrane domain [Moorella glycerini]  clstr ali  27  7......LMREAGRVRFHLALTVGLGVGAGL--LAILQASARVVNGVFLEGQDLRGIWHWLMALLGIIFL---RAGLAWGVEVAAHRAAARIKYDLRQRLVGHFLAVGPLPLKDEHTGELVNVLVEGVEDLEAYFARYLPQLALAALVPLMVLGFVF----PLDLFSGLLLLFTAPLIPLFMLLIGRRAETLSQQQLSGLSAHFLDVLQGLTTLKIFGRSKAQAEVLTRLSDRFRSTTLGVLRVAFLSALVLELVATISTALVAVTVGLRLVYARIPFNE-ALFLLLVAPEF--YLPLRLLGSQFHAGLAAARRIFAVLDMAGPCTTPAPAVAQPPGLHIVLAGVHYTYPDRERPALEEVSLELRPGEKVALVGPSGGGKSTIAHLLLRFLEPDRGLITVNGLPLNQIPLEEWRRQVALVPQHPYLFSGTIADNILLGRPDASREEMVAAARLAGAHEFIAPRGYDTPIGERGLRLSGGQARRLAIARAFLKDAPLLILDEVTAGLDPGGDQVIQEALERLMEGRTVLIIAHRLSTVYRADRIVVLASGRVVETGRHEDLMAQQGAYYRL.... 591
168 0.000e+00gi|497703781|ref|WP_010017965.1| amino acid ABC transporter ATP-binding protein [Lactobacillus farciminis]  clstr ali  27  12.....WVKPYIKQYKGLLITALTLGLLTSFCAGALMFTSGYTIDKAATHPVNILLIY---VPILLTRAFGIGRPVFKYVERLKSHNWVLRVTSDLRTRLYKTLESDASFFNEHHKTGDIMGLLSEDISHLQNLYLRTIFPAVIGYLLTIIGSLALGIFNPAFGFFVFLLLFIEVFLVPLFSVSIESARRAYQKEVKSDLYVQLTDNILGVDDWIISGRKDDFRNLTSENIHNLDQSQLKSKAFRRNRDFGLQLIFAALAICFLIFTNLTMTNGQEQANFVSAVVLAIFPLSDAIIPVSQGFEEWPLYKDSIQRLNTI--KPVKSNLPAQIDLAPNDFSLTLNNVSFEYDTDSPILIKNFSQTIHKGEKLALLGPSGIGKTTVLQLILGDLTPTAGQIKINDYDIAQV-QEHRQKLFSVLNQKPFLFNTTLMNNVRLGNEGKSDVEVKQALERVGLKDLVEPDKYNTLVGENGSRFSGGEQERIALARILLQDAPIVLLDEPTVGLDPITENDLLETFFSVLKDKTIIWVTHHLQGVNHVDKVVFMNSEEIEMQGAPKDLYQSNKHFKELYQ.. 574
169 0.000e+00gi|872574649|ref|WP_048532527.1| ABC transporter [Marinovum algicola]  clstr ali  26  20..ALGALWPFLRPYRGLLLASILALVATACISLTLPLAVRRVVDN--FRAEDGALLDLYFXXXXXXXXXXXXXTALRYA--LVT-RLGEQVVTDIRKAVFDRVMGLSPAFYEKIMTGEVVSRITTDTTLILSVIGSSISIALRNVLIFFGGMGLMLLTSPKLTGLVL--LIVPAVVVPILTGRRLRVLSRENQDWIAASSGSASESLSAVQTVQAFTHEVLTRRAFSEVTDKSLDAAKRRITTRSLMTAIVIFLVFTGVVGVLWIGARDVRAGEMSAGSLVQFVIYAVMVAGSVAALSEIFGELQRAAGATERLVELLHAEDAVSDPADPLPLPESGAISFDAVSFTYPQRPDSALDHVTLDIAPGETVALVGPSGAGKTTIIQMLLRFYDPASGRITLDGVDIAAMRRDAFRRAIALVPQDPVIFAASARENIRFGRPEASDXXXXXXXXXXXXHDFISPEGYDSGLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVDALSRDRTTLIVAHRLATVKKADRIVVMDQGRIVAIGPHDQLVAQDGLYARLAR.. 587
170 0.000e+00gi|518446120|ref|WP_019616327.1| ABC transporter [Psychromonas ossibalaenae]  clstr ali  22  16LKPLSALVPFIKPYKGTLTAAVIVLLMASAATSCLPIAARYLIDSGISSGDPDKIDFYFQXXXXXXXXXXXXXASRFYLITWLG----ERIVADIRKKVYSHVIRQDPAFFEVTQTGEVLSRLTTDTTLVQSISGVGISIALRSSVMLIVSLAGIMYTSPSLTLMIL--LLVPAVIGPLWIARKVRKLSRAAQDKIADSSGMANETLNAIETVQAFTLESLQSRRFAEAVEAAFIAGLQRIRGRFVMSLGSMFLLFGAVTLVLWVGTREVLAGDMLPGELAQFVLFTVLLASSGAMLSEMWGEVQRAAGAMERLFELLDAQPFIRAPANPIPLPSQGSIVFSEVDFKYPSRPDLAIDNFNLNITPGETIAFVGPSGAGKTTTFQLLLRFYDPNTGAVFINGVDITKTDPQAVRAVIGIVPQETIVFAASALENIRYGRPDASDDDVKSAAQAAFADEFIEPEGYDTFLGEKGTRLSGGQKQRIAIARAVLKNPPILLLDEATNALDAESERLVQETLQKLMHNRTTIIIAHRLATVLKAKRIVVMHEGRIQAIGSHAELVKKNPLYARLVE.. 586
171 0.000e+00gi|755614304|ref|WP_042533703.1| thiol reductant ABC exporter subunit CydC [Oceanobacillus oncorhynchi]  clstr ali  30  1MKDISLVLKMMLKEKRDILISIFFGFLAGITAVSLFAASGYLISQAAFAPP----IYTLMILVASVKLLGITSAVSRYGERYFSHRGTFTILKNIRLKVYDQIEPLASRLLQKYRSGDILARIVGDVESLQHFFLRVFYPPVVLAAVFTATIFFTMYLSIGVAMTMIGGVIIVLVVFPSIFYLFQKKTAVTMREKRGALSSEFTDYLYGFRELTIFQQAERKKQQLDNNMKQYEEIKAKENRQLAIREAVVIFFSFFIAVIILVQAGFYVSEGNLAGTLLAMLFMIAITVFEDTPSMAVLPAHLEESKASSKRLTEVWEKETQTEVAVHEIETDVPIQFDFKDVSIQYPTEKKPAVRLAAFQIKPGTNIAIVGPSGSGKSTLMQAMLTFAPIQSGQLLVNGEELDKIAPDSLWRQMNVSLQHNHFFYGSIYENLRFANKEAGEEACQEALEKVQLSHF----SLEDQVLEKGTNLSGGEKQRLALARLFLRDASVWLLDEPTSSLDAITEQEIMEEIEKATKYQTVVTIRHRLTGLEKMDQIIVMNHGEVVEQGTYMELMRKDGYFKAMKE.. 564
172 0.000e+00gi|668947710|gb|KFC66500.1| putative ABC transporter, ATP-binding protein, ATPase [Bosea sp. LC85]  clstr ali  26  18...LSSFWPYALTQKGRIALAILALIVASGATLVLPLAVRRVIDVGFSGGDQALAHNYFMLLIGVVAVLALASSARFYLVMTIG----ERIVSSLRADVFTHLTRLEPAFFDSSRAGDLVSRLTADTTQIKSAFGSAASIALRNGIMFLGALALMVVTSPQLSAIVIA--AIPLIVLPLVFGRSVRRRARAAQDRLADASAFASEAVGAIRTMQSFGAERQTARAFESASNDAYAASRSATRSRAILSGVAIFLVSASVVCVLWVGAMDVFAGRMTGGRLSQFVLYAVLAASSLGQLSEVYGEISAATGAAGRLGEILATRPAITAPAHPTPMPEPGELAFEGVSFSYPGRTASALHELSFSVRPGERIALVGPSGAGKSTVLQLALRFFDPAEGRILVDGVTGTDAEPEAWRQRFALVPQEPTVFGVSVRDNIAYGRPGASREEVEEAARLAAADGFIRPQGYDTVVGERGVTLSGGQRQRLAIARAVLKDAPILLLDEATSALDSESERAVQDALDRLMQGRTTLVVAHRLATILSADRILVLDEGRVVEEGTHGELKARGGLYARLA... 583
173 0.000e+00gi|504593398|ref|WP_014780500.1| thiol reductant ABC exporter subunit CydC [Thiocystis violascens]  clstr ali  38  1MKDILRLLDLFRPYRGWMLLGTLAAILTLIANVMLMAASGWFL-XXXXXXXXXXXXXNYFTPAAMIRGSAMLRTGGRYAERLINHEATFRLIASLRVWFYSHLEPLAPARLQQYHSGDLLSRIRADIDALDNLYVRVLVPVVVALASTLIFVIFLFLFAPVLALTGLIFLSLAGVALPLWSQSRGQAPGRRITEDESELRTAVIDGVQGMAELTVYGVTERQAQRIDDLSRRLVADQARLSSDHGLTLAAVGLCASLSLWVLLWLAIPLVRDGQLMPPLLAMLALFTLASFEAVAPLPQAFQLLGRTLAAARRLFDIVDTEPAVREPPGLSPQIANFDIAFDRVTFGYPKAAHPAVADIVLRIPEGTRAAVIGATGSGKSTLFNLLLRFWAPDAGAIRIGGQDIADFHGDDLRRHIAVVSQHTHLFDATIRENLLIANPDASQGAIEQACRVAQIHDFIAPEGYDTWVGETGVRMSGGQGRRIAVARALLKDAPILLLDEPTEGLDAATERDLMQALDRLMVGRTVLLITHRPAGLDWVDQVLVLDRGRVVPQATQAALLAVGP......... 573
174 0.000e+00gi|493791434|ref|WP_006739592.1| thiol reductant ABC exporter subunit CydC [Streptococcus urinalis]  clstr ali  28  15.....WVKPFLKQYKATLILALLLGFLTFFCAGALMFNSGFLISKSAALPSNILLVY---VPIVLTRAFGIGRPVFHYLERLTSHNWVLKMTSKLRLKLYETLEKDAIFIKRDYRLGDIMGLLSEDINHIQNLYLRTIFPTFIAWLLYIFIVISVGFVSLPYALLTFCYFLLFLLAFPLWSVLVNGARQKREKMIKNELYTDLTDNVLGISDWIFSQRGQDYVALHETAEEELLKVQSKLRNFNNKRAFLVEFCFGLAVLTIIWASFRFVGHHGGDANWIAAFVLAIFPLADAFSGLSAASQETNTYADSLERLNELPDFK---NQEMTALIPDASLKLQISNLYFQFEKDGKEILKGINLDIQQGEKLAILGRSGSGKSTLATLIRGDLLPTKGQIKLGGIETKDLS-DTISDYIGVIQQAPYLFNSSLLNNIRIGRSDASVEEVWEVLERVGLKKMVQPHGLNTMVDEAGMRFSGGERHRLALARILLKDSPIILLDEPTVGLDPVTEVELLKTFMEVLKDKTLIWITHHLKGVEYADRVIFIENGQLEMSGSPVELSETNPRYRHLK... 575
175 0.000e+00gi|515831945|ref|WP_017262698.1| amino acid ABC transporter ATP-binding protein [Lactobacillus rossiae]  clstr ali  24  13.....WVMPYLRKYRXXXXXXXXXXXXTTFTGSALMFTSGYLISRAAQHPFNIMLIYA---TIVLVRAFGIARPSFKYAERLTSHNWVLRIVSDFRKKLYQSVERDAVAIRQRHQTGDILGLLAEDIAHIENLYLRTVFPLIVGWLLYLFVVIALGTFSWPFAALMALLLGVIVILMPLVSVALNGAREFHQKQTQQRLYTSMTDAVLGVGDWMISGREKDFMDRQTGPLTDMRNLQTADNKFQWWRDLVVQLMIGIIAVVMIYWAGSYFQTSHLALNWIAAFVLAIFPATDAFASIPQGVSEWPVYQDSIKRVNQL-DQNVVAPVVQTHLAAEDFKSLAIDHVDFKYADGQQAVLSDIDWTINCGDKVALLGPSGTGKSTLLKLMLGDEQPTKGAVKLNGITIDKL-QNDRGKLFGVLDQQPYLFNTTIMNNVRLGNLSATDDQVKAAIKAVELDQLVEPNGYNTLVEEAGARFSGGERQRFALARILLQDAPIIILDEPTVSLDPITEHELLNTIFALLRDKTIIWVTHHLEGITHVDSVRFLEHGQFEMIGKPHDLYQTSDRFRSLY... 574
176 0.000e+00gi|950026733|ref|WP_057152024.1| thiol reductant ABC exporter subunit CydC [Lactobacillus similis]  clstr ali  27  13.....WVMPYLRRYKWLLTLVLFLGLMTFLSAGALMFNSGFLISSAARQPFSVIVIY---VPVVLARGFGIARPVFRYAERLTSHNWVLRIVSDFRRRLYQAVERTAVTIKQTHQTGDLLSLLADDIDHIENLYLRTVFPMVIGWLLYLVIVIGVGVFSWPVXXXXXXXXXXIVIVMPLISVAFNGAREFRQKQLQGQFYTQLTDEVLGLTDWVISGRYTDFMAHQRTAIDEIAQLRRRDHYFQWWRGLAVQVIFLAAVVTLLVWSGTAFTTTKTSANWVAAFALALFPVIEPFLEMSQGASEWPVYRQSITRVNQLSESASQSETAAQQTLTAPVTALRVDHVQYTYPGAETPVLKDISLTVKRGEKLALLGPSGTGKSTLLKLLVGDAQPTQGTITLNGVTMSRL-QTQRASLFGVLDQQPYLFDTTVMNNVRLGNLQATDEDVKSAIAAVGLEPLITPQGYDTLVQEAGNRFSGGERQRLSLARILLQDAPIIILDEPTVSLDPITEKHLLDTVFTVLADKTIIWVTHHLAGIKHVDQVRFLEKGQFDMQGTPVELYRTEARFRRLYE.. 576
177 0.000e+00gi|527024013|ref|WP_020876494.1| thiol reductant ABC exporter subunit CydC [Desulfococcus multivorans]  clstr ali  39  6.KELTPFIRRFRSQWGRMALGTLLGLVTVASSVGLLALSGWFISAAAYAGSGSAHLFNFFFPSIGVRIFAFARTLGRYGDRIVSHDATFRILEQLRVWFYGRIEPIGPGPLGGFRSGDLLSRIVSDIDALDNLYLRVIQPSVVALILAAALPLFLLPFDPWIAFVAGSGLVAAGFGIPVLSGRLGADTGSSMTARVARLRTRIVDGIQGAPDMIVFGASARYLNDLREENRKLIDDQRRMSHIRGFSGALMTLISGLTVGIVLWLGSGDVLQQWMDGPRLTLAVMATLAAFEGVVPLPAAYQFLGRTQKAAARLLEIVHTPVAVRFPAASGALPQSFDLTFEAVGFQYAADAPPALDNFSLHIPEGGRVVVLGETGAGKTTLVNLLVRFWDPTKGRILIGGRDIRSYSETDLRRLVSVVPQQPHLFNASIRDNLRIARKDASEVEMKTALAVAKLLDVVEPEGLDTWVGEGGRELSGGQARRLSVARAVLHDAPIWVLDEATEGLDTVTEAEMTASLYRHIRGKTLIVITHRLSLWTLMDIVVMLDKGRIV...................... 584
178 0.000e+00gi|902770794|ref|WP_049641891.1| ABC transporter [Candidatus Rhodobacter lobularis]  clstr ali  26  18..ALRGLLPFMAPYRLMLLAALVALVFTAAISLVLPLAVRRVVD-GFETG-AAALLDQYFVXXXXXXXXXXXGTGLRYY--LVT-RLGERVVADIRKAVFDRMIGMSPAFYEKIMTGEVLSRITTDTTLILSVIGSSVSVALRNVLIFLGGLVLLFFTSPKLTLLVLLIVPAIIVPI-VLLGRRLRVLSRENQDWIAASSGSASEALSSVQTVQAFTGEGQSRENFSEVTEESFNSAKARIMTRAMMTVIVIALIFSGVVGVLWIGARDVRADEMSVGALVQFVIYAVMVAGSVGALSEIWGELQRAAGATERLVELLNAQDSVDDPAAPRPLPDQGAIRLEDVTFRYPSRPKAALSSISFDIQPGETVAIVGPSGAGKSTIFQLLLRFYDPSAGKVCIDGVDVAEMSRAEFRKCIALVPQDAVIFAATARENIRFGRPEASDSEVEXXXXXXXXHDFLTPEGYDSYVGERGVMLSGGQKQRIAIARAILRDAPILLLDEATSALDAESERLVQAAVDEISQDRTTLIVAHRLATVKKADRILVFDEGQIVAEGTHAELVEAGGLYARLAR.. 585
179 0.000e+00gi|984323850|gb|KWV73165.1| Lipid A export ATP-binding/permease protein MsbA [Pseudomonas fluorescens]  clstr ali  25  21.RAIRLASRFIAPYRWQALGALLALIVTAGITLSMGQGIRLLVDQGFMTQSPHLLNQSIGLFMLLVVGLAVGTFTRFYLVSWIG----ERVVADIRRQVFNHLIYLHPGFYENNRSSEIQSRLTTDTTLLQSVIGSSLSLFLRNALMVIGGIVLLFITNPKLTSIVVVALPLVLAPI-LIFGRRVRSLSRLSQDRIADVGSYVAETLGQIKTVQAYNHQVQDEQRFAVTVEDAFSTARKRILQRSWLITLVIMLVLGAVGVMLWVGGMDVISGRISGGELAAFVFYSLIVGSAVGTLSEVLGELQRAAGAAERIGELLQSGNDIQAPTTPLPERVSGRMELQDLRFSYPSRPDSAIDGLNLTINPGETLALVGPSGAGKSTIFDLLLRFYDPQQGRILLEGQPLTELDPLDLRRHFALVSQSPALFFGSVEDNIRYGNPSATTAQVEAAARIAHAHDFIMPDGYQTHLGESGQGLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEHLIQQALPQLMQGRTTLVIAHRLATVKNADRIAVMDQGKLVAVGTHQQLIASNPLYARLA... 590
180 0.000e+00gi|647637528|ref|WP_025910179.1| MULTISPECIES: thiol reductant ABC exporter subunit CydC [Bacillus]  clstr ali  30  1MRNLLTISTIVLKEKKDIVYTTIFGVLAGLIGISLFGASGYVISKAALIPP----LYTLTVMLALLKLFGIAKAVTKYAERYYSHRATFTILGNLRVRFFEKLEPLMPSVLHQYRSGDLLARIVGDVENLQNFFLRVFYPPIVFFFVFISTIFFTLFYSVWISVTLAIGMLLTGVVVPMLAAWRQQRLKASTQELRSELSAETTEFLYGFRDLKVHQKVGEKQGKLTELSKLYLSAQARKQEAENASQSWSLVISMFVCWAVTLFGVYDVTRGELDGLFLAMLIMIGLNVFEYAVPMAAFPTHFEDSRRSSAQLFSVMGNQKEVKKRVSAVLQDEPMDVEVRNLSFAYGNRN--VLDDVSVTFSAGSKTAIVGPSGSGKSTLFQLLVKLYEPTSGTISINQEFLTNVEQEDLWSYTNVVMQENHFFYGTVRDNLLLANDNASDIELKAALQAVELHAYE----LDDRILEKGENLSGGERQKLAMARAFLKKGRIWLLDEPFSSMDLLTEQKVIAELTQKAKDATLIFISHRLAGLERMDQIIVMDEGRVVEVGSFSELMSKKGYFYHLKQ.. 561
181 0.000e+00gi|550939404|ref|WP_022687809.1| ABC transporter ATP-binding protein [Sphingomonas phyllosphaerae]  clstr ali  27  16...LAMVFRHAGKYPLQITAAFSALAVTSAATIAIPYSFKRVIDRGFATPEAVAQSFHYMLLIVVV--LALGTAVRFYFVAWLG----ERVVADIRTEVQRHLMTLSPSFYESNRPSEIASRLTADTGQIETVVGSTVSIALRNSFTAIGGLIYLFAISPKLAAMLLAGIPLIIAPI-ALLGRRVRNLSRTSQDRIADVGSIVVETLGAMKIVQAFGQEARESARFTDAVEATMATARKRVALRAIMTAIVIGLVFGAITLVLWEGAEDVAAGRLSGGAIAAFVLTGGIVAGAFGALTEVYGDLLRGAGAAGRLTELLAARPEIAAPAHPVALPQPGTVAFRRVEFRYPSRQDAALHEFSLDVAPGETLAVVGPSGAGKSTLFQLLQHFYRPATGQVLVDGVDLATADPSEVRARIAMVPQETVIFGTSARDNLRYGRWDADDAQIWAAAEAANAADFLRPEGLDTFLGEGGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQDALERLMATRTTIVIAHRLATVRAASRIVVMDGGRIVEQGTHPALIERGGLYARLA... 584
182 0.000e+00gi|648650456|ref|WP_026342207.1| thiol reductant ABC exporter subunit CydC [Paenibacillus fonticola]  clstr ali  29  3........PYFRTYSGRFALYLILGTLTILAASMLMFTSGFLISKSSLQPDNILLVY---VPIVGIRAFGIGRAVIHYVERLVGHDAVLRILSKMRVRLYKILEPQALFIRSRYRTGDILGVLADDIEQLQNVYIRTVFPSLAALLVYGTVIIALGRFDWLFALLIAGYIFILVAVLPYISLLLTKRTNAEVKRERNGLYQKLTDAVMGIGDWVISGRPAEFLESYEQDEDAVARKERKLRTWARWRSLAGQLVVGIVVVSMIYWSGSQAAGGHIDPTLIAAFVLVVFPLADAFLPLSDAVERIPQYQESLRRLDRISENAEAVAAAVLDVSRTREVHLQLHGVSFAYEGQAAYTVRNVSLDLPQGKRVMVIGRSGAGKSTLLKLIQGAIAPTEGDVSINGVPASHF-GDDISKVISVLNQSPHLFDTTVANNIRLGRPAASEEELDLAVQQAQLDALIAPAGLDTPMRETGQRFSGGERQRVALARILLQDAPVLVLDEPTVGLDPRTERQLLSTIFKSTTGKSLVWVTHHLVGAEMMDEIVFMEHGAILMRGTHEQLLEREPRYRSLY... 604
183 0.000e+00gi|950253811|ref|WP_057290330.1| ABC transporter [Noviherbaspirillum sp. Root189]  clstr ali  26  17...LKGLLPFLMPYKKQFVLAGIALLLAAGSTLAIPYAFKQMIDLGFGAAGSTTHIDLYFLALFGVAVLAIATAARFYMVSWLG----ERVTADLRSAVYRHVVTQSPEFFETTQTGEVLSRLTTDTTLIQTLVGTSISMALRNTLLFVGGLVMLFVTSVKLSSIIIVMLAAVVLPI-VLFGRRVRALSRDSQDRVADASALAGEILNAMPTVQAFTHEKEEASRFGASIERAFSAAMRRIRARSMLTMMAILLVFGAIVFVLWLGAHAVIQGRMTAGELGQFILYATIVAGAIGALSEVLGEAQRAAGAAERLLELLAVRSPIQSPMHPVSLPQGASLSLRHLGFHYPSRPQAALSDLTLDIGAGETVAIVGPSGAGKTTLFQLLLRFYDPQHGSILLDGVDIRQLDLHTLREAIGVVPQDTIIFSANAMENIRYGRSDASDDEVIAAAKQAAAHEFIEPEGYRSFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERLVQAALEAAMVGRTTLVIAHRLATVQRADRIIVMEHGRIIESGTHASLVERGGLYASLA... 588
184 0.000e+00gi|806815496|ref|WP_046174271.1| thiol reductant ABC exporter subunit CydC [Domibacillus indicus]  clstr ali  32  1MKQL---IAIMIKEKRDIWLSVLLGAVAGLTSVALFGLSGFLISKAALQPP----LYIITVMAALVKFLGAAKAGSRYAERYVSHRATFTILSNLRVSFYEKLEPLAPQIFGRYRSGDLLARIVGDVETLQNFFLRVFYPPLVLVIVFLSTIFFTLFYSVWIXXXXXXXXXXTGFVIPGLLALRQRAVKQGIRQRRADLSADAAELLYGFRDLKLHQTLTEKHAQLLHTADLYVKEQEKEGLSAAGGQALNTAAAMAVSFVVLALGAYFVTIGELDGLFLAMLVMISLNIFDNAVPMAVFPAHFEDTRQAAGRLFSIAAEEPPEIK-TGMLEQKETFSIEWRDVTFTYPGEARPALKNVSISMPAGTKTAVVGPSGSGKSTILQLLLDMHQPEAGDILLGERSIKEVRPESIWSKTNVMLQANHFFYGTIRDNLQIAGDDVTESEMKESLRLTAL-----PFGLDDPVLEKGENLSGGEKQRLAMARLFLKRAPVWLLDEPSSSLDTLTEKQIFKELFKKAEGNTLLLISHRLTGLEKMDQIVVMEHGQVVEAGTFAQLMAKKGYFYELKQ.. 558
185 0.000e+00gi|916410121|ref|WP_051113865.1| ABC transporter [Hyphomicrobium zavarzinii]  clstr ali  25  19LRPLLALKPYLLRHPGRLAGAAVALVLSAGAMLAVPMAVRRMIDNGFGARDGGMIDQYFMMMIAIGLVLAIASASRFYLVNWIG----ERVVADLRADVFAHLARLGPDFYERTHSGEVMSRLTADTTQVKAVAGSSISQALRNAIMLIGALVMMIITSPSLSLLVLI--AIPVIVLPLIYGRVVRRLSRRAQDTLAEASAYAAENLAAVRTMQAFGHEGAVAGRFAASVERSFTAARERMMARAGLTGLVILLVVSSIVGVLWYGASSVISGEISGGRLSQFVIYALFAAGALGELSEVWGETTQAAGAAERITEFLTIEPEIKSPANPVPLPLPGEIEFRNVRFAYTGRTAPALDGVSFRVAPGERVALVGPSGAGKSTVLNLILRFYDPASGQILIDGIDISHLALDALRGTTALVPQEVALFADTVIENIRYGTPNAAETDVVRAAVAAQADAFIRPQGYETRLGERGVSLSGGQRQRIAIARAILKNAPILLLDEATSALDTENELAVQRALDALTKGRTTIVVAHRLSTVQNADRILVLDNGHIVESGTHRELVQRSGLYARLSE.. 589
186 0.000e+00gi|651606737|ref|WP_026601043.1| ABC transporter [Methylomonas sp. 11b]  clstr ali  24  16.STLKALWPFIRPYRGRMFLAFCLLCLGSATILLVPLAFRDLIDFGFGQGLLGSLSMDHFLALFGLACLWAVTIAARY---YTVSWVGERVTADLRSAVYERVLAQSPQFFETLQTGEVLSRLTGDTTLIQTVVGSSISMGLRSLFQFVGGMIMLAVTSLHLFSLILGLMILLTLPI-LAMGRKVKKLSRESQDKIADASALAGEILNAVPTVQAYNQERREANRFKERAEISFLTAVRRSRFRSALTVIVITAVMGSIIFVLWIGANQVNAGIMTGGQLASFVLYATLVSSGVSTIAEVWGDVMRATGATGRLLELLHAEPAIVDTLTPQSLVGGAAIQFQQVSFSYPSRLQSALDSIDLSIAVGESVAFIGPSGAGKTTLFQLLLRFYDVTHGTIRLNGQDIRHLSLQELRGKIAIVPQDAVIFSTSALENIRYGRPDASDEEVIAAAQLAQVGEFIDPDGYQTFLGERGTRLSGGQRQRIAIARAILKNAPLLLLDEATSALDAESEVLVQQGLNAAMRGRTTLIIAHRLATVNKVSRIVVLDQGRIVEIGSPEDLRKQSGLYARLA... 592
187 0.000e+00gi|737744708|ref|WP_035713404.1| ABC transporter [Haematobacter massiliensis]  clstr ali  26  21...LRGLAPFIRPYRVXXXXXXXXXXXXXGVSLILPMAVRRVVDGF---GSDALLLDTYFTAFLGIAALLAVGTGLRYY--LVT-RLGERVVADIRKAVFDRVISLSPGFYERVMSGEVLSRITTDTTVILSVLGSSISVAMRNAIIVAGGTLLMLLTSPKLTGLVL--LIVPLVIVPIVTGRRLRAESRTSQDWIAASAGNASEALTAVQTVQAFGHEPETRAAFARVTEKAYASAQRRIGTRAVMTMIVIFLVFAGVVGVLWVGARDVRADAMSIGALVQFVIYAILVAGAVGSLSETWGEVQRAAGATERLLELLATEDEITDPAAPVPLPRPGEVAFRDVSFHYPTRSRSALEDFTLTVRPGETVALVGPSGAGKSTVLQLLLRFRDPDSGSVSLDGIDLRDMARGDFRAALSLVPQDPVIFAATARDNIRFGRPDATDEEVTXXXXXXXXHDFLTPDGYDTWLGERGVVLSGGQRQRIAIARAILRDAPVLLLDEATSALDAESERAVQRAVARLSEGRTTIVVAHRLATVRSADRIVVLDAGRIVAEGTHETLVAEGGLYARLAR.. 586
188 0.000e+00gi|750146955|ref|WP_040451030.1| ABC transporter [Labrenzia alexandrii]  clstr ali  24  13LRPLSRLLPYLLKHKGMVLAALAALFSAAIITLILPAAVRRMIDSGFGADDPALVNSYFAVLIGVVCALACASSV-RYFLVM---WLGERVVAEVRADVFAHMTRLSPSFYDSAKSGEILSRLTADTTQIKAAFGASASLAMRNTIMFTGASVMMVVTSPRLSVIVXXXXXXXXXXX-XGFGRKVRKRSRFAQDMLADASAYAGEMLGSVRTLQAFTHESRSSGIYRSAVETAFTAARQAITARAALTGFAILVIGSSIVAVLWIGASDVFAGRMTGGELSQFLLYSILAAGSLAALSEVWGELSQAAGAAERLSELLEITPEIRAPLNPIPLPDRGEIRFEDMSFAYQAAGNPVVQDLTLTIAPGEKVAVVGPSGAGKSTLFSLLMRFYDPTSGAIRMNGVDLRDLDPDALRRNIALVPQDTAVFGASIAENIAYGLPDAKRQDIINAATAALASPFIETNGYDTLVGERGITLSGGQRQRIAIARAVLKQAPVLLLDEATSALDAESEQLVQRALDQLMEGRTTLIIAHRLATVLKADRIVVMDEGRIVETGTHQQLSAAGGLYAKLA... 582
189 0.000e+00gi|947468833|ref|WP_056133191.1| ABC transporter ATP-binding protein [Lysobacter sp. Root494]  clstr ali  25  13...LRTLWPFVHGHLGLFIAWLVALACSSTATLSFPAAARVVIDQGFASG-GAAIDHXXXXXXXXXXXXXXXXXXRFFFVSLLG----ERVVADLRERLYTQLLGLDAGFHDRNRSGELVSRLTADAELLRSVVGSTMSVALRSVVTVIGSIVMMFVTAPHLAAYALIGIPFAVLPI-VIGGRRLRKISRASQDRIADANTLAAETLGAVRTVQAHAREPYEHGRFTEALRTAVNVARKRIGAQSIVTAVAITIVFGAITIVLWSGAHDVVGGSMTAGTLGQFVLYALIGGGSVGALAEVWNDLQRAAGGMGRIGELLVEAPAIVSPEHPQPLPSPGELAFQHVTFHYPQRPQAALVDFNLRVHPGETVALVGPSGAGKSTVFSLLLRFHDPQQGTVRVDGVDVRELDPAALRGSIALVPQQPTIFATSARDNIRYGRLEASDAEIEAAVRAAHASDFVSPQGLETELGERGARLSGGQQQRIAIARALLKDAPILLLDEATSALDAQSERAVQQALEKLMEGRTTIVIAHRLATVLKADRIVVMDHGRVVAEGTHAQLLEQGGLYAELAK.. 579
190 0.000e+00gi|501442177|ref|WP_012465626.1| thiol reductant ABC exporter subunit CydC [Chlorobium limicola]  clstr ali  31  1MKTFLRLTALVKPYFWWMALAALIGFATTGSGIGLLMTSGYIIAKAALQPPLSAI----QLGIVGVRFFGLARGALRYAERLLSHDATFRILTKLRLWFYDAIEPLAPARLMHFRSGDLLQRVVDDIQSLENIYTRVLVPPLTALFVSALMWFLLGKYSIEASLLILFFHMLAGIGVPLLAIRLSRGVSVGIMKQKTAQQLLSLDLFQGIGELQIYGKLPKHLEAMRTAEADKLRLQRKNALIDGLHESLTGLLMNGAVVAILWALIPKLSAPDMNGISLTIVTLAVMASFEPFLPLPASLKHLEADMHAGERLFEILDAKPETIAPAAPLPFPKDPAIRAENLSFTYPGSPVKTLDSLSFAAVPGDRIAIVGPSGAGKSTITSLLMRFWNTPEGSLTIGGADIGRFDPEELRRNISLVSQRTYLFARTIRENLLLAKPEAADEELKKALTAAGLAHFSS--KLDEWAGQHGMKLSGGERQRMAIARMVLQNAPVMILDEATANLDGVTEKEVTETLSTLGRGKTMITITHRLKAMDQYDVIVVLDKGKIVEQGRHEDLMQGNGLYRRMWK.. 565
191 0.000e+00gi|954177100|ref|WP_058089210.1| ABC transporter [Aquabacterium parvum]  clstr ali  24  14.RPLGSLRPFLMPYRGRIALAGLFLVLAAITTLVLPLALRTLIDQGFVSPDPGERVMQHFLALFGVGAALGVFSASRYF--MVT-WLGERITSDIKGAVYAHVLRQSPEFFETTQTGEVLSRLTADTTLIQTVVGTSVSMGLRNVIMAIGALTMLVVTNPVVMAQVLGGLVL--IVLPAIAYRRVRRLSRASQDRIADSSAIAAEVLNAVPVVQSYTAESREAQRFSEANENAFRTGERRIRARALLVGFIITATTGALLWGLYQGTQAVLDGRITAGHMGQTVVYVILLLSSVAALSEVYGDILRAAGATERMMELLKARSRIESPTQARSLPAGSTVKLSGVQFHYPSRPQPALEDFSLDVAAGETVALVGPSGAGKSTVFQLLLRYYDPQGGHVEIDGVKLPEASLDALRERIGIVPQDSTIFSASAMENIRYGRPSASDEEVFAAARAAHAHDFLQPEGYQTFLGERGVRLSGGQRQRISIARAMLKNAPLLLLDEATSALDSESERAVQAALEEAMKGRTTLVIAHRLSTVVNADRIVVMDGGRIVDAGTHAELMARNGLYARLA... 587
192 0.000e+00gi|746244602|ref|WP_039293011.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. IHB B 3415]  clstr ali  31  1MNELAILTKAMLQERKDIVMAIIGGFIAGIAGVCLFATSGYLISQTVFAPP----LYTLIVLTSLVKILGLVRAAARYAERLYTHRATFSMLSRLRTAFFAKLVPLTPGVLNQKRSGDLLSRIVGDIESLQHYFLRVAYPPVIVVMVFLATVLFTSAFSVWIACLFVMGMLAAAFVVPAIVMLGQRKNQGRVREQRSALSTEVTELLYGFRDLKVYGQLEQRGKQLESASAALTAEQQAAARHLLRGQSLHVFVTFLISWSVLTLGALLIVEGSLAGVFLAMLVMISQTVFEEAAAMATLPAYKQDSEHAAKRLEETVRAADLLAEPSGKVPADQAVSIELSGVSFQYEDEWRPALKDVSLHIPSGSKTAIVGPSGSGKTTILELLLKLRTPAEGQIRLNTTSIQDLDEAGLWQAANVVLQNSHFFRGTLRDNLLLKEEAHSDEALSAMLNKVQLPDKL----LDDMVYEKGENLSEGEKQRLALARVMLRTGRLWLLDEPTSSLDYITEQQVLRHLLAQAADDTLILISHRLTGLEAMDQILVMDHGQVIEAGSYSDLMKQKGYFYEMKQ.. 564
193 0.000e+00gi|948753391|gb|KRL77544.1| thiol reductant ABC exporter, CydC subunit [Lactobacillus paracollinoides DSM 15502 = JCM 11969]  clstr ali  27  2MRDLRWVMPYLRKYKWLLTLVLFLGVMTFLSAGALMFNSGYLISEAARRPGNIIYIY---VPVVLARGFGIARPAFRYAERLTSHNWVLRIVSDFRKKLYQAVENKAAAIKQTHQTGDILSILAEDIDHIENLYLRTVFPMVIGWVLYLFIVIGVGVFNWAXXXXXXXXXXXXXXXMPMVSVAVNGAREFKEKQIQHDFYTNLTDEVLGLSDWVISGRYDDFMDLQTKPIKQIAKLRREDHYFQWWRGFGVQVFFLLAVLTLLIWSGFQFTGSKAQANWVAAFALALFPVIEPFLEISQGASEWPIYQQSIQRVNALSA--DPVVQKDQAQLNGAFSQLTVDNVTFRYADDDRVILHDLTLQINAGEKLALLGPSGTGKSTLLKLLLGDEHATAGQVTINGQDIATL-QDARANLFGVLDQQPYLFDTTVMNNVRLGNLNATDDQVKAAIKAVELEPLILPNGYDTQVQESGARFSGGERQRLSLARILLQDAPIIILDEPTVSLDPITEKDLLDTVFNVLKDKTIIWVTHHLAGIDHVDQVRFLENGQFDMQGTLDDLYQHEARFRRLY... 574
194 0.000e+00gi|507129334|gb|EOR21887.1| cysteine ABC transporter permease/ATP-binding protein [Bacillus nealsonii AAU1]  clstr ali  30  1MSALQKIIKLMLMEKKDINIAVICGFIAGISSVGLFAASGYLISKSALIPPF----YTLIILTSTVKLLGLVKAGAKYGERLYSHRATFTILSNLRIAFYEKLTPLVPQIFHKYRSGDLLARVVGDVESLQNFFLRVFYPPLVLLLVFVSTIFFVCFYSLAIAVILLLGFFLTTIIIPALFSLKQVKIKGKVRQERGNLSTHITEVMYGFRELKLFHQLPSKQQQLLSHSESYINQQKVENLNKVSSQSFNGFMTFVTSWLVIGVGAYFVANGMLEGIFLAMLVMISLTVFESAAPMAVFPIYMQESRDASTRLYEVVEDSSFVKDPINKLPSLAP-SLQFTDVQFTYMGDWRKTIPKLSFVIPAGSKTAIVGASGSGKSTLLQLILKLQYVDDGKIYWGDFDTSTVSSEAIWEQTRVVLQENYYFYGTIRENLQLAESQLSDTQMEAALAKVKLEHF----SLDHRVLEKGENLSGGEKQRLAIARAFLKKGHLWLLDEPTSSLDSQTEQSVYQEIFKYAEQDTFILVSHRLNGLEHMDQIIVMDHGEIVECGSYNDLMNKQEYFYKMK... 565
195 0.000e+00gi|918204225|ref|WP_052341544.1| ABC transporter [Salinarimonas rosea]  clstr ali  25  23LSALRPLVGFAARYKGRIAAALIALVVASVATLAVPLAVRRVIDHGFSD-AQGDLISAYFGMLVVVVGFLALGSALRYYFVIT---LGERVVADVRAAVFERLTTLDPAFFDASRAGELVSRLTADTTQVKAAFGASISIALRNAVLLVGAIALMIWTSPKLSALVLVALPLIVVPI-IVSGRKVRRRSRIAQDKLADASAFAAEAVGSVRTMQAFGMERETARRFAHAAEEAYDAARISVRARAMLTGAAIFLVSASVVGVLWYGAQAVLAGTMTGGTLGQFVLYAVFAASAMGQLSEVYGELAQAAGSAERLGEILEALPGVTAPERPRALPEPGSVAFEDVRFHYPTRTEPALEGVSFALRPGERVALVGPSGSGKSTVLQLILRFYDPEGGRVSVDGVPLTEADPVALRRRLALVPQEPTIFGVSVLDNIRYGRPDATEAQVREAARLASADVFVEPDGYATLVGERGVTLSGGQRQRIAIARAILKDAPILLLDEATSALDAESEHAVQEALDRLMEGRTTLVIAHRLATVRSADRILVMDAGRIVEEGDHDGLVARGGLYARLAR.. 593
196 0.000e+00gi|504270606|ref|WP_014457708.1| thiol reductant ABC exporter subunit CydC [Bacillus megaterium]  clstr ali  29  2MKYKSWIWPYFKTYKYRIFSILLLSLLTIGSACALMFTSGYLISASSLQPETILLVY---VPIVLVRTFGLSRAAFRYGERLVSHDFILRILAKMRTRLYHLIEPLIAT--SRYRTGDVLGVLAEDIESLQDLFLRTILPTISAVILYVVAIVALGFFSLKFACLIAIYLFLLVVVMPLFSLWHMKAANQRYKSSKAQLYAKVTDGFLGVADWVLSGQQQSFFHSYNKTEDELDRMDRKLKLWTYYRELIGQVIVAGLIVTMIWFGASLFADKELAGVFIAAFILVVFPLSEALLPVSNAVEKIPQFEESLNRVQEMEKNWETVNEKKHTLSLPDSVSLKVEHVRFRYSNEEESVIHDLSFQVEQGKKIAILGKSGAGKSTLLKLLQGSLLPTEGTVQLNGQSVAEVR-EDVPKLISVLNQNPYLFNTSVANNLLLANEEATKEEVIEAMKQVNMHSLVEGQGYQTSMLETGQRFSGGERQRIALARVLLQHTPIVMLDEPTAGLDTVTEKRLLSTIFETLHDKTLIWVTHNLVGMEKMDEILFLQDGKVAIRGTHEELLATNSHYQKLYE.. 574
197 0.000e+00gi|928981317|ref|WP_054005643.1| ABC transporter [Pseudorhodobacter psychrotolerans]  clstr ali  25  17..ALRGLWPFLRPYRPMMITAGLALILTASVSLILPMAVRRVIDN-FNAGDLGL-VDKYFGAALLIAATLAIGTGIRY---YFVTRLGERVVTDIRRALFDRVMGMSPAYFEKILTGEVLSRITTDTTLILSVIGSSVSVALRNMLTVLGGMVLMSLTSFKLTGLVLLIVPAIIIPIVTL-GRRLRNQSRENQDWIAQSSGKASEALSAVQTVQSFTHEALTRADFAAVSEQSFTSAKTRMATRAAMTVIVIFLVFAGVVGVLWMGARDVRAGTMTPGQLVQFVIYAVLVAGAVGSLSEIWGELQRAAGATERLVEMLDATDPVVEPTHPVPLPVKGAITLDNVEFHYPARPAPALHGISLTVQPGETVALVGPSGAGKSTVLQLLMRFYDPQSGSLALDGQDLKSLARTDFRAAMALVPQDPVIFATSALENIRFGRPDATQXXXXXXXXXXXXHDFIAPNGYDTYLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQAAVDHLSKGRTVIVVAHRLATVKRADRIVVLDQGRIAAIGTHDELVAQGGLYARLAR.. 584
198 0.000e+00gi|652886988|ref|WP_027147406.1| ABC transporter [Methylobacter marinus]  clstr ali  24  13LSSLRNLWPFLRPYRGRMALAFVLLCLGSATILAVPLAFRDLIDQSASTGLLGSLSLNGFAVLFGLASVWALAVAARY---YTVTWLGERVTADLRSAVYARVLAQNPQFFETLQTGEVLSRLTGDTALIQTVIGSSISMGLRSLFQLAGGMIMLAVTHLYLFSLNLGLMALLMLPI-LAIGRRVKKLSREAQDKIADASALAGEILNAVPTVQAYTHEQQEARRFADRAEVSFMTAIRRSRVRAVLTALIIMAVMGVIVFVLWVGAHQVQTGIMTGGQLTSFILYAALVAGGAGTLAEVWGDVMRAAGAAERLLELLHARPAIIDPPQPLPSPEKSEIQFEHVTFRYPSRPQKALDDISLDIAAGESVALVGPSGAGKTTLFQLLLRFYEVTDGVVRFNEQDIRQLSLHDLRNRIAIVSQDPVIFSANALENIRYGRPTASDDEVMAAARSAQVEEFIQPEGYQTFLGERGTRLSGGQRQRIAIARAILKNAPLLLLDEATSALDAESEILVQEGLNVAMQGRTTLIIAHRLATVKKVSRIIVMDQGRIVEIGAPDDLRQRSGLYARLA... 590
199 0.000e+00gi|891156097|dbj|BAR98864.1| ABC-type multidrug transport system [Blastochloris viridis]  clstr ali  25  52LKPLSALVPFVGRYKGRVGAALVALVVATLATLAVPVAVRRMIDHGF-APENAGFIDQYFSMMLAVVSVLALASAVRYY--LVT-TLGERIVADLRAALFAHLLRLDATFYDTAKTGELISRLTADTTQIKSAVSTAASIALRNVMMVIGAVAMMVVTSPGLSGLVLV--AIPIIVLPLVFGRSVRKKSRLAQDTLADASAFAAESISAVRTLQAFTGEGTARSRFDRAVEXXXXXXXXXXXXXXSLTFVGIFLVFASVVAVLWSGAQEVLTGRMTPGTLGQFVLFAVFAASSLGQLSEVWGEVSQAAGAAERITELLGVKPCIDVPAKPTALPKPGVVAFESVRFAYPTRTTAVLDGVSFVVRPGERVALVGPSGAGKSTVFHLLLRAYDPASGKVKLDGVSLADADPRDVRGHIALVPQDVDIFAATVADNIRVGRPDATDEEVRHAAELAAADEFVAPNGYGTLIGERGITLSGGQRQRIAIARAILKDARVLLLDEATSSLDAESETLVQTALDRLMEGRTTLVIAHRLATILSADRILVMDGGRIVEEGRHGELVGRGGLYARLAK.. 622
200 0.000e+00gi|739343543|ref|WP_037205814.1| MULTISPECIES: ABC transporter [Rhodobacteraceae]  clstr ali  25  20..ALAGLAPFILPYKWLVVLAGMALVLTATVSLILPLAVRRVVDG--FETENAQLLDSYFSXXXXXXXXXXXXTGLRYY--LVT-RLGERVVADIRKAVFDRMIGMSPAFYEKVMTGEVLSRITTDTTLILSVIGSSVSVALRNVLIFLGGLVLMLLTSAKLTGMVL--LLVPAVIVPIVLGRRLRALSRENQDWIAASSGSASEALLSVQTVQAFTHEAQSRASFADVTERAFVSARKRIGTRAVMTIIVIFLVFSGVVGVLWIGARDVRADVMSVGELVQFVIYSVMVAGAVGALSEIWGELQRAAGATERLVDLLHAEDSVKDPAQPRTLPEPGAIGFEGVTFHYPTRPQSALSGINLDVKPGETIALVGPSGAGKSTIIQLLLRFYDPQQGRVTLDGISLCDVTRAEFRHHVALVPQDPVIFADTARENIRFGRPDASDXXXXXXXXXXXXHDFLAPDGYDSYVGERGLMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQHAVDEMSADRTTIIVAHRLATVKKADRIVVFEEGRIVAEGTHDALVAEGGLYARLAR.. 587
201 0.000e+00gi|491990141|ref|WP_005708880.1| thiol reductant ABC exporter subunit CydC [Haemophilus paraphrohaemolyticus]  clstr ali  48  1MKPLFPFLSLYRNHFGRLLLGTILAITSLSASIGLLSLSGWFLAASFLVGSTIL--FNFFYPSSGVRGLAIGRTISRYFERLVTHDATFRVLAELRISVFKKLIPLSPSGLNRFRNSELLNRLVADVDTLDTLYLNLLSPFVSAIMVITFMAIGLSFISGLLTIIICGTLLALLFIFPAIFYRLGQKSGKKIIQARAEYRSQFIEWVQLNAEFLLFGLVPQMTEKLEKTEQTWLSSQSKENQLTGFSNALLTFMNGVLVCIVILLVATAIDAPSADTPLVALVIFCVMASAEILMPIGIAFLHLGQLITAAERLNDVIEQRPLVAFNGSASIAENQPLVRFENITFSYPASHQAALNALSFEVNKGEKVAILGKTGSGKSTIFQLLNRHYDPTSGQILLANCNVADYPEATLRSHLVTLSQRIHIFSQTLRDNLLMGNPHATDEHLKLVLEQVELAYLLQEQGLDLWLGEGGRPLSGGEQRRLGLARVLLSNAELVLLDEPTEGLDRETEQQILTLIFTHCQTRTLLMITHRLQGLKRFDRVYRIDNGQL....................... 553
202 0.000e+00gi|398097283|gb|EJL87593.1| ABC-type multidrug transport system, ATPase and permease component [Polaromonas sp. CF318]  clstr ali  23  33.RSLSGLLPFLRPYRGHILLAAVFLVLAAVATLVFPLALRSLIDGGFSAAGKGEQLMALFELFAVAAALGLFSAGRFYMVSWLG----ERVTADLRNAVYAHVLRQSPEFFETTQTGEVLSRLTGDTTLVQTVVGSSLSMGLRNAVMGVGALGMLVYTNPYLMVQVLGVLVLIVAPS-VWFGRRVRKLSRASQDRVADSSAIAAEVLNAIPVVQSYTAEAREAGRFDQSTTRAFNTAVRRAGARSVLVAFIIIATSAALLWGLYQGTQAVMRGDITAGHLGQTVVYVIILASASAVLGEVYGDLLRAAGATERLMELLASRSPVSSPARPVPAQAGSAIRFEAVNFHYPSRPQAALSDFSLSVAPGETVAIVGPSGAGKSTVFQLLLRFYDPASGRIELDGVRTDAMSLEDLRKRIGIVPQDAVIFSTSALENIRYGKPEASDEETRAAAKAAFAHEFITPEGYDTFLGERGVRLSGGQRQRIAIARAMLKNSPLLLLDEATSALDAESERMVQAALESAMKGRTTLVIAHRLATVQQADRILVLDHGRLVEQGTHTELVNRGGVYARLA... 606
203 0.000e+00gi|652420419|ref|WP_026815865.1| ABC transporter ATP-binding protein [Arenimonas composti]  clstr ali  26  11LNTLRGLLPYVRPHRALVGLWLAALALSSTATLLLPVAVRYVIDEGFSAGGSIDPWFALLFGVAV--LLGLATAARFYFVTLLG----EKVIADLRRSLYGHLLGLDQAFFERSRSGELVSRLSADTEMLRGVIGSAMSVALRSGITVLGSAVMLAVTSPRLALFALLGIPLVVAPM-VLAGRRVRGVAKDAQDRVAEANARAAETLGAMHTVQSYAREAHERQRFGGAVDAALRTARKRIRLQSLLTAVVIVLVFGSITAVLWVGARDVAAGTMSAGTLGQFLLYAMIGAGSVTALSEVWNEVQRAAGGMARIAELLGERSGLPVPATPATLPVPGRIEFRDVTFRYPTRPDPALRDFSLVVAPGETVALVGPSGAGKSTVLQMLLRFHDPDTGVIRIDGVDLSTLDPETLRAQLALVPQDPVIFATSAAENIRYGRLDADDAEVEQAARDAEAHDFLAPQGYASELGERGARLSGGQQQRLAIARAVLKDAPVLLLDEATSALDAQSERAVQQALARLMRGRTTLVIAHRLATVLEADRIVVMDAGRIVAQGTHAQLMAAGGLYAELAR.. 579
204 0.000e+00gi|635651440|ref|WP_024298311.1| ABC transporter [Methylosarcina lacus]  clstr ali  24  15LSSLKALWPFMRPYRGRIALAFVLLCLGSATILLVPLAFRDLIDFGAGAGLLGSLSLNGFAVLFGLASLWALAVSARY---YTVTWIGERVTADLRTAVYARVLVQSPQFFETLQTGEVLSRLTGDTILIQTVVGSSVSMGLRSLFQFVGGMVMLAVTSLHLFSLNLGLMALLTLPI-LAIGRKVKKLSRESQDKIADASALAGEILNAVPTVQAYTQEQRETRRFSERAEMSFKTAIRRTRVRAALTALIIMAVMGSIIFVLRIGANLVHEGGMTGGQLASFVLYAVLVAGGVGTLAEVWGDIMRAAGATGRLLELLHAQPAIVEANVPQPLPRPAEIRFDHVTFRYPSRPQAALEGITLAIAPGESIALVGPSGAGKSTLFQLLLRFYEVSDGAIRFNGQDIRELSLQELRNRIAIVPQDPVIFSANALENIRYGRPDASDDEVIAAAKSAQVEEFINPEGYQTFLGERGTRLSGGQRQRIAIARAILRNAPLLLLDEATSALDAESEILVQEGLNTAMRGRTTLIIAHRLATVKKVGRIIVLNQGRIVETGAPEDLRKQSGLYAKLA... 592
205 0.000e+00gi|495003676|ref|WP_007729690.1| amino acid ABC transporter ATP-binding protein [Brevibacillus sp. BC25]  clstr ali  27  11.....WFLPYFRQFFWQFAAAALLGTLAMACASALLYTSGYLISRSALKPENVLMVY---VPIVLVRAFGFSKAVIQYLERLVGHDAALRVLSRMRVRLYQAIEPQAQLLRTRFRTGDLLGVLADDIEQLQNVYLRFVLPAVSAVLLYGAGIVALGRMDGMFALLMALYCGFLLFVAPAVVLWSSIAKSRRFKRERQAAYRELTDAVFGMSDWILSGRTQQFLQLFTRRQKTAAQIENSIRRGEWRVQWMSQCAIGGAIVLLVIWVGGLAAANQIPATLIAAIGLVAFPLMDAFARISDAVVRMPEYKESLGRLREIEGSRPSIGEAQKEVADQAGGSLKLDHVHFRYPQASNWSVQDVSFEVPQGGKIALLGRSGAGKSTILNLIRGAIQPEAGKLTVNGQPVQ--SEEASACLFSVLNQQPYLFDTTVANNIRLGRPDASDEEVCAVTAQVGLDQLIEPDSYQTRMQETGLRFSGGERQRIALARILLQNKPIVLLDEPTVGLDPLTERDLMTTIFRVLQGKTLIWVTHHLSGVEQMDEIIFMEQGVISMRGTHDQLYRDNPRYRNLY... 573
206 0.000e+00gi|941811923|ref|WP_055189803.1| ABC transporter [Aliiroseovarius crassostreae]  clstr ali  26  22..ALSGLWPFMAPHKLWILGAFAALVFTAGISLILPIAVRRVVDGFDADGGAGHLLDKYFXXXXXXXXXXXXXTGLRYY--LVT-RLGERVVADIRKAVFDRVVGMSPAFYERIMTGEVLSRITTDTTLILSVIGSSVSVALRNMFIFLGGLILMLFTSAKLTGXXXXXXXXXXXXX-XXXGRRLRNLGRENQEWIAKSSGNASESLLSVQTVQAFTHEDLSRREFADLTEESFDSARIRITTRAIMTVIVITLIFSGVVGILWIGMHDVTDGGMSIGALVQFVIYSVMVAGAVGALSEIWSELQRAAGATERLVELLNAEDKVQDPAEPKLISARGAISFKDVTFHYPSRPHAALEGITLEVKPGETVALVGPSGAGKSTIIQLLERFYDPDSGSVELDGVDLRDMRRDDFRKYIAMVPQDAVVFATSARENIRFGRPDASDXXXXXXXXXXXXXXFLTPDGYDTYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERLVQAAVDELAQGRTTLIVAHRLATVKKADRIVVFEEGRIVAQGTHDELVEGGGLYARLAK.. 591
207 0.000e+00gi|890430232|ref|WP_048884451.1| ABC transporter [Erythrobacter sp. s21-N3]  clstr ali  27  21LRPLKMIAREAAKYPLQIALAVIALVVTAITSLALPTAAKLIVDRGFGGEGDVGRWFRYLLLLVSILGLG--TAMRFYFVSWVG----ERVVADVRCKVYENLLRLSPSFFEKNSPREISSRMTADTAVIEQVVGTTVSVALRNSIMAVFGTAYLFWLAPQLAVWLLAGIPLVIVPI-ALFGRRLRDISRSSQDRVADVGGITTEILSAMKIVQGFNQEEREAGRFGDAVARAFATARIRILVRAVMTAMLITLIFGALTILMWRGATMVNEGTITGGTISAFVLAGAITAGAFGSLTEVFGDLLRGAGAAGRLSELLEERPEIVAPARPQPLPEPGSLSFEKVTFSYPTRPESAISDFSLVVEPGESVAIVGPSGAGKSTIFQLVERFYDPQEGRIKLDGVALTQVDPRQIRQRMAIVPQEGILFAASARDNLRYGAWDADEDAIWEAARVANAEDFLRPNGLDTFLGEGGARLSGGQRQRMAIARALLRDAPILLLDEATSALDAESERLVQDALEHLMQDRTTLVIAHRLATVRAADRIVVMEDGRIVETGDHNSLSAAGGLYSRLA... 589
208 0.000e+00gi|947447668|ref|WP_056112111.1| MULTISPECIES: ABC transporter [Mesorhizobium]  clstr ali  26  16..PLRRLVPYIGRYRGLVAGAVVSLVLAALTTLALPVAVRRMIDHGFSSADST-FIANYFTMLVVMAAVLALASAGRYYFVIT---LGERVVADIRRDVFSHVTALSPAFFDTAHSGEIVSRLAADTTQVKSAVGATASVALRNIILGLGAVAMMVVTSAKLSGLVIV--AIPIIVLPLVFGRSVRRRSRQAQDTLAEATAYASEQIGAVRTLQAFTNEKLVTGRFXXXXXXXXXXXRSSVLARALLTFFAIFMIFSSVVAVLWFGSRDVLSGTLSPGTLGQFLLYAVFAAGALGALSEVWGELSQAAGAAERLTEILAERPAIGAPPNPKPLPARGAIAFDNVSFSYPARPRAAVHGLTFAVKPGETVAIVGPSGAGKSTVFSLILRFYDPETGSIAIDGIEAREADPAALRQRIAIVPQDVTVFAASARDNIGFGRPGASGXXXXXXXXXXXXDPFITRDGYDTQLGERGVTLSGGQRQRIAIARAILRDAPILLLDEATSSLDAESETLVQAALEHLMRGRTTLVIAHRLATVLKADRILVMDGGRIVEEGTHKSLVAKGGIYARLAK.. 584
209 0.000e+00gi|948036306|ref|WP_056695501.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. Root52]  clstr ali  29  1MNELAMMSKAMIQERKDILLSILGGFIAGIAGVGLFSASGYMIAQTVFAPP----LYTLIVLTSMVKLLGFVRAASRYGERLYSHRATFSMLSRLRTSFFAKLITITPGILNKNRSGDLLARIVGDVESLQNYFLRVAYPPIIVVMVFLSTVLFTSVYSLWVACLLVLGMLITAFVVPGIVLLGQRKIHGRVRQQRALLSTEVTEVLYGFRDLKVYGQLEQREQRLQQASAALALEQQRAAGHLLRGQSMHIFVTYLVTWGVLVVGAWLIMDGSLAGVYLAMLILATQTVFEEATAMAVLPVYKQDSEHAARRLTETVQSSDVQPAPGGQCATEQAVSVQLSHVTFQYEGEWRAALNDISITFPPGSKTAIVGPSGSGKSTIVDLLLKLREPTSGDIQLNDVSLSKLDEESIWQTSNVVLQQGHFFKGTVRDNLLLNGEEHADEQLAAVLNKVQLPNM----SLGDTVYEKGENLSDGEKQRLALARVMLRSGRMWLLDEPTSSLDYVTEQHVLQQVFAQSADDTLLLICHRLTGLEKMDQIVVMDRGMIVETGSFKELMEQQGYFYEMK... 563
210 0.000e+00gi|889517177|ref|WP_048823871.1| amino acid ABC transporter ATP-binding protein [Bacillus sp. B-jedd]  clstr ali  27  1MKTDKWIKPYILRHRWLFALAILLGALTVLFGGSLMFSSGFLISKSATRPESILMVY---VPIVGVRAFGIGRAAIGYAERLTNHQFILKIVSAMRLRLYKIVEPQAVFLRSKFRTGDILGALADDIEHLQDFYLKTLLPAIVSLAVYTVVILFAGAFSIQFAIVLAILCGLLVFAGPIVSFLYMRVKNGEMKRLRNVLYSDSADAVFGLGDWLFSGREEEFIRRHEQRQADLLELEKQRQSFVDWRDLLQHGILGFTVVATVYWASGAAEEGEIPATLIAAFSLAMLSLLESFLPLSTAAGDVTIYSDSVRRLMESGSVHKWSKDEEEAAYKASQAEIELKEVSFAY-EDGESVISNFSLNVRQGEKIAILGPSGSGKSTLLKLIHGQLLPTKGEVLLNGRRTGEIVGE-IPHWIAVLNQKAYLFNTSVMNNIRLGNEGASDEEVFEAANKVGLHDMLTPDGYRTGMSEAGRRFSGGERQRISLARILLQKTPVVIMDEPTVGLDPITENKLLADIFQALEGKTMIWVTHHLAGMERMDRILFMDDGEVTLDGTHEELLRESERYRRLYE.. 570
211 0.000e+00gi|648535851|ref|WP_026227602.1| ABC transporter [Hoeflea sp. 108]  clstr ali  24  25.........YLSRYPKLVVGAIISLILAAVTTLTLPIAVRRMIDHGFSTSDSG-FIAKYFAMLVAIAALLALASACRYYFVIT---LGERVVSDIRRDVFSHVTGLSPAFFDTAMSGEIVSRLAADTTQIKSAVGATASVALRNIILGLGALAMMVVTSPKLSGLVIA--AIPLIVLPLVFGRSVRRKSRAAQDTLADATAFASEQIGAIRTLQAFTNEKMVTRHFAAAVETAFQAARASVLARAILTFFAIFTIFASVVAVLWFGSRAVLDGTLSPGTLGQFLLYSVFAAGALGALSEVWGELSAAAGAAERITEILAEEPTVAAPALPVALPATGAIEFRDVTFSYPVRPRAAVHGLNFKVRPGETIAIVGPSGAGKSTVFSLLLRFYDPESGAVLIDGVDLKKADPEAVRERIAIVPQDVTIFASSAADNIGFGRPGASRSDIEAAAKAALADEFIEQDGYETQVGERGVTLSGGQRQRIAIARAILRDAPILLLDEATSALDAESERQVQTALEHLMQGRTTIVIAHRLATVLKADRILVLDGGAIVEEGTHQSLVAKGGIYARLAQ.. 586
212 0.000e+00gi|517986120|ref|WP_019156328.1| thiol reductant ABC exporter subunit CydC [Bacillus massiliosenegalensis]  clstr ali  26  1MKYFQVYVPYLKQYSHWIALAILFGVMTVVGSSMLTFTSGYLISSAALQPYNILMLY---VPIVLVRTFGISQAVTRYIERLIGHNTVLRILSIMRVSLYRVIEPQALFIRSRFQAGDLLGTLADDIEHLQDVFIRTIFPVIVALFLFASSVVALSLFDWKFALWIGFCLSFVVFVYPLLSLFLMKNNQLKLKESKSNLYTTLTDTIFGLTDWLIRGGQEQFLEKFAKESEQMAQVERKMSYWNQSRELHLRILSCMILIMVGIWAGLAVDAGEIASTYIAAFTLVTLPIIEGLIPVSRAVEKIPTYQESLKRIEMI--ESNGFEEKYSNVSLGKEADIFVNGLKYRYRGSIEDTIKGIDLSISPGAKVALLGKSGAGKSTLLQILLGELIPTKGQVLINGFAPSDY-GEDIYQMISVLNQKPYLFATTVENNICLGNEDATEEEIERVIRQVKLDQYIHPKGLATQMGETGALFSGGERQRIALARILLKDTPIVILDEPTVGLDPRIEADLIETIFTTLKDKTVIWVTHHLLGMEKIDQILFMEKGKIALEGNHQLLMKTSERYRSLYE.. 568
213 0.000e+00gi|1011955763|ref|WP_062762695.1| ABC transporter [Falsirhodobacter sp. alg1]  clstr ali  25  16MGALRALVPFLRPYRWMVAGVLFALVSTAGASLTLPIATRRVVD--AFGTSTEQLLDDYFLAFLGIAALLAVGTGARYY--LVT-RLGERVVADIRRALFDRVTGMSPAFFENIMTGEVISRLTTDTTLILSVIGSSVSIALRNLLMLIGGLVLMVFTAPKLTGXXXXXXXXXXXXI-VVMGRRLRVYGRDNQEWIAKSSGNAAEMLQSSATVQAFTQEGAVRARFSDLNERAFASARKRIATRAIMTMIVIFLVFAGVVGVLWVGARDVRAEGMTTGELVQFVIYSVLVAGAVGALSEIWGELQRAAGATERLSELLQAEDTVIDPADPVAMPVRGQISFEHVDFRYPQRPQAALEDMVLTVNPGETVALVGPSGAGKTTVLQLLMRFYDPQGGRICIDGVALTDMARADFRRDVALVPQDPVIFAASARDNIRFGRPEATXXXXXXXXXXXXXHDFLTPDEYDTWVGERGVMLSGGQKQRIAIARAILRDAKILLLDEATSALDAESEAAVQQAMERLAAGRTVIVIAHRLATVKKADRIVVMEQGRIVAQGTHESLIAEGALYARLAR.. 585
214 0.000e+00gi|499235942|ref|WP_010933482.1| thiol reductant ABC exporter subunit CydC [Chlorobaculum tepidum]  clstr ali  34  1MKTFLRLTGLTRPFAWWMLLAALIGFATIGSGIGLLMASAWLITTAALMPALSA----LQIGITGVRFFGISRGVIRYAERLISHNTTFRILTRLRVWFYDAVEPLAPARLAAYRSADLLKRIVDDIQSLENIYARVLAPPITAALITLLMWFVVGHWSTAAAEGVLTSQLIAGIAVPLLTARLAAGTARGITALQGEQQVLAVDMVQGMSELRVFGMVGDYTEKLRDAEVKKLALQKCAAFIEGLHESLTGLAMNGAVIWILYSMLPMVRTGAVSTITLASVVFGVMASFEAFLPLTGSVQNIEADVRAGERLFEIIDAKPEVVPPAKPEPFPKSTGIEVKNLAFTYPGSDRPALDGVSFSVPQGGRTAIVGPSGAGKSTITSLMVRFWNPTQGEISIGGQTIDKLDPEELRRNIAMVSQRTYLFGQTIRENLLLAAPDATDERLRQALTLAGLDSLQSR--LDDWVGQHGMNLSGGEQQRLAIARMILQDAPIIVLDEATANLDAITEQALLDTLDTTSQGKTVLAITHRLHRMERYDEIVVLYEGRTIERGSHEELLKSDGFYAGMWK.. 565
215 0.000e+00gi|736354745|ref|WP_034380445.1| ABC transporter [Herbaspirillum sp. CF444]  clstr ali  26  48.KTLIGLLPFLQPYKRQFMLAGLALIVAAAATLAIPYAFRQMIDGGADAAANTLHIDLYFLALFGVAVLGVATAARFYMVSWLG----ERVTADLRSAVYAHVVTQSPQFFETTKTGEVLSRLTTDTTLIQTLVGTSISMALRNGLLFAGGMVMLFITSVKLSSIIIVML--AAVVLPIVFYRRVRKLSRESQDRVADASALAGEILNAMPTVQAFTHEEIEARRFGTSVERAFHTAMQRIRARSVLTMMAILLVFGAIVFVLWLGAHAVVQGSMSGGQLGQFILYASLVAGSIGALSEVLGDTQRAAGATERLLDLLTAQSPVQSVLLPETLPPRAALQLADVVFHYPSRPDSALMHLSLDIKPGETIAIVGPSGAGKTTLFQLLLRFYDPQQGAIRLDGVDIKFLSLQTLRGAIGIVPQDTIIFSENALENIRFGRADAGDEEVIAAAKMAAAHEFIEPQGYQSFLGERGVRLSGGQRQRIAIARALLKNPPLLLLDEATSALDAESERLVQTALEAAMIGRTTLVIAHRLATVQRADRIIVLEHGRIVETGTHASLIAQNGLYASLA... 627
216 0.000e+00gi|951507283|ref|WP_057873290.1| thiol reductant ABC exporter subunit CydC [Lactobacillus rennini]  clstr ali  28  3.KPLKWVKPYMTKYKGLLTLILVLGLATFICGGALMFTSGYLISKSATRPENILLIY---VPVVLTRAFGIARPVFRYVERLTSHNWVLKVTSDLRKRLYQTLARDASFFQQHFKTGDILGILADDLGHLQNLYLRTIFPTLVSWLLYVVIVIAIGYFSWFFALGIALLLFVIVVLMPLVSVAVQGARTQRQKQLQHDLYTDMTDDVLGLSDWVISGRQTDFEKRPQPTLKAARQNTLAIRRFEWWRDFLIQFIFGLVVLVIIVWTNQQFTANQSMANWIGAFVLCLFPLVDAFAPVSQGVQEWPLYRTSVERLNAL---KPVQRDLPQQQTLAAPVAIDFNAVDFRYTAEQALLLKQFSLHIHAGEKIAILGPSGAGKTTLLNLLLGELTPQAGQVSINQVPITAL-QKQRAQLIGMLDQKPFLFNTSVMNNIRLGKLNASDSAIMTALEAVELGPLMQPEGANTVVEEAGARFSGGEQQRLALARVLLQDAPITLLDEPTVGLDPITEKALLKTIFNVLQTKTVIWITHHLQGIEHADQIIFLEHGQIAMQGSPRELYRTNARFRKLYQ.. 571
217 0.000e+00gi|1011591473|ref|WP_062460850.1| ABC transporter [Rhizobium sp. Leaf306]  clstr ali  24  14LKPLSRLLPYLSRYRGMVAGATFFLVLAACTTLALPLAVRRMVDHGF-ASSDGHFINNYFVMLFVLAVLLAIASGMRYYYVIT---IGERVVADLRREVFSHVTRLSASFFDVNQSGEIVSRLTADTTQIKSAFGSAASQALRNTILCLGAMGMMVYTSPKLSALALG--AIPLIVFPLVFGRSVRRRSRAAQDMLAATSAYAAETIGATRTVQAFTGEAVATSRYSDTVENAFEAARKSIRARALLTGFGIVLIFGSIVGVLWYGAQSVLAGTMTPGTLGQFVLYSVIAASSLGTLSEVWGELSSAGGAAERLSELLDEVSAVRDPEHPKALPSPGDVAFDSVSFAYPARSAITLNALSLHVAPGETVAIVGPSGAGKSTIFSLLLRFYDPTAGSIRLDGVDLRHATLEDIRSRLAIVPQDVTIFAASIHDNIAFGVPNATREAVRAAAIAAQADEFIADNGYDTLAGERGITLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQKALDGLMRNRTTLVIAHRLATVLKADRILVLKNGRVVEEGTHQSLVAAGGLYAKLAR.. 584
218 0.000e+00gi|518800198|ref|WP_019956152.1| ABC transporter [Loktanella vestfoldensis]  clstr ali  27  20..ALQALWPFIRPYKWNLIGAGFALVFTAMAALSLPLVARLVVDNFGLDSVEISRYFVALLAVAVLLAFG---TALRYY--LVT-RLGERVVADIRKAVFNRMISMSPAFYEKIMTGEVLSRITTDTTLILSVIGSSASIALRNILIFIGGVVLMLLTSVKMSIMVL--WPIPVVLFPIMFGRRVRSLSRENQDLIAESSGDASELLTSAQTVQAFTHEDLSRAKFDEVTEQSYRSARRRILTRAFLTAIVIFMVFAAIVLFLQMGSEDVVAGEITEGGLVQFMIYTIMVGGAVAALSEVWGELQRAAGATERLIELLTIEDSVTDPAQPRQLPAPGELHFENLRFSYPSRSISALDGIDLHIAPGETVALVGPSGAGKSTIIQLVQRFYDPQEGAVKLDGIDLRDLNRAEFRKHIALVPQDPVIFADTARENIRFGRPDATDXXXXXXXXXXXXHDFLTPDGYESYVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESEYAVQRAVEDLAKTRTTLIVAHRLATVKKADRIVVFDAGRIVAQGTHDALVAQGGLYARLAR.. 586
219 0.000e+00gi|738203705|ref|WP_036159627.1| ABC transporter ATP-binding protein [Marinomonas ushuaiensis]  clstr ali  24  15.QSLFPIFTFIKPYRGTVALALFFLMFTAGVSLSLGQGVKMVIDSGFISGSVDQLTSTILILIAMISLLAFGTFFRFYLMSWLG----ERVSADIRTAVFNQIVRLHPSYFEENRSGELMSRLTTDTALLQSIIGSSFSMALRSFFMLLGGLAMLFITNLKLSMIVVICVPLVLIPM-VIFGRRVRRLASSSQDAIADIGTYAGEIIQNIKVVQSYNHETLEQAAFGQEVEKAFDVAKKRIKQRSFLFAAVILLTFAAISVMLWVGGTDVIAGKMTGGELGAFIFYAIMVAMSMATVAEVYGELQRAAGSATRLLELLDIESAITSPINPLPLPHGVAIGFHNLDFYYPSRPDAALRNINVTIEHGQTVALVGPSGAGKTTMFEMLQRFYDPQKGNITLNDISLEQLSLSELRDVMGMVPQQPVLFSTNVMRNIGYGKPQASKDEIIDAAKRANAHEFIEPEGYESFLGEQGVRLSGGQKQRIAIARAILKDPDVLLLDEATSALDAQSEAYVQEALNKLMVNRTTIIIAHRLATVIHADKIVVMDKGQIVDTGTHQSLLISSPLYQRLCE.. 589
220 0.000e+00gi|1011940779|ref|WP_062749066.1| thiol reductant ABC exporter subunit CydC [Bacillus clausii]  clstr ali  26  1.................MLATVILGILTVLASSLLTFTSGYLITRASERPETILLLY---IPIVGVRAFGISKAVTRYAERLLGHHAVLKILGDMRVALYEMLEPQALLVRSRFQTGDLLGTLADDIEHLQDVYIRTLFPTATALFICIFSISALALFDWKFACWMAFLLSFFIFVYPLLSLFLLKKRQVRLKAKRKQSYQLLTDALFGLHDWIVSGRKAAFIQKFMKTTMDSGEIEKEIVYWQQSRTFQLQLLAGFILLFVGLWAGAAAAKGEIMPTYIAAFTLVVFPILEGLIPLSEAIEKAPAYQESIQRIEEVRQFAEKKPETIAQPFTAVQPSITLKNVTYYYPDEKNPALQDISLSIPFGKKIALLGKSGAGKSTLLQLLLGVITPSAGTVEIGHISPEKY-GDDIFSGIGFLNQKPYLFATTVANNIRLGNQSAGEKEIQKVIEQVKLDHYIEPNGMNTQMEETGQRFSGGERQRIALARIILKKTPIVILDEPTVGLDPATERDLLATMFATLKDKTVIMITHHLIGIENMDHILFLDEGKIMMHGTHEQLIKTNARYRKLYH.. 552
221 0.000e+00gi|297172783|gb|ADI23748.1| ABC-type multidrug transport system, ATPase and permease components [uncultured Rhodospirillales bacterium HF4000_38H21]  clstr ali  23  20MSSLRAILPFIAPYRLQLVGALLALVTASGTVLALGNGLRMLVDQGFAEGDGTLLDRALFVLFGVTVLLAGASYVRFYLVSWIG----ERVVADIRSAVYRHIIRLDQGFFEVTRTGEVLSRLTTDTTLLQAVIGSSVSIALRNILMFIGGLSMLAITSPKLTAXXXXXXXXXXXXI-IGYGRRVRRLSRESQDRVADVSAFSEETLNALRTVQAYTHEEIESARFGGFVEGAFKTAVARISARALLTAIVIVMVFGAVGTILWIGGHDVLDGTISAGELSAFVFYAVVVAGSVGAISEVIGDLQRAAGAAERLVALLATKPSIDAPENPIALPVPHQVSFDNVTFHYPARPDSALEGFSLKVKRGETVALVGPSGAGKTTVFQLLLRFYDPDSGIICVDDVNIRDANPVEVRERIGLVAQDPVIFAANAWENIRYGRPGASDEDVRAAADAAYATEFLEPEGFDSFLGEKGVRLSGGQRQRIAIARAILRNPSVLLLDEATSALDAESEQVVQKALETIMKERTTLVIAHRLATVLHADRIAVIDDGKLVAIGTHQELLESSPLYGRLAK.. 590
222 0.000e+00gi|938252174|gb|KPP87551.1| ABC-type transport system hybrid ATPase / permease [Rhodobacteraceae bacterium HLUCCA08]  clstr ali  25  19.SALGALWPFMAPYRXXXXXXXXXXXXTAIISLLLPMAVRRVVD-SFDTGSAELLDKYFGAALIITALLAIGTAVRYYLVT----RLGERVVADIRKAVFDRMIGMSPAFFEKIMTGEVLSRITTDTTLILSVIGSSVSVALRNLLIFVGGLVLMLITSAKLTGLVLLVVPAVIVPIVLL-GRRLRVLSRENQDWIAASSGNASEALLSVQTVQAFTHEFASRGRFADVTERSFVAARQRIGVRALMTAIVIFLIFAGVVGVLWIGARDVRAEMMSVGELVQFVIYSVMVAGAVGALTEIWGELQRAAGATERLVELLHSSDAVRDPEAPETLPVRGEIAFDDVRFSYPARPQQALDGVSLTVAPGETVALVGPSGAGKTTVIQLLLRFYDPQSGAVRLDGQDLRTLSRDAFRAHMALVPQDPVIFADTARENIRFGRPDATDXXXXXXXXXXXXHDFLLPDGYDTYVGERGVMLSGGQKQRIALARAILRDAPVLLLDEATSALDAESERLVQAAVDELTKDRTTIVVAHRLATVKKADRILVFDEGRIVAQGSHDALVAEGGLYARLAR.. 587
223 0.000e+00gi|221724470|gb|ACM27626.1| multidrug ABC transporter [Agrobacterium radiobacter K84]  clstr ali  23  44.RPLGRLTPYLKRYRGMVAGALIALIAAAVTSLALPLAVRRMIDHGFDQADRGL-IDSYFVAMMLMAVVLAVASAMRYYFVIT---IGERIVSDMRREVFDHVTRLSPSFFDVNQSGEIVSRLTADTTQIKSAVGATASVALRNLILCLGAVGMMIVTSPKLSSIVLI--AIPIIVLPLVFGRSVRKRSRAAQDTLAQASAYANETIAASRTIQAFNGETTAAERYGASVEDAYQAARAAIKSRSLLTGFAITMIFGSIVAVLWVGAENVLAGTMTAGTLGQFLLYSVIAGTSLGSLSEVWGELSQAAGAADRLGELLAEVSPIAAPSDPLPLPQPGRVDFSDVHFSYPSRPRSALHGLSLSVKPGETVAIVGPSGAGKSTIFSLLLRFYDPQQGSVAIDGIDARRVSPDDLRDRIAIVPQDTTIFAASIHDNIAFGRPGASRDEVRAAAIAAQADEFILDQGYDTQVGERGITLSGGQRQRVAIARAILKNAPILLLDEATSALDAESETLVQKALDGLMETRTTLVIAHRLATVLKADRILVLDQGRIVEEGTHQSLIHHGGIYAKLAR.. 613
224 0.000e+00gi|960368905|ref|WP_058261759.1| ABC transporter [Thalassobius gelatinovorus]  clstr ali  26  20..ALSDLWPFLSPYKWMVFGAILALTLTASVSLTLPLAVRRVVDN--FNGADGALLDQYFXXXXXXXXXXXXXXXXRY--SLVTL-LGERVVADIRKAVFNRIIRMSPAFFENIMTGEVLSRITTDTTLILSVIGSSISVALRNVLIVVGGMALMLFTSAKLTGLVL--LIVPLVIVPILTGRRLRKLSRENQDWIAESSGNASEALLSVQTVQAFTNEHGAQRDFAHVTEASYVSARRRIATRAVMTVIVIFLVFAGVVGVLWIGANDVRSGTMSAGALVQFVIYSVMVAGSVAALSEVWGELQRAAGATERLVELLHAKDSVEDAAAPVPVPATGHIRFDKVSFRYPSRPDSALDAIDLDIRAGETVALVGPSGAGKTTIIQTILRFYDPQSGRIELDGTDLKDMTRGEFRKHLALVPQDPVIFATTARENIRFGRPDASDXXXXXXXXXXXXXXFILPEGYDSQVGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQAAVDELSKTRTTIIVAHRLATVKKADRIVVMEDGQIVAQGTHDELVAEGGLYARLAR.. 587
225 0.000e+00gi|502886905|ref|WP_013121881.1| thiol reductant ABC exporter subunit CydC [Thiomonas intermedia]  clstr ali  36  18..DLKRLVGLFLPYRNWMLWGALAALLTLLANVALMTASGWFIAQMALVGLVGAA-MDYFTPAAFIRGMAITRTAGRYIERLITHEATFRLLQELRVWFYRRLEPLAPARLQELRSADLSSRLISDIDALNHLYLRVLVPVGVALLGGALILGMMALYSGRVAASTLLFLLLAGVAVPLLTFRLGHGPGRRLVTLRAELRSAAVDGLQGLGELRVYGGAARQAQRIDALTDAMIGQQRQLSRATGLSQGLLGLSANLAMWCALLLAVPLVTDASITPAELPMLALFVLSSFEAVLPLPLALQMLGETLAAARRVFGILDARPQVEEPADPVPQWERADVEIDGLRLRYPGEAAWALDGLSLHLRAGERVALVGPSGAGKSTLVQALLRFWDYQEGSVRIGGHDLRAWPGEALRAHIAVVSQDTYLFNTTIRDNLMLAKPEATEDEVIAACKAAQLHDFIAPEGYETWVGEAGMRLSGGQARRVAIARALLRNAPLLILDEPTEGLDALTERDLLRDLVQLMQGRTVLLISHRIAALAAVDRVLVMEAGRVVEAGAPAELLAQGGAFRALHDAL 595
226 0.000e+00gi|491973399|ref|WP_005699856.1| amino acid ABC transporter ATP-binding protein [Haemophilus parainfluenzae]  clstr ali  49  1MRALLPFLRLFKFAKLPLFLGLVLMITGLASSIGLLTTSGWFLAATAIAGLGTL--FNFFYPSASVRGLAISRTLFRYFEKLVTHDATFRILAKLRVQVFEKIIPLSPAVLNRYRNSDLLNRLVSDVDTLDSLYLRLIAPFITAIFVILAMCIGLSFVNVPXXXXXXXXXXXXXXXIPTVFYQLGKKFGDKLVHSRALYRTQFLEFIQAQAELLLFNAEDKLKNNMAKTEANWQADQQKEANLSGFSTALSLFLNGLIIAAMLWFSSQAFGNDEYRMAFIALFTFAALASFEILMPLGSAFLHIGQVIASAERVTDIIEQRPLVTFNDQNATILATILIEAKDLSFTYPERQNRALENLNLTIQKGKKIAILGKTGSGKSTLLQLLVRNYDANQGELFLAGKPIADYAEDTLRSQFCFLTQRVHVFSDTLRQNLQFASANISDEKMIEVLNQVGLGKLLEEQGLDIWLGDGGRPLSGGEQRRLGLARILLNDAPILLLDEPTEGLDRETERQILRLILAHSENKTLIMVTHRLTAIEQFDELCVIDEAKLIEKGTYTELLQEKGFFKQLVERV 580
227 0.000e+00gi|40063615|gb|AAR38404.1| ABC transporter, ATP-binding/permease protein [uncultured marine bacterium 582]  clstr ali  24  22..ALAALWPFVRPYRVMMGFAIVALVATATVSLVLPLAVRKVVDN-FNADESNLLDQYFAMAIVVVALLAFG-TGMRYA--LVT-RLGERVVTDIRKAVFGRVINMSPAFYDNILTGEVLSRITTDTTLILSVIGASVSIALRNMLIFAGGLTMLLLTSVKLTGLLL--LIVPIVALPVLTGRRLRVLSRENQDFIAASSGNASEVLSALQTVQAFTHETASRQTFDRVTEKSFEVAAQRINTRVLMTMIVIYMIFSGVVGVLWIGVHDIRSNAISAGELAQFVIYAILVAGSASALSEIWGELQRAAGATERLVELLQAQDTVTEPKNPLDLSQPGEIIFDDVHFRYPARPRLSLSQINLTINPGETVALVGPSGAGKTTIIQLILRFYDPTSGQVRLDGVNLCDLRRDVFRNVVALVPQDPVVFAASALENIRFGNPEASDEQVYAAARAAVAHEFITPDGYDSYLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESEQAVKLAVETLSSDRTTIIIAHRLATVKKADRIVVMDKGQIVDTGTHDELVAKGGLYAHLAR.. 589
228 0.000e+00gi|496216558|ref|WP_008930800.1| ABC transporter ATP-binding protein [Ectothiorhodospira sp. PHS-1]  clstr ali  26  17LRVLGRLLGFARPHTGRIIAAAVALVAGSGAVLAFGAVLRLVIDQGLTAGDAAALNQALMLLLGVVLLMATAVSVRMYLVTWIG----ERVVADLRRAVFEKVLRLDPAFFEMTRTGEVISRLTTDTSLVQVVVGSTLAIAVRNLLLFCGGMVLLFITSPKLTLGVLLGVPLITVPV-WILGRHVRRLSRQSQDRVADIGAYVDETLYGIRTVQAFCHETVDMLRYGRQVEQAFDTAIRRTRFSALLSGMVMLLVFSSISLVLWVGGHDVLAGRMSNGQLAAFVFYAVLVAGAVGAISEVIGELFRATGAAERLIELLDTEPAITPPTRPRTLPAPPEVQLEQVVFRYPSRPPPALDGITLTLEPGEKVALVGPSGAGKSTVLQLLLRFYDPESGRIRFDGVDIRETDPGQLRRRMALVPQDAVIFGADAWENIAFGMDGVSREQIRQAADAAHASEFLDPEGFSSHLGERGVRLSGGQRQRIAIARAILRDPALLLLDEATSALDAESERLVQEALEHLMEGRTTLIIAHRLATVRKADRIVVMDQGRIAAVGTHDELVAQGGLYARLA... 586
229 0.000e+00gi|849134372|ref|WP_047995957.1| ABC transporter [Puniceibacterium sp. IMCC21224]  clstr ali  25  23...LAQLWPFLAPYRSMLVAALVALSLTACVSLILPLAVRRVVDN-FEIG-SGALLNQYFGAALGIAALLAVGTALRYA--LVT-RLGERVVADIRKAVFDRVIGLSPVFYEKLMTGEVLSRITTDTTLILSVIGSSISIALRNVLIFAGGLVLMLFTSWKLTLMVL--LIVPAVVVPILTGRKLRVLSRENQDWIAASSGNASEALSSVQTVQAFTHEALNRAAFAEVTEKSYDAARRRIWTRALMTAIVIFLVFTGVVGVLWIGAWDVRAGDMTPGALVQFVIYAVMVAGSVAALSEVFGELQRAAGATERLVELLQTEDAVQDPEIPEVLSAPGEIVFDHVRFSYPSRPGSALDDVCLTVKPGETVALVGPSGAGKTTIIQLVQRFYDPDSGAVRMDGVALRDMERSEFRRHIALVPQDPVIFAASARENIRFGRPEASXXXXXXXXXXXXXXXXXXPEGYDSYLGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAESERAVQQAVDRLAETRTTIIVAHRLATVKKADRIIVMDQGRIVAQGAHDALVAEDGLYARLAR.. 589
230 0.000e+00gi|947825273|ref|WP_056486601.1| ABC transporter [Sphingomonas sp. Leaf208]  clstr ali  28  16..DLAMVWRHASRYPRQIAFAGLALMMTSAATIGIPYGFKRVIDRGFGAGASVASSFHYLLMIVIVLAFA--TAVRFYYVSWLG----ERVVADIRTNVQRHLLSLTPRFFEENRPSEIASRLTSDTALIEQVVGSTVSMALRNTFTGIGGLIYLFAISPKLAGMLMIGIPLIILPI-AILGKRVRNYSRTSQDRVADVGSIATETLGAMKVVQAFGQEDREARRFADAVGATFAAARARILLRALMTAIVIGLVFGSITLVLWEGAIDVAAGRISGGAIAAFVLTGGIVAGAFGALTEVYGDLLRGAGAAGRLSELLRERPEIAAPANPIALPQPGALAFEGVQFHYPTRRDAALNGFSLDVKPGETVAVVGPSGAGKTTLFQLVQRFYDPDAGRVTLDGIDLRDADPAEVRARIAMVPQETIIFGASARDNLRYGDWSATDDQLWXXXXXXXXXXFLRPEGLDTFLGEGGARLSGGQRQRVTIARALLRDAPILLLDEATSALDAESERLVQEALERLMTNRTTLVIAHRLATVRAAERIIVMSDGQIVEEGSHGSLMTNSGLYARLA... 583
231 0.000e+00gi|888994321|ref|WP_048811489.1| ABC transporter [Methylobacillus flagellatus]  clstr ali  26  6.RPLRLFWPLLRPYRWQILLAFCLLSLASAILLLVPWAFRDLIDQGFGTGTAAAQINRHFVFICGLVIVWALIVACRYY--IVS-WIGERVTADLRSLVYERVLTQSPQFFETLQTGEVLSRLTADTTLIQTVVGSSISLGLRSLFQFIGGMIMLAVTSWYLFSLNLGLMLLLTLPI-MLIGRSVKTLSRESQDRIADSSAMAGEILNAMPTVQSFTQEPREQQRFRHSVETSFKAAVRRIRVRAFLAAFVIAGISAAIIFVLWLGAHQVTQGELSGGELASFILYAALVAGSVSTIAEVWGDIMRAAGAAERLLELLNSKPAIRDPSTPVLPSSTASIKFDNVSFYYPAKPQPALDHISLEINAGETVALVGPSGAGKTTLFQLLLRFYDIFEGSISINGLDIRNLSLDTLRGMIAIVPQDPVIFSANALENIRYGRPDASDEEIKHAAQAAQAHAFIEPQGYDTFLGERGTRLSGGQRQRIAIARAMLKNAPILLLDEATSALDAESETLVQQGLASAMHGRTTLVIAHRLATIQNADRVVVLEHGRIVETGTPNELRRQSGLYSRLAK.. 583
232 0.000e+00gi|754993203|ref|WP_042347737.1| amino acid ABC transporter ATP-binding protein [Bacillus massiliogorillae]  clstr ali  28  15.SWVKPYLQ---QNKKXXXXXXXXXXXTFFCASALMFTSGYLISKSATRPENILLVY---VPIVLVRTFGIARPVFRYLERLTSHNLVLKFLSRMRVRLYQKLEVQALSLKSRFSTGDLLGVLADDLEQMQNLYLKTIFPSVIAVILYVLAVIALGFFSIPFALLMALFLFVLVVLFPLVSLLVIRQKQTQTKQARNELYKRLGDAVMGISDWKISGRQEDFLKSYEQQENKQDQLEAEMERFNRGRNFLFQIVVTIIIIVMIWFASNSADANIFDHVWIAAFVLVVFPIIEAFAPIPDAISQLPSYENSLHRMNNIEHKPSIQQQTVDELMMQESLTIELKDVSFAY--DEELVLNDFSLHVYQGEQIALLGKSGAGKSTIVKLLLNAVSPTSGTVTINKASVEKLH-DEINKFIAVLQQKPHLFDTTVMNNIRLGNPKASDEDVIEAAKQVQMHDYISPEGYHTRMRELGGRFSGGERQRIALARILLQQTPIVILDEPTVGLDAVTERELIETIFRNLQGKTLIWITHHLAGVERMNQIVFMEDGRVQMKGTHEELLQTNERYANLYQ.. 581
233 0.000e+00gi|917322369|ref|WP_051929081.1| ABC transporter [Thermopetrobacter sp. TC1]  clstr ali  27  39LKPLKRLLPYLMRHRGHVAMALVALIAAALATLAVPLAVRRVIDHGFSA-ENVQFVNQYFAMMLVVA--GILAAASAARYYYVT-WLGEKVVADLRTDVFAHLLKLSPAFYEKTHTGEVLSRLTADTTQIKSAFGTTASQALRNLLLLVGSVVMMVVTSPKLSGLTL--LAIPLIILPLVIYRKVRSLSRQAQDTLAQTASLAQEALPAVAVVQAYRQEDRLIRRFAEATRIAFRAAVQRTRARAFLTAAIIFIAFGAIVAVLWLGAQDVLAGRLTGGELGQFVLYAAFAAGSLGSLSEVWGEVQLTAGAAERLAEILDTKPQITAPARPEPLPEPGEVRFDNVTFTYPTRPHKALDGVSLSVKPGERVAIVGPSGAGKSTIFSLLLRFYDPDSGAVMIDGVDIRKADPKQVRARTALVPQETVIFTGTILENIRFGNPEASDEEVLAAARAARVDEFAEPDGLNTMLGERGVNLSGGQRQRIAIARAILANAPILLLDEATSALDAESEQHVQAALETLMEGRTTLAIAHRLATVREADRIIVMDNGRIVDEGTHEELVAKGGLYARLAR.. 609
234 0.000e+00gi|738758328|ref|WP_036651829.1| amino acid ABC transporter ATP-binding protein [Paenibacillus wynnii]  clstr ali  29  1MKREGWFAPYISPYFWRFVLIIVLGALTVFSASSLMYTSGFLISKASTPIENILMIY---VPIVGVRTFGTSRAVIHYVERLVGHDTILRILSKMRIRLYNILEPQALFLSSRFRTGDILGMLADDIEYLQNVYLRTVFPSVIALLLYAAVVISLGTFDIAFALLMALYILVLVVVLPLISLLFTQKRQREVKQERNSLYQKLTDAVLGMGDWVISGRQAQFVDTYEADEKRVARTDAALRGWARLRMFIGQAIVGVGVVSLLFWAAGQYASGAIVGTLIAAFVLVVFPVADAFLPVSEAVEKIPQYRNSLERLAGVEADEELTLDNATAAAMDQSVHIQLKNAGYRYGESEEWSIRDLNLDIPQGKKIAIIGRSGAGKSTLLKVIQGVIKPSMGSTVINGMDAAAY-GERIPSIISVLNQSPHLFDTTVANNIRLGDPDASDEAIKKAGALAKLDTLISPEGYNTPVREAGQRFSGGERQRIALARILLQNTPVVVLDEPTVGLDPRTERELLATIFEAMAEKTLVWVTHHLVGAEQMDEVIFMENGSVEMRGTHAELMEREPRYRRLYE.. 578
235 0.000e+00gi|940691433|ref|WP_055024864.1| cysteine/glutathione ABC transporter ATP-binding protein/permease CydC [Shewanella sp. P1-14-1]  clstr ali  44  1MKSLLPFIKLFKRQWFMMLIGLFLTCTTIIAGIGLLSLSGWFLSATAIAGLTAATAFNFFTPAGGVRFLSIARTASRYGERLATHEASFKLLTELRVWSWKKLFPLSASNLQGLRQGDMLNRLVADIDTLDHLYLRLLVPMSASLLTVGALYAFIAWFDAALAISLTVWLLAAWLILPLVFYRLGRKPGEAVVDNKRRFRVLVLDVIQGQAELTLFSANARYREKLHQAELALFNSQAAMAHITGLSQALLIMVNGAAVVMMMYLAGQGVGESVPPGPLMAMMVFATMATIEMMMPIAGAFQHLSGCVLAAKRISEVTEQTADIRFGDVDQLPQS--ELILNDIQFGYQVNS-PVLSALNLHIPQGSKVALLGATGCGKSSLLSLITREWQPQQGQISLGGLDIAEYDEATLRASMTVVSQRIHLFAGTVRDNLSIALPHANDERLTEVLKQVGLETLLTSKGLDSWIGEGGRQLSGGEQRRIGVARALLRDAPILLLDEPTEGLDKRTEREILRLLFALAKGKTMLMISHRLTAMAEMDCIHMMENGKIKASGRHQQLMSDNTDYQRLYQHL 588
236 0.000e+00gi|499766086|ref|WP_011446820.1| ABC transporter ATP-binding protein [Novosphingobium aromaticivorans]  clstr ali  27  26..PLRMIWGEAAKYPGRVAAASAALIVTSAATLAIPSGFRLIIDKGFAAGADVSAIGRWFYLLLIVLVLAIGTACRFYFVSWLG----ERVVADIRLKVQANLLRLPPSFFETNSPKEISSRMTSDTAVIEQVVGTTVSVALRNTITAIGGLGYLFYLAPKLTAILMIGIPLVVGPI-VFFGRRVRNVSRSSQDRVAVIGVIVSEVLGAMKIVQAFGQEKRELERFGEKVEATFQTALRRISLRAVMTAIVILLVFGGITMLVWQGAVGVAEGRISGGTIFAIVITAGLVAGALGALSEVYGDLLRGAGAAGRLNELLREQPEIAPPARPTALPIPGQIAFQNVSFRYPSRPELALDDFSLTVEPGETVAIVGPSGAGKSTLFLLAQRFYDPHGGTIRIDGVPLTSADPAEIRQRSALVPQDATLFAASARDNLRYGNWGASDEAIWEAARAANAEQFLRPQGLDTFLGEDGARLSGGQRQRIAIARAVLREAPILLLDEATSALDAESERLVQEALDRLMKERTTLVIAHRLATIRAADRIVVMDAGRIVEQGTHSSLTAADGLYARLAR.. 595
237 0.000e+00gi|506397331|ref|WP_015917050.1| ABC transporter [Agrobacterium vitis]  clstr ali  24  23LKPLARLNPYLMRYRGMXXXXXXXXXXXXXTTLALPLAVRRMIDHG-MASADAGFINKYFAMLIVLALIMAASSALRYYYVIT---IGERIVSDIRREVFDHVSRLSPAFFDVNQSGEIVSRLTADATQIKSAVGASASVALRNIIMCFGAMGMMIYTSPKLSVMVLA--AIPVIVFPLIFGRSVRRRSRLAQDRLAEAAAFAGESIGAARTVQAFNGEAAASARYGAAVEQAFQAARIATRSRAILTGVAITLVFGSIVGVLWYGAQSVLAGTLSAGTLGQFLLYSVIAASSLGQLSEVWGELMQAGGAAERLTELLAEVSAVQSPDHPKPLPTPGEVWFENVEFSYPSRPRSAVKGLSFAVDAGETVAIVGPSGAGKSTIFSLILRFYDPTSGRICLDGSDLRDVSTEALRGSIAIVPQDVTIFSGTIHDNIAFSCPDASREAVIKAARAAQATEFIDERGYDTEVGERGITLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQKALDELMKSRTTIVIAHRLATVLKADRILVIDDGKVVEQGTHQSLIQQGGIYARLAR.. 593
238 0.000e+00gi|639456729|ref|WP_024634578.1| thiol reductant ABC exporter subunit CydC [Paenibacillus sp. MAEPY1]  clstr ali  31  1MSELTILSKAMLGERKDILLSILGGLIAGIAGVALFSASGYMISQTVFAPP----LYTLIVLTSLVKLLGFLRAASRYAERLYSHRATFSMLSRLRTSFFAKLIPLAPGVLNKKRSGDLLARIVGDVESLQNYFLRVAYPPVIVVMVFLATMLFTASFSIWIACLFVLGMLATALIVPGIVLLGQRKTQGRVRKQRAQLSTEVTEVLYGFRDLKVYGQMAQGEQKLQHISAALAAEQQRAAGNLLRGQSIHAFVTFLISWGVLALGGYLIMDGALAGVFLAMLVMASLTVFEEAAAMATLPVYKQDSEHAAKRLTEVASATLSSQQPIGKVSTDHPASIELSGVTFQYEGEWRPALKEISLHFPAGSKTAIVGPSGSGKSTLIDLILKLRTPMAGDIRLNDVSMDELNETSLWEMANVVLQQNHFFRGTIRDNLLLSRGDHTDKHLLDVLAKVQLSRI----SLTDLVLEKGENLSEGEKQRIALARALLRQGRVWLLDEPTSSLDYVTEQRVMTHLYEQAAGDTLLLICHRLTGLEQMDRIVVMEQGRIVETGSYAELMMQQGYFYEMKQ.. 565
239 0.000e+00gi|936197367|ref|WP_054531509.1| ABC transporter [Erythrobacter sp. SG61-1L]  clstr ali  29  19..PLGMIWQAAMRYPGQVALSLLALTVTAAATLAIPMGFRQVIDQGFAQPAGIARWFRYLYLLVFV--LAIGTGCRFYFVSWLG----ERVVADIRKAVQSNLLRLSPGFFEENSPKEISSRMTADTSQIELVVGTTVSVALRNLITVIGGIVVLLFLAPQLTLMXXXXXXXXXXXX-XWFGRRLRKISRESQDRVADVGAMTTEVLGAMKIVQGFNQEGREAGRFAAIVELTFDTARRRILLRSLMTAIIILFIFGSITALMWRGAMQVAEGALSGGTIAAFVLTGALVAGAFGSLTEVYGDLLRGAGAASRLNELLKEKPAIAPPARPLELPVPGSLAFQGVTFRYPTRPEAAVQDFDLTIEPGETVAIVGPSGAGKSSLFQLAERFYDPQAGTIRLDGVPLTSVDPAEVRRRMALVPQEGTLFAANARDNLRYGAWDASDEAIWEAARAANAEEFLTPQGLDTYLGEGGARLSGGQRQRVAIARALLRDAPILLLDEATSALDAESERLVQQALERLMEHRTTLVIAHRLATVRAADRIVVMDGGRIVEQGTHSELTAAGGLYARLA... 587
240 0.000e+00gi|493757483|ref|WP_006706295.1| thiol reductant ABC exporter subunit CydC [Candidatus Regiella insecticola]  clstr ali  60  1MSALLPFLALYRRHWFWISLGIVLATLTLLASIGLLTLSGWLLAGTALAGSAGLYSFNYLLPAAGIRAAAMIRTVGRYAERVVNHDATFRVLADLRVFTFKKILQLSPASTNRFQQSDLLNRLVADVDTLDHLYLRVIAPFIAALVVILVVTYGLTWLDVTLAFTXXXXXXXXXXXXPMVFYRAGKPIGEALTHLRSRYRCQLTRCLQGQAELLVFGAFGRFRTKLEKIEQRWLAQQQQQASLVAIAQSLMIFASGLTVTLLLWLVAENMTGNNQSAELIALLVFTTIAAFEALSPVATAFQYLGQVITSARRVLELITKQSSVVFPHRVTAVAENIELEIKQVSFTYPNQPLPVLQNISLSIAAGEHIAIVGRTGCGKSTLLQLLTRAWDVTQGDIFINQQPLANFNEKTLRQMMVVVSQRIHIFSDTLRANLLLASPLATDNSLETVLNQVGLQNLLENEGLNAWLGEGGRSLSGGEQRRLGVARALLHPAPLLLLDEPTEGLDATTEQQILSLLRQHGQHKSMILITHRLYGLDTMDRICVMDAGRIVEQGDHRQLMNKKGRYYQLGQ.. 577
241 0.000e+00gi|913004991|ref|WP_050350091.1| amino acid ABC transporter ATP-binding protein [Virgibacillus pantothenticus]  clstr ali  28  1MRT--WIIPYVKMHYKGLLASILIGLLALACGAALMFTSGYLISKSALRPENILMVY---IPVVSVRAFGIFRAVFHYLSRLTSHNTILRILANMRSRLYQTLEPQAAFIQSRFQTGRILGVLSDDIDHLQDLFIRTILPSATALGMYGIVIAYLGWFDIVFALLMAVYLFFIVVFIPILSLWSSRKRTALIKNGRYDQYHILTDGLLGIKDWMIAGKPNDFMKQDTMKDQSVAIVERRIKSQQRFRDFANQLIIGAMVISMVYWSSTMVAEGNMHVTLIAAFVLVTLAIAEAFLPVSEALEQVPEYTESISRLEALEETKATSQQNVSLSAVPRSVDILLDHVAFQYHGFDKQVLKDVSIAIPQGKRLALLGKSGAGKSSIVQLICGSYAPTKGTVTLNGTDVTAY-GDALFEMVSILNQQPHLFNTTIANNLRLGNQQATDQNIVEAAKKVQLHDYIKPKGYNTMMEESGQIFSGGQQQRVALARILLKGTPVVILDEPTVGLDPKTEADLLKTIFSTLKDKTVIWITHHLSGIKHMDEIIFLEDGYIEMQGSHQELLTTSQRYQDLY... 569
242 0.000e+00gi|495403419|ref|WP_008128118.1| ABC transporter [Phyllobacterium sp. YR531]  clstr ali  25  18LKPLSRIFPYMSRYKGMLAGALVSLILAAVTTLTLPLAVRRMIDHGFT-GANGAFIDNYFGMXXXXXXXXXXXXXGRYYFVIT---LGERIISDLRRDVFAHLTKLSPAFFDGTQSGEIVSRLTADTTQIKSAVGATASIALRNLILALGAIFMMVITSLKLSSLVIAAIPVIIIPL-VAFGRSVRRRSRRAQDTLADATAYASESIVSVRTLQAFTNEKLATSRFGGAVEDAFLAARASVKARAFLTAFAIFMIFSSVVAVLWFGSRDVLSGVMTPGTLGQFLLYSVFAAGALGALSEVWGELSQASGAAERLTEILNEEPAIAAPANPVALPQPGSVDFDQVQFNYPARPDPALRGLNFTVNPGETVAIVGPSGAGKSTVFSLLLRYYDPASGSINVDGIDIRNVDPADLRARIAIVPQDTTIFAATVSENIGFGRPGASNADIEAAAKAALAHDFISDQGYETQVGERGVTLSGGQRQRVAIARAILRNAPILLLDEATSALDAESEMLVQKALDHLMEGRTTLVIAHRLATVLKADRILVMENGRIVEEGTHQVLVKKNGIYAHLAK.. 588
243 0.000e+00gi|670487113|ref|WP_031435365.1| ABC transporter [Methylomarinum vadi]  clstr ali  23  21......LWPFIRPYRLRIVSAFLLLCLGSATILLVPLAFRDLIDFGFGQRQNAGGGNGHFAALFGLACLWALAVSARYYVSWIG----ERVTADLRSAVYGRVLTQSPQFFETLQTGEVLSRLTGDTTLIQTVIGSSISMGLRSLFQFIGGMIMLAVTSFHLFSLNLGLMALLVLPI-LVIGRRVKKLSRESQDKIADASALAGEILNAVPTVQAYTQEQREIERFAGRAEVSFLTAIKRTRVRAMLTALIITAVMGTIIFVLWIGANLVNEGQMTGGQLASFVLYALLVAGGVGTMAEVWGDVMRAAGAAGRLLELLRATPTIAESPHPQALPRSGEIGFEQVTFRYPAQQAAALDDITVQIRPGESVALVGPSGAGKTTLFQLLLRFYDVTNGRICFNGEDIRRLSLRELRDNIAIVAQEPVIFSANALENIRYGRPSASDEEVLAAAKAAQVEEFVEPDGYRTFLGERGTRLSGGQRQRLAIARAILKNAPLLLLDEATSALDAESEILVQQGLNAAMRGRTTLIIAHRLATVKQVDRIIVLNQGRIVETGSPEDLRKQSGLYARLA... 592
244 0.000e+00gi|972373779|ref|WP_059027322.1| cysteine/glutathione ABC transporter ATP-binding protein/permease CydC [Type-B symbiont of Plautia stali]  clstr ali  59  1MSALRPFLRLFRRHPWRLLLGVLLAIVTLLANIGLLALSGWFLAASSLAGLAGL--YSFMLPAAGVHGAAIARTGARYFERLVSHDATFRVLQHLRVFTFSRLITLAPGQLAAFRQGDLLNRFVGDVDTLDHLYLRVIAPLAGAFAVIVMVTLGISLVDMRLALVLGGVMLATLVTMPPLFYRLGAPAGRAIALQRNEWRLRLTQWLSGQAELTLYGLSTPWRQQLNSDERRWQAAQYQQQRXXXXX-XXXXXXXGVTVTLLLWMSAGGLAHNTSHGALIALIVFCALAAFEALVPVAGAFLPLAQVVAAAERVNGIINQTPALAFPDASTLAAGSLAVAIDQVTFHYPQRSDAVLQAFSLHVRAGERVALLGPTGCGKSTLLALLARAWDAEAGSIELQNVALREWDEASLRQRISVVTQRVHLFNQTLRDNLRIAHPDASDARLSDVLRQTGLARLLEEEGLNVWLGEGGRPLSGGELRRLAIARALLHDGDLWLLDEPTEGLDGATERHILARLLQATAGKTLIMVTHRLTGLDALDRICMMENGQIVEQGAHHELISKAGRYWHFQQR. 570
245 0.000e+00gi|654939621|ref|WP_028389816.1| thiol reductant ABC exporter subunit CydC [Bacillus cihuensis]  clstr ali  30  1MRDLFQVIRLVTMEMKDILYTILFGFLSGIVAISLFAASGYLISKAALVPPLYTLTVLLALLKLC----SIARTLSRYAERFFSHRATFSILGNVRVSFFEKLEPLASGIFQKYRSGDLLSRIVGDVESLQNFFLRVFYPPIVFVLVFLSTIFFTSFYSVYVALTLLAGMILTGFIIPILFAIRQRDIEQGIQSERGELSTEVTEFFYGFRDLKIYQKLEEKERRLLQLSNLYIREQERKEGLTNFSQTLNTLVANCVSWAIVTLGAYQVVTGKLDGLYLAMLVMISLNVFEYSIPMAAFPVHFEDSRRAATRLFSVVEKNPPLKDSGMCNLGQGAIAIDIDKVSFSFSDHTRLVLNQVSLTLSAGSKTAIVGPSGSGKSTLLQLVMKMQNTDEGRILLNGTSIDMIEEESIWKSMNVILQENHFFYGTIKENLLLAKENATDDELKEVLVKVELDGY----SLDQPVFEKGENLSGGEKQKLAIARTLLKRSRLWLLDEPTSSMDALTEQNVYRHLFKQAKNDTIVLISHRLTGLEQMDQIIVMDQGMVVESGSFTELMERRGYFYGMKQ.. 566
246 0.000e+00gi|516480079|ref|WP_017868523.1| amino acid ABC transporter ATP-binding protein [Lactobacillus pobuzihii]  clstr ali  26  12.....WIKPFLSKYAKSMILALFLGFMTFFCAGALMFNSGYLISKSASLPENILLVY---VPIVLTRAFGIGRPVFRYLERLTSHNWVLKLTSELRLKLYNVLEKDAVFFKDKHQTGDILGVLSDDIDHIQNLYLRTIFPTIVGWLLYVVIVLALGYFSCLFSLVMLLLLGVLTILMPLTAMIVNGAKQEKQKTIKNTLYSGLTDNVLGVSDWIFSQRGRDYVKQHDQEEGKLRDVNHHLANNENLRNFLVQLVVAAITVAILFWTAFQFGDHGGAANWIAAFVLVIFPLGDAFTDIPGAAQETNIYEDSLVRLNNLSDNESQSISNDQAASITAPVKFEVKNLSFRYDEQGLNVLEKLDLSISQGEKLAILGRSGSGKTTLIHLLRGDLKPVSGQILLNGVPVSGL-GENISQFIGVIHQAPYLFRTSVRNNLKIGNENASDEELWDVLDRVGLTEMVMPDRLDTQVDEAGHRFSGGERHRMALARILLQNVPVVILDEPTVSLDPVTEQDLIETFVKELSGKTLIWVTHHLQGLSLMDQVIFIEDGKLKLNGSPEQLANENSYYQKLLR.. 585
247 0.000e+00gi|90337003|gb|EAS50708.1| ATP-binding protein, ABC-type transporter [Aurantimonas manganoxydans SI85-9A1]  clstr ali  24  18LKPLARLIPYLKRYKAKVVGAIFFLSLAALTTLSLPLAVRRVIDKGFDAP-STAFIDTYFAMXXXXXXXXXXXSAGRYYFVIT---LGERVVADLRKDVFARVTRLSPGFYDKALTGEIVSRLTADTTQIKSVVGATASLALRNAILFIGAVAMMVITSPGLSLIVIAAIPVIIVPL-VAFGRSVRRRSRYAQDTLADATAYATEAIGAVRTVQAFTSETATGNRFAAAVDRAFQAARASVSARAFLTAFAIFLIFSSIIAVLWIGAQQVTEGTMSGGTLGQFLLYAVFAAGAVGQLSEVWGEIAQAAGAAERLSELLAEEPAIRSPTDPVALPRPGEVVFDRVSFAYPTRPDSTVHDLSFTVKHGETVAIVGPSGAGKSTIFSLIERFYDPDAGRVLIDGVDVRTADLEQLRSRIALVPQDVTIFAATAAENIGFGDPDASRPQVVSAARSALAEGFIEQDGYDTVIGERGITLSGGQRQRVAIARAILRDAPILLLDEATSALDAESEILVQRALEKLMEGRTTLVIAHRLATVLKADRILVLDGGQIVEEGTHASLIAKGGIYARLAR.. 588
248 0.000e+00gi|647247038|ref|WP_025697154.1| amino acid ABC transporter ATP-binding protein [Paenibacillus forsythiae]  clstr ali  29  1MKREGWFAPYVSSYFWRFLLIVLLGALTVFSASSLMYTSGFLISKASIPPENILMIY---VPIVGVRAFGTSRAVIHYVERLVGHDTILRILSQMRQRLYRILEPQALFLSSRFRTGDILGMLADDIEYLQNVYLRTVFPAVISLIIYAAAVIAIGTFDVRFALLVGLYILVLVAVLPLVSLLVTQKRQREIKQARNRLYQKLTDAVLGMSDWMISGRQGQFVETYEADEQAVARTDAALRRWARIRMFLGQSVIGLGVLSMIWWAGGEFAEGAIPGTLIAAFVLVVFPVADAFLPVSEAIEKIPQYRNSLERLAGVADTPPGL--PDAAVTSRQLAHILIRGVGYRYAKEAEWSVRDLTLDIPQGKKIAIIGRSGAGKSTLLKLIQGALAPTAGAVKINGRDAASY-GDRIPSIISVLNQRPHLFDTTVANNIRLGDPEASEEQIARAGALAKLGDLIAPAGYDTRVREAGQRFSGGERQRIALARILLQNTPVVLLDEPTVGLDPRTERELLSTIFAAMEGKTLIWVTHHLVGAERMDEVIFMENGRVEMRGTHAELLASEPRYRRLYE.. 595
249 0.000e+00gi|586910417|dbj|GAF25316.1| ABC-type transport system [Moorella thermoacetica Y72]  clstr ali  34  48.....RLLGLIAPAWQAVLGATLLGSGTIASNIGLMATAAFLIASAALHPPAG----KLMLAIVGVRFFGITRAVCRYLERYVNHSITLGILGRLRVAFYRTLEPLIPAGLPGHHSGDLLSRAVADVATLENFYLRVLNPPLVALPVAAGVFLFLAHFGRTLALAWMGAFLAAGVIFPVGVTIVGRGVMRRQGEARAALNTALVDTVQGLADILVFDHGRQQQEYIATLDRQYLHLQGRKAGLNGLANALTSLASNLSLWAVLVLAIPLVNRGQIDGVYXXXXXXXXXXXXXXXQPLPMLFPHLEGSLAAARRLFALSDARPA-GDPAGPVPHPRDFSLRVKGLRFRYGPGEPPALDGIDFDVPSGARIAIVGPSGAGKSTLVNLLLRFWDYEEGAILLGGYDLKAYPPEELRRFIGVVAQPTHLFHATIAENLLLARPDATWEEMERAAREARLHEFIQPRGYETLIGEEGFKLSGGQRQRLAIARALLKNAPILILDEATTGLDAVTEREVIDSIRHLMEGRTTLVITHRLLGLEDMDKILVLDRGRVVQQGRHAELLRQEGLYRHLWQ.. 610
250 0.000e+00gi|960426959|ref|WP_058318818.1| ABC transporter [Thalassobius mediterraneus]  clstr ali  25  20..ALRELWPFLRPYRMLAALAGLALVLTASVSLMLPLAVRRVVDNFNVQ--DGALLDRYFGAAMAIAGLLAVGTGLRYM--LVT-RLGERVVADIRKAVFDRVVGMSPAFFENIMTGEVLSRITTDTTLILSVIGSSISIALRNVLIFLGGLVLMLLTSAKLTGLVL--LIVPGVVIPLVLGRRLRVLSRENQDWIAVSSGNASEALQSVQTVQAFTNEFAVRRDFSTVTEASFDSARRRISTRALMTVIVIFLVFSGVVGVLWIGANDVRNDTMSAGALVQFVIYSVMVAGAVGALSEIWGELQRAAGATERLVELLNAEDSVADPAAPVTLPAQGRITFDNVSFRYPTRPDSALDQVNLDIAPGETVAFVGPSGAGKTTIIQTILRFYDPQQGRILLDGVDLKDVARADFRSHLALVPQDPVIFASTAMENIRFGRPDATDXXXXXXXXXXXXHDFIMPEGYASELGERGVMLSGGQKQRIAIARAILRDAPVLLLDEATSALDAASERAVQGAVDEVSQSRTTLIVAHRLATVKKADRIVVMDEGRIVAQGTHDELVAEGGLYAQLAK.. 587
251 0.000e+00JGI.Meta 7070033014 SRS047634_LANL_scaffold_63727__gene_74338 thiol reductant ABC exporter, cydC subunit [Human Supragingival plaque microbi  ali  49  1MRALLPFLSLFKHARATLVLGVFLMIGGLAASISLLTLSGWFLAA--TAIAGAGALFNYFYPSASIRGLAIGRTVARYVEKIVTHDATFRVLAKLRVQVFSRIIPLSPAVLNRYRNSDLLNRLVADVDTLDSLYLRLLAPFISATTIILMMTIGLCFISVPLALFMGITLLVLLFFIPTIFYRLGTTFGAQLTHSRSSYRMQFVEFIQAQAELLLFNAEKQLKTRLNQTEQQWQDYQRQESNLSGFSTALLLFANGAMLAVVLWFGAEDFGSDTYDXXXXXXXXXXXXXCFEILLPLGAAFLHIGQVIASAERISEILDQPPQVKFAGTQSAVSSDVLIELKDVHFFYPERPNVALNDVNLSIKTGEKVAILGKTGSGKSTLLQLLVRNYDPNKGHILLANQPIEDYTEQTLREQICFLTQRVHTFSDTLRNNLQIAKTKISDERMIEVLNQVGLSKLLEQEGLELWLGEGGRPLSGGEQRRLGLARILLNDAPILLLDEPTEGLDRKTERRILHLILQHCQQKTLIMVTHRLTAIEQFDQICVIDDAKLVEQGGYSELSQKNGFFKRLIERI 578
252 0.000e+00gi|491366075|ref|WP_005223986.1| thiol reductant ABC exporter subunit CydC [Marichromatium purpuratum]  clstr ali  39  1MRELLRLWRLFRPYRAWMLLGTLAAVLTLLANVTLMAASGWFI-XXXXXXXXXXXXXNYFAPAALIRGSAMIRTAGRYGERLVNHEATFRLIASLRVWFYRHLEPLAPARLQQYHSGDILSRIRADIDALDNLYVRVLVPVVVALISVTLFVVFLALHDPXXXXXXXXXXXXXGIGLPWWAELRGRAPGQRLAEQEGALRAAVIDGVQGMAELTVYGATERQARRIEGLSEQLIADQARINSDQGLTQAAIGLCXXXXXXXXXXXXIPLVRAGELPPPELAMLALFTLASFEAVAPLPHAFQLLGRSLAAARRLFAIVDTAPAIREPDGPSPRLEQFDIVFEGVGFSYPDADRAALAEIDLRVPEGTRAAVVGATGSGKSTLFNLLLRFWSTDCGSIRVGGHDIRDIDSETLRRHIAVVSQHTHLFDTTIRENLLVARPEATQTELEQACRVAQIHDFIAPEGYDTWVGETGVRLSGGQGRRIAVARALLKDAPILLLDEPTEGLDAATERSLMAALDRLMQGRTVLLITHRPAGLDWVDQILVLDQGRERARG................... 555
253 0.000e+00gi|340741129|gb|EGR75279.1| cysteine/glutathione ABC transporter membrane/ATP-binding component [Escherichia coli O104:H4 str. LB226692]  clstr ali  98  1..........................................................................................MLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCALAAFEALAPVTGAFQHLGQVIASAVRITDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYPEQSQQALKGISLQVNAGEHIAILGRTGCGKSTLLQLLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDNLLLASPGSSDEALAESLRRVGLEKLLEDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQI