current user: public




COG4987
Query: [CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components, from COG0312

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570
# E-value Template Links and tools%idFirst MRALLPYLALYKRHKWMLSLGIVLAIVTLLASIGLLTLSGWFLSASAVAGVAGLYSFNYMLPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCALAAFEALAPVTGAFQHLGQVIASAVRISDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYPEQSQQALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDNLLLASPGSSDEALSEILRRVGLEKLLEDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLRGLSRFQQIIVMDNGQIIEQGTHAELLARQGRYYQFKQGLLast
1 0.000e+00gi|114331388|ref|YP_747610.1| ABC transporter-like protein [Nitrosomonas eutropha C91]  clstr ali  25  176..TLFRLWRFARPYKWQLFTGFMLMLGSTAAALVPPYLTMPLMDNVLIPYQNGINVDLVIFYLSGLLGAAIVAWILGWARTYVLARISERIGADLRTTTYEHLLKLSQAYFGGKRTGDLMARIGAETDRINLFLSLNLLDFATDVLMIVLTVIILVSIDPWLALITLLPLPIIAWLIHLVRDR-LRVGFEKTNRVWAEVNNVLADTLPGIRVVKAFAQEVREIERFRAVNQRNVEINDRVNKVWALFTPTVTLLTECGLLVVWIFGIWQVSQDHITVGVLTAFLAYIGRFYLRLDSMSRIVSATQKAAAGTKRIFDILDHVSSVPEPVKPVLPAIKGHIELRNVGFRYGTR--RVIQNFNFAIEPGEMIGLVGHSGSGKSTLINLICRFYDVTEGAILIDGIDIRSLPIADYRKHIGLVLQEPFLFFGTIAENIAYGKPDASRKEIITAARAAHAHEFILPYGYDSLVGERGQALSGGERQRISIARALLIDPHILILDEATSSVDTQTEQEIQGALDNLVSGRTTLAIAHRLSTLQEANRLIVLDHGKIVETGNHAELMACQGHYYHLYQ.. 746
2 0.000e+00METAHIT MH0045 GL0085432 [Complete] locus=scaffold3224_5:2003:3790:+  ali  21  19.KSLGQLASYCKSYFPAIIVAVLLAITASVFSLIGPNKLQDITDLIKDGLVTGIDIKAVEDIAFFLVVLYALGFIFNYIQGFIMATVTQKVSKSLRTGISNKINSVPLNYYNKTSIGDVLSRVTNDVDMIGQTMNQSVGTLVSAVTMFIGSLIMMLVTNWIMAITAVLAT-AIGFVLMMLIMSRSQKYFIRQQSELGKINGHIEEIYSGHNVVKVYNGVEKAEEKFESINDRLYDSAWKSQFMSGLMMPLMNFIGNFGYVCVCIVGAALFMHDHITFGVIVAFMIYIRLFTNPLSQIAQAATSLQSTAAAAERVFEFLNEEEEDESHKSAKLETAKGDVEFRNVKFGY-DPNKIIIHNFSAHAKAGQKIAIVGPTGAGKTTMVNLLMRFYELNSGEILIDGVPINKMTRQNVHDLFCMVLQDTWLFEGTIKENIVYSKEGVTDEEIVRACEAVGIDHFILPQGYDTILNDK-ANLSAGQKQLITIARAMIENAPLLILDEATSSVDTRTEIQIQEAMDKLTEGKTSFVIAHRLSTIKNADLILVMKDGDIIESGNHNELLEKGGFYAELYN.. 588
3 0.000e+00gi|337747111|ref|YP_004641273.1| hypothetical protein KNP414_02844 [Paenibacillus mucilaginosus KNP414]  clstr ali  23  42...VKRLSKYMKPYARQLVIMIVMMCVGGITKLLNPLLIAYAIDHALKE----KDGTTLLYCVLGMLGLYIIQWAANAYRIRFTNMIGQRIIYDLRHDLFSHIQQLSFRFFDKRPAGSILVRITNYVNSLQDLLTNGAVNLMIDCVQLVGIIVILLIYNVKLGAAIIVTVPIM-FLISTKLRVRIRRSWQVVSTKTSRINAHLNECIQGIKVTQAYTQEKPNMAYFELMNKDNHKAWTRASNLNQSFNPIIEVTGAIGYCILFWFGAHLIQAGEITIGVLVAFATYIGHFWEPINRLGQMYSQMLIAMASSERIFEFIDEQPNVAEPAAKDLPPIRGDIDFKGVEFEY-EPGRHALKGIDLQVKAGQSIALVGHTGSGKSTIINLLCRFYDVTSGSIKIDGTDIRDVTIQSLRSQVGIVLQDTFIFSGTIRDNIRFGRLDATDEEVEAAAKAVRAHEFILPQGYDTEVQERGNVLSMGQRQLLSFARALLADPRVLILDEATASIDTETELKIQEALKTLLAGRTSFIIAHRLSTIRHADHILVLDHGRVMEEGDHDALMKHQGIYHGLIQA. 608
4 0.000e+00gi|237666025|ref|ZP_04526013.1| ABC transporter, ATP-binding/permease protein [Clostridium butyricum E4 str. BoNT E BL5262]  clstr ali  20  1MNNFKRALTYVKPYKFQVILAIVCAFMSNIAVVVATYLNGVAIDNM--QGINSVNFNNLYRILIGLGFIYIISSLFQWFISRYANKVAYIIVRDMRRDTFESLNKQPLSYYDHHKHGDIISRFTNDLDSVSDALAVSITNVFSGIVTVVTALFCMFYLNVEITIGILVVTPV-GFIIASMISRFSQTSFVKQQQSVGEMSSFVSEIVGNQKIVKAFDRERVSMKQFEKISDNLCKTATHAMFASALINPSTRFINNISYIAVGLVGGILAITKGVSVGTISSFLIYSAQFAKPFNEISGITAQIQTAFASLTRIFNIIDEKGECPDKEAIELKNCNGNIKIANMYFSY-DKSIPLIEDFSFEAKPGETIAIVGPTGCGKTTLVNLLMRFYDIDKGAIYIDNNNVCDITRDSLRKNFGMVLQDPWLFNSTISDNISYGNSDASKEDIIKAAKKAHAHSFILKDGYDTVINEE--NLSAGQRQLLTIARVMLAEPRILILDEATSSIDTLTEMRIQKAFLTLMSGRTSFVIAHRLSTIVSADKILVMNKGKIVEQGNHKELIKKHGFYYDLYN.. 568
5 0.000e+00gi|323342555|ref|ZP_08082787.1| cyclic beta-1,2-glucan ABC superfamily ATP binding cassette transporter, ABC/membrane protein [Erysipelothrix rhusiop  clstr ali  21  1MKSYKKLWRFLKPYKLKLTGAVLCLLVAAILTAAAPMIEGFVTDISLNVAGAHIQFDVIIRIISILFVIYVTNALSRLFLQYLISDAIQSAVYDMRMEVKKKMERLPVSYFDKHSAGDLMARMSTDIEALSGALQQSFAQVVMAVLGIIFAVILMISIDFTMALVGIAIIPLSILVARFIM-KRSQILFTRQQEVLGNMFSVVQEKFTGFNEIKLYNYQENATADFRKANEELCENGFKANFFSGLMTPSVSMITYIAIALAVYMGAIRIIEGAMAVGALQAFIRYIWQVNQPLSQITQMAPTIQASIAAMDRVFEYLEEPDDVYDIENPKIDDYEGSVSFENVYFGYG--EKAVIQDLSVEIKPGEMVAIVGPTGAGKTTIINLLMRFYDVNDGSIKIDGIDIRDMKRDDLRSLFGMVLQDTWLFSGKIKENIAYGKPDATDEEIIDAAKRTNVHHFILPNGYDMVLNEESSNISNGEKQLITIARALLSDPKILILDEATSSVDTRLDAMIQEAMAELMKGRTSFVIAHRLSTIKNADKILVVKDGNIIEMGNHDDLMAKGGFYADLYN.. 579
6 0.000e+00METAHIT V1 GL0050656 [Complete] locus=scaffold52636_2:463:2187:+  ali  21  6.KTLSKLNSYIAGNRKYLILVIISALLANIFMLVAPYISGRAID--FIKGENNVDFPMVAKFIGILFAVYVLNALFTWGMTVFTNALSNHSIEKMRKDAFGKISKLPLKFFDGHSHGDIISRLTNDIDAVSEGLLQGITQLFSGIVTVVGSLVLMFLLDWRITLCVIVITIICIFVSKAIATN-SGKMFRLQAQTIGELNGYVSETVGNLKVVKAFGYEDKSSEVFGEINSRLYDCGQKAQFYSSLVNPTTRYINNLAYISVGVLGGLAALAGHLSVGIISSFLIYATQFARPINDMTSILTQLQSAQAAAARIFALGEIEPETPDEDRPELEVKNGEVMFKDVDFSY-NKDKELIKDLNIVAKPGQRVAIVGPTGAGKTTIVNLLMNFYGVDKGTIFVDGQAIDSVQRDSLRKNFGMVLQDTWLFAGTVKENIAYGKEGATEEEIINAAKAASAHGFILPSGYDTMITEDGGNLSSGQKQLLTIARAMLSDPKILILDEATSNVDTMTEQRIQKAFLKMMEGRTSFIIAHRLSTIREADLILVMDKGRIIEQGTHNELLAKNGFYTKLYN.. 573
7 0.000e+00gi|334138723|ref|ZP_08512133.1| ABC transporter, ATP-binding protein [Paenibacillus sp. HGF7]  clstr ali  21  1MKMIKRFVTYYKPYKKVLFADLIFAALASMCALAFPMLVHFMTSSAISEE--GIAAALLVKMIAVFLFLMAVEYGSGFYTDYYGHAMGAAMEADMRNDLFRHVQSLPFSFHDKTATGQLMSRATHDLFNISELAHHGPEDLVISFVRIAGSALILWLLNPVLAMTLLAILPFM-VLFAYNYSIKVKEALKRNNERIGDLNAQLEDSLAGVRVVQSFANEEIETAKFKASNELFLGSRKKGYKAEALFFNGLTSFMSLMNIAVVVAGALLISNNMLLLTELITFLLYINTITDPVKRLVNFTQNLQNGAAGFERFVEILSIKPDITDEDAVTLNRVRGKIRFENVGFRYSGDHSPVFSHLNLTVFPGETVALVGSSGVGKTTLCRLIPRFYDPCEGHVYVDDLNIKDVELKSLRSQIGIVQQDVYLFAGTVRDNIRYGKPDATEEEIIAAAKLAHAHEFILPGAYEAFVGQRGSKLSGGQKQRISIARVILRNPAILIFDEATSALDNESEKIIQHRLETLARNRTALIIAHRLSTIRNADRIVVLTEQGIAEEGTHETLMRQGGTYAKL.... 569
8 0.000e+00gi|220932731|ref|YP_002509639.1| ABC transporter-like protein [Halothermothrix orenii H 168]  clstr ali  23  1........................MLFHAGITIFFVDVFKNFIKTVITGGAGEKGLTDLAKLAIVMIVIFFVKGIVYYGQRYLVSYVSHKAIRDIRNDLYAHLQNLSLSFFNKNKTGEMISRVTNDVNRLQSAIVNGTISVFYQVVVFILGIGYLFILNPRLTMFLIIVLPAMTYLLSR-FNKKIRRVSKNVQMKIADVSDVLQETLSAIRVVKSFCREDYEFKRFSSENEANFRAKVKTAQYGAILTPSIEFLAAMAFTAILWYGGYEVLKGRMDPSELITFFLTLLYLTTPLKSLSKLSSTIQQALAAAERIFETMDIDTEKETEKTRALTEVEGKIEFKNVTFGY-NENEPVLKNINLTANPGESIALVGPSGAGKTTLVDLIPRFYDPVEGKVLLDGIDIKKINLTSLRENIGIVPQETVLFSGTVYENIAYGNLDATEEEIIRAAKAANAHDFIIKKGYHTVIGERGVGLSGGQRQRIAIARAILKNPRILIFDEATSALDAESEALVQDALNKLMKNRTTFIIAHRLSTIKNADRIVVISDGEIVDQGTHSELMAKKGLYYNLYQ.. 550
9 0.000e+00gi|319654232|ref|ZP_08008321.1| YgaD protein [Bacillus sp. 2_A_57_CT2]  clstr ali  25  1MDSIKRYLKFVKPYRLQXXXXXXXXXXKFAIPLLIPLLIKYVIDDIIGNSQSDKTSTLLMVMAVMIALFVIARPPIEYYRQYFAQWVASKILYDIRDKLFTHIQKLSFRFYANTRTGEVISRVINDVEQTKTFVVTGLMNLWLDVATILIAVVIMLNMDVTLTIVSLLLFPFYAFSVKYFFGN-LRKLTRARSQALAEVQGYLHERVQGMAVVKSFAIEDYEQTQFDAQNKNFLTKAIDHTKWNAKAFAVVNTITDISPLLVIGYSGYQVIQGEISLGVMMAFVAYIDRLYGPLRRLVNSSTTLTQSIASMDRVFELIDEKYDIDDSDAIQCRNVKGHIQFEEVSFSYNENEPPVLKKINLDVSAGETIALVGMSGGGKSSLVGLIPRFYDVNEGRILLDGTDIRSFKVRSLRDKIGMVLQDNILFSESVKTNILLGKPDANEDEVIEAAKAANAHEFIMPEGYDTKVGERGVKLSGGQKQRIAIARIFLKNPPILVLDEATSALDLESEHLIQEALEKLAKDRTTFIVAHRLSTITHADRIILIEHGEISEAGSHEELMKKQGNYYKLFQ.. 576
10 0.000e+00gi|377575804|ref|ZP_09804793.1| putative ABC transporter permease/ATP-binding protein [Mobilicoccus pelagius NBRC 104925]  clstr ali  22  66....RRLLGRLAPVRLQVAAAVVLTVLGVSLSVLGPKVLGRATDLLFAGVVGAGLPAGLARMLASMDVVYLAAAVLMWGAGRIVNDVSMVTMRRLRSDVEDKLHRLPLAYVDGQPRGELLSRVTNDIDNLGQSLQQTFGQLLNSLVTVVGILAIMLWISPTLTLIALVAIPLSAIATAVI-GKRSQKLFVRQWNRTGVFNGQIEEAFTGHELVTVFGRRKEAVADAMRTNDELFEATFGAQVVSGLMMPVMMFVGNLTYVLVAVVGGLKVASGQMSLGDVQAFIQYSRQFTQPLAQVASMANLLQSGVASAERVFELLDAPEQTPDHEHPGLPRARGRIEFEDVSFSY-DPERPLIEHLDLVAEPGQTVAIVGPTGAGKTTLVNLVMRFYELDAGRITLDGVDITDMSREQLRSQIGMVLQDTWLFKGTIRDNIAYGRPGATDEEIRAAAEATYVDRFVLPEGYDTVLDDDGGSISAGERQLITIARAFLSRPSLLILDEATSSVDTRTELLLQQAMAALRTDRTSFVIAHRLSTIRDADLILVMEEGRIVEQGTHEALLASGGAYTRL.... 668
11 0.000e+00gi|308050212|ref|YP_003913778.1| lipid A ABC exporter, fused ATPase and inner membrane subunits MsbA [Ferrimonas balearica DSM 9799]  clstr ali  23  12..TFKRLWPYVLPYKMAFIAAIIAMMVYGGVDAAMIYLVKPLIDSGLADGNAS----TFKWAPLVVVGLFMIRGLGNFVSTYCMAWVSQHVIRSMRQAVFEKYLKLPVTYFDSRSSGDLISKITYDTEQVSRASTNALISMVRDGFTVIGLLFIMFYESWQLSAIFFLVGPVVAWVITIV-SRRFRKISKNIQAAMGGVTSASEQMLKGHRNVLAFGGQEVESARFDKVNNHTRQQNMKLAAAQAISQPAIQIIGSIALAVVLFAASFPSVLDSLTPGSFVAIIGAMMGLMTPVKHLTRVNAEFQRGIAAASSVFEVLDEAEAV-DNGSVELKRVKGEVRFDNVTFRYNEESDPVLKQIDLAIPAGQTLALVGRSGSGKSTLSSLLPRFYDIASGTITIDGQDIRDVTLASLRNQIAMVSQQVILFNDTIANNIAYACDEATREQIEAAAEAAHVMDFVMPDGLDTLVGEDGVLLSGGQRQRIAIARALLRDAPILILDEATSALDTESERAIQAALETLQQGRTCLVIAHRLSTIENADQIVVMDKGAIVEKGDHNDLMNHGGIYAQLQQ.. 577
12 0.000e+00gi|373107841|ref|ZP_09522133.1| hypothetical protein HMPREF9623_01797 [Lachnospiraceae bacterium ACC2]  clstr ali  23  12.RTVKKVLRYIGRFRLYLMASLLFAFLTVVLTLLAPRLTGAVVDHMIGAGR--VDFHGVRRIMLQLVLAAAGVGIFQWCMNLCNNHLAYAVVQALRNDAFRKIERLPLSYLDAHPVGEIESRVIADADQFSDGLLMGFTQLFTGVLTILGTLLFMLSVNVWITLAVVLITPLSFLLAGYI-SKHSYILFRAQSTLRGEQTGMINEMVEGQRVVKAFHRERAVISDFDALNEKLTETSLKATFFSSLTNPTTRFVNALVYMIVGAVGALSVIGGHLTVGELTAFLSYASQYAKPFNEISGVVTELQNAIACAARLFEFIEEAEEVPDADAKAPERFDGAVGFDKVAFSYV-PEQHLIENFDFAVKPGQKIAIVGPTGCGKTTLINLLMRFYDVTGGSITLDGTDLRDLTRTSLRGGFGMVLQETWLKSGTIRENITMGNPGIREERMREVARICHIANFILPQGYDTVIAENGEGFSQGQKQLLCIARVMMSNPSMLILDEATSSIDTRTELKIQEAFNKLMERRTSFIVAHRLSTIRNADVILVMKAGHIIEKGNHEELMAAKGFYYTLYE.. 580
13 0.000e+00Oral.Meta HOMD gadi_c_9_116 Granulicatella adiacens ATCC 49175 [46802 - 45057] (REVERSE SENSE) ORF  ali  21  12.NVIKDFIHYYKPYKKLFLLDFTCAVIVAILELAFPVMVRSVIDNIV----PSQNLQQIILVGAGLLALYAFSTTLNFIVVYMGHILGINIETDMRRELFAKVQKQSFSFFDNMKIGELMSRLSSDLFDISELAHHGPEEFFIAIMTLIASFFLMYQVHPTLALLTIFFVPIIAVALA-VFNRRMSRINRNIYKGLANYTAGLENVLSGMRVVKAFANESHEQQLFEDLIQEYRSNKIAFYRTMGTSSSFNYLLMRSINLFSLIVGAYFTVIGDLTPGELVGYILLANVFVGPINKMNSMIELYPKGFAGFRRFKELMNVEIDIEDPDAIPAPAFEGRVEYKNVGFGY-EEDKKVLEHINLTVEPGQTVAFVGPSGVGKTTLVNLLPRFYDLKEGEILVDGTNINRFTLQSLRRQIGIVQQDVFLFNGTIRENVLYGRLDATDEEVDRAIEQAKLKEVILEDGVDTHIGERGVKLSGGQKQRLSIARIFLKNPSILILDEATSALDTQTEKFIQQSFDELAKGRTTFIIAHRLATIKNADRIIVVTEDGLTEDGTHEELLAKNGAYAALYKA. 579
14 0.000e+00gi|319892905|ref|YP_004149780.1| Lipid A export ATP-binding/permease MsbA [Staphylococcus pseudintermedius HKU10-03]  clstr ali  22  2...IRRYLEFVKPYRWLIVGTIIVGILKFGIPLLIPLLIKYVIDDVINNAALTVDDKLMRLMLIAAFIFVVVRPPIEFFRQYLAQWTSNKILYDIRKKLYDHLQALSSKFYANNKAGEVISRVINDVEQTKDFIMTGLMNIWLDCITIIIALSVMFFLDVQLTLAAIVVLPFYILTVYFFFGR-LRALTRERSQKLAETQGFLHERVNGMAVIKSFAIEENEAKNFDQRNTNFLNKAFKHTRWNAYSFSAINTVTDIGPLIVIGYGAYLAITGSVTVGTLAAFVSYLEQLYGPLRRLVSSFTTLTQSFASMDRVFQLFDEPYDIKNAPQAKAIPIRGQIEIENVSFKYNPEERNVLNHLNLDIQHGETVAFVGMSGGGKSTLIHLIPRFYDVTEGHIKIDGHDVKDFDTASLRRQIGMVQQDNILFSDTVKENILLGRPDASFEEVVEAAKLANAHDFIMPQGYDTEVGERGVKLSGGQKQRLSIARIFLNDPPILILDEATSALDLESEAIIQEALEKLSHDRTTIIVAHRLSTITHADKIVVIENGEIVEQGSHETLMQREGAYRRL.... 572
15 0.000e+00gi|299143274|ref|ZP_07036354.1| ABC transporter, permease/ATP-binding protein [Peptoniphilus sp. oral taxon 386 str. F0131]  clstr ali  20  4IQLIKRISPYFKKYKSILFIDLLCAAFTTASEMILPLILRY-ISSVGMKDIKLLNVELIIRLALLFLILKSIDLVAAYYMASIGHIMGAKIETDMRADVYAHLQTMSDSYYNETKIGVLMSRITNDLFDITEFAHHCPEEYFIGGIKILVSFIILLSVNLKMTIFIYLMIPIMVVFASKY-NHKMREAQKMQRVHIGDLNSSIEDSLLGIKVVKSFANEEIEAKKFNIQNAKFLGIKKKFYKAMAGFTVITKLFDGLMYLILIVSGGYFMMKGEIKPSDLIAYVMYVTSLLATVRRIVEFTEQFQKGMTGIERFYEIMDTKSEIEDENAIELKDVKGKIEFRDVTFKYEKDTENVLENFNLNINPGDNIAIVGPSGAGKTTICNLIPRFYDVSYGEILVDGENIKNVTLKSLRNNIGIVQQDVYLFSGTVMDNIRYGNPSATDDEVLRASELAGAREFILPEKFDSYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNKSEQIVQESLEKLTKGRTTLTIAHRLTTVQNADEILVMRDRKIIERGTHDELMKNQGYYFDLY... 574
16 0.000e+00gi|119025112|ref|YP_908957.1| ABC transporter permease [Bifidobacterium adolescentis ATCC 15703]  clstr ali  20  22...MKKLVKFCSRYIPVMILALVLGAAGTVCQIIGPDKLKDMTNEITKPVMNSIDMDAVSRIAWLLVALYVGYALLSYLQSWLMANVTQRTAQQLREAISQKINRLPLKYFDKVSYGDVLSRITNDVDAIGQTLGQSVGSLITSITLFFGALIMMFYNNVTMTLCAIGSA-LLGLIIMGVIMKVSQKYFTRQQVALGDVNGHVEEMYTGHTVVKAFCGEERSIEQFEKYNNDLYVSGWKSQFLSGLMMPIMNFVGNFGYVVVCVVGAALAMDGNIEFGVIVAFMMYIRLFTQPLSQFAQAFQNLQRCAAASERVFGFLEEPELSDETGKQALQPVRGDVEFSHVRFGY-DADKTIINDFSASVKAGQKVAIVGPTGAGKTTMVNLLMRFYEISGGTISIDGIDTKSVPRWNVHDQFSMVLQDTWVFRGTVRENIAYSKKDVTDEQIVAACKAVGLHHYIMPNGYDTVLDDKAS-LSQGQRQLLTIARAMVEDAPILILDEATSSVDTRTEELIQKAMDALTVGRTSFVIAHRLSTIRDADMILVMNGGDIVERGTHEELLAKGGFYADIYN.. 606
17 0.000e+00gi|378549786|ref|ZP_09825002.1| hypothetical protein CCH26_06857 [Citricoccus sp. CH26A]  clstr ali  22  65....KRLFATFGPERTGMTLXXXXXXXXXXXXXWAPAILGDAMNVIFGGPGQGIDFAELARLILIVLGMYVVAQLFMWLQGRVLNDIVMRVVYRLRQDIEAKVNRLPLSYFDTRQRGDLLSRTTNDVDNVQQAMQQAFATLVYSALTIIGIVIMMFWLSWQLALIALIALPLSGVVVG-IIGSKSQKLFTAQWKNTGRLNGHIEESFTGHELVTAFGRQQDMGARFDERNEELYEASFRAQFYSGMIMPIMQWVNYLGYVGIAVVGGLRVATGQMTLGAVTAFIQYSREFNQPLGQVAGMSNMLISGVASAERIFELLDAEEQDPDRPADLARPVLGRIEFDHVAFSY-TPEKPLITDLSLTAEPGHTIAIVGPTGAGKTTLVNLIMRFYEIDAGAIRLDGVDIRSLQRGVLRGQVGMVLQDAVLFGGTIRENIRYGRLDAMDEEVVAAARATFVDRFVLPDGYDTVIEDEGANVSAGERQLITIARAFLADPALLILDEATSSVDTRTEVLVQEAMAALRTDRTSFVIAHRLSTIRDADVILVMEHGDIVEQGSHDQLLAAGGAYHRLY... 682
18 0.000e+00gi|154502987|ref|ZP_02040047.1| hypothetical protein RUMGNA_00809 [Ruminococcus gnavus ATCC 29149]  clstr ali  23  12......ILWLIRPYLHFLMLSFVFAGISALLTLYAPILIGNAVDLII--GKGSVDFDAIGRILFRLAGIIVITSAAQWLMNLCNNHITYRVVKDVRTKAFAKLQKLPLKYVDSHAYGETISRIITDVEQFSDGLLMGFTQFFTGVVTILGTLVFMLLINVKIALVVILITPVSLFVASFI-AKRTYVFFKAQSETRAQMTSLVDEMVGNQKVVQAFGYGDRAVERFDTINKKLQKVSLQAIFFSSITNPSTRFVNGLVYTGVSIAGAFTAIGGGITVGQLSCFLSYANQYTKPFNEISSVVTELQNALACARRVFDFIEEQPEEPDAAAIELKNPDGSMTLEHVSFSY-NPEIKLLQDLNLNVKPGQKIAIVGPTGCGKTTLINLLMRFYDIQSGEIRVGNTGIQNITRDSLRANFGMVLQETWLKAGTIAENIAYGKEDATREEIIAAAKAAHAHGFIMEQGYDTLIQEEGGNLSQGQKQLLCIARVMLRIPDMLILDEATSSIDTRTEMKIQEAFQSMMRGRTSFIVAHRLSTIREADVILVMKDGNIIEQGSHEELLEKGGFYKNLYE.. 575
19 0.000e+00gi|213693279|ref|YP_002323865.1| ABC transporter [Bifidobacterium longum subsp. infantis ATCC 15697]  clstr ali  20  20.KVMGKLVNYCRNYLPVIIVALILGAIGTVCQIVGPDKLKDMTNEIVKGLPASVDFGAVGHIAWTLVALYAGYAVLGYVQSWMMANVTQRTAQRLRESISVKINRLPLKYFDKVSYGDVLSRITNDVDAIGQTLGQSLGSLITSATLFVGALVMMFYNNVIMTLCAIGAS-LIGLIIMMAIMKASQKYFARQQTALGDVNGHVEEMYAGHLIVKAYNGEADSIRRFERYNADLYESGWKSQFLSGLMMPLMNFVGNFGYVVVCVVGAALALNGQIEFGVIVAFMMYIRLFTQPLAQFAQAFQNLQRCAAAAERVFGFLEEPEMEDESGKQALLDVKGDVEFSHVQFGY-EPGKPIIHDFSASVKAGQKVAIVGPTGAGKTTMVNLLMRFYEISGGSIAIDGVDTKSVPRWNVHDQFSMVLQDTWVFRGTVRENIAYSKPGVTDKQIEDACKAVGLDHFILPDGYDTVLDDK-SSLSQGQKQLLTIARAMVQDAPILILDEATSSVDTRTEELIQKAMDALTVGRTSFVIAHRLSTIRDADMILVMTHGDVIERGTHDELLAAGGFYADLYN.. 605
20 0.000e+00gi|160943700|ref|ZP_02090931.1| hypothetical protein FAEPRAM212_01194 [Faecalibacterium prausnitzii M21/2]  clstr ali  22  17..TLNRVLHKIRPYSAFVVCSLLVAAVSVAAQLYIPILCGEAIDKML--GKGNVDLSGVLRIAVSILVVAAVAALAQWLLSVCNNRITFSVSRDLRNEALRKIQTLPLSYLDSHPSGDIVSRMVADVDTFADGLLMGFTQLFSGILTIFGTLLFMLRENVPITLVVVCITPLSLVVAG-FLAKRSYGYFQSQSTVRGKQTALVNEMIEGQKVVQAFGHEAESLAAFDEVNGQLQDVSLKAIFFSSLTNPATRFVNNIVYAGVGLVGALYAVRGGITIGQLSVFLSYANQYTKPFNEISGVVTELQNALACAARVFELLDAEDQVPEAENAAALQPDGHVQLQDVSFRYL-PDRPLIEGLSLDVQPGQRIAIVGPTGCGKTTLINLLMRFYDVNSGSIKVSGTDIRDVTRASLRGSYGMVLQDTWLRAGTVRENIAYGKPDATMDEVIAAAKAAHAHSFILPDGYDTVIAEDGGNISQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEVRIQKAFARMMQGRTSFIVAHRLSTIREADVILVMKDGHIVEQGNHDQLLAQGGFYAKLYN.. 583
21 0.000e+00gi|266621116|ref|ZP_06114051.1| ABC transporter, permease/ATP-binding protein [Clostridium hathewayi DSM 13479]  clstr ali  21  29..TILRLGRYMIQYKWLLLLAFVMTVGSNLLALVGPMLSGYAIDA-IEPGIGKVDFSRVFHYAGWMAAFYVISSVLSYALSVLMITISRKVVYRMRKDVFDKMLALPAGYYDLHQTGDIISRISYDIDTVNESLSSDLIQILTTVITVAGALYMMVVISPRLVLVFAFTVPLSACITKFVTGR-TRPLFRARSASLGNLNGFVEEMVTGQKTLRAYCQEEHVIQKFAVKNKEAVETYYRAEYYGSMVGPMVNFINNLSLSLISVFGALLYLAGYMTVGRISSFVLYSRKFSGPINEAANIMSDLQSALAAAERVFALMDEIPEAADPGAIELGRGEEEVRLSHVDFGY-DRDRIILHDLSLKADPGKLIAVVGPTGAGKTTLINLLMRFYDPNSGEIRVDGHEIRGVTRKSLRKSYAMVLQDTWLFHGSIYENLAYGKEGATMEEVMAAAKAARIHSFILPDGYETILTDDGTNISKGQKQLLTIARAMLLDARMLILDEATSNVDTRTEIQIQEAMRKLMEGKTCFVIAHRLSTIRNADLILVIKQGEVVEKGNHEELMRAEGEYYQMYTA. 602
22 0.000e+00gi|334336903|ref|YP_004542055.1| xenobiotic-transporting ATPase [Isoptericola variabilis 225]  clstr ali  21  40..SLRRFARTMRPERARVALLTVCGVVSVALTVAGPRILGEATDVVFEGMLGRMLADLVAAMDGLVVGVYAGAFVFGWLQARIMTVAVQNTMRRLRDDVEAKLHRVPLAYADSQRRGEILSRVTNDIDNVAQTTTQTLAQLVTSLLTVVGVLAMMFWISWVLALVALVTVPLSILVTVQI-AKRSQPQFVAQWAATGRLNAHVEEMFTGHALVKVYGRQRDAAERFAQENDALYDSTSRAQFISGTIQPSMGFLANLNYVLVAVIGGLRVASGQLSIGDVQAFIQYSRQFTQPLTQVASMMNLLQSGVASAERVFELLDAPEQTPDPEARELDRVRGRVAFEDVSFSYVE-DAPLIEHLDLVAEPGRTVAIVGPTGAGKTTLVNLLMRFYEVDSGRITLDGVDVRELTREGLRSRVGMVLQDTWLFRGTIEENLRYGRDGASREDFLAATRATHVDQFVLPDGYDTMLDDEATSLSAGEKQLLTIARAFLADPEILVLDEATSSVDTRTEVLVQHAMNALRSGRTSFVIAHRLSTIRDADLIVVMEHGRIVEQGDHESLLAADGAYARLY... 653
23 0.000e+00gi|304404490|ref|ZP_07386151.1| ABC transporter related protein [Paenibacillus curdlanolyticus YK9]  clstr ali  23  22...MRRLLRYVLPYRRTLSFVVAVVLLNMALSLAEPLLLGYIIDEGIVKH----NYTFIHGVGAALLGFRLLGWLFGWLHTKLINFTGQRVLFDLRQQLFNHLQTLSFRFFDGRPAGKIMSRITNDTNAIGELINGGLITTVMEVTHLAGIVVILFWMDWQLALLSFATMPLLYLIVSTLRTR-IESAWSRSRRTMSAINGNVNETIQGIRVVQAFSRQSGNNEKFNDINIDNKKAFMRAIRMESTVWPLVEMVGMLGTCIVVWFGARQVMNETLTIGFVMAFINYLWRFWGPLSALSKVYSQLLSAMASAERLFEILDTEPEVKNAAASALPPIRGEVVLKEVSFRYGPDKPEVLHGINVSIKPGQRVAIVGPTGAGKSTIVNLLMRFYDATGGKVIIDGYDVKDVTLESLRSQMGIVLQDSFIFSGTIEENLRYGNEHATDEALREAARSVRIDKFVLPEGYDTQVEERGSKLSVGQRQLLAFGRVLLSDPRILILDEATSSVDTETEQHIQAALATVLEGRTAFIIAHRLSTIRDADMILVVQDGTIAESGTHAELMQTSGLYANLVQ.. 587
24 0.000e+00gi|340360568|ref|ZP_08683036.1| multidrug resistance ABC superfamily ATP binding cassette transporter, membrane protein [Actinomyces sp. oral taxon 4  clstr ali  22  61..SFIRMLSLLMPFKRSLAVAMAAAIGSVVLTVAGPKILGQATNLVFEGPGAGIDYGALGRVLLLTLAVYLGSAFLAWLEGFVLNRIMIKAMYRMRADVEAKIHRLPLSYFDHVQRGELLSRVTNDIDNVTNTLQQSLSSAVTSILTVVGVLAMMISISWRLTLVAMIVLPLMGVLFGVV-GPRSQRAFTTQWAKTGRLNARVEESFSGHALVRTYGRTADSREKFDDENDELYRAGLRAQFLSGIMMPVMRVVGNLSYVAIAVAGGLMVAGGGLRLGDVQAFIQYSQQFTQPLAQLGGMATAVQSGTASAERIFELLDAAEERPDADVADPGTGKGAIEMDHVRFSY-DPDTELISDLSLRVEPGQTVAIVGPTGAGKTTLVNLLMRFYEIDGGRISLDGVDTATMHRRDVRARTGMVLQDPWLFQGTIRENIRYGRPGATDEDVEAAAGACYVDHIVLPEGYDTVLEEDAANVSAGERQLLTIARAFIADPAVLILDEATSSVDTRTELLVQRAMAALRRGRTSFVIAHRLSTIRDADTILVMEHGDIVEQGTHAELLERDGAYARLHAA. 688
25 0.000e+00METAHIT MH0014 GL0050160 [Complete] locus=scaffold634_1:77:1846:-  ali  24  12..TLLRVLQYVKPYRVLVIVSLLCACVSAAAQLLIPILTGKAIDQMLGAGQ--VNLSGVLVFAVWIAVVAALSAVAQQFLATSNNKIAYNISRDLRNAAFHKLQLLPLSYLDAHPSGDLVSRMIADVDTFSDGLLMGFTQLFTGVVLIVGTLTIMLIKNWMIALLVVVLTPLSMFVASFI-ARKTHHYFTEQARVRGQQTALINELIEGQKVVQSFGHEAASLSDFDCINDELGRVSLNATFFSSLTNPSTRLVNNIIYAAVALVGALSAVGGGISVGDLSVFLSYASQYAKHFNEISGVVTELQNALACAARVFSLLDEDDRVPDKENAAVLSPKGTVDLKDVCFRYV-PDRPLIEGFNLHVKPGQRIAIVGPTGCGKTTMINLLMRFYDVNSGAILVDGTDIRDATRHSLRKSFGMVLQDTWLKAGTIRDNIAYGRPDASEEDVIAAAKAAHAHSFTLPDGYDTVITENGGNISQGQKQLLCIARVMLELPPMLILDEATSSIDTRTEIKIQSAFARLMNGRTSFIVAHRLSTIQEADVILVMKDGHIIEQGTHEELLKKQGFYANLYQ.. 583
26 0.000e+00gi|163791306|ref|ZP_02185720.1| hypothetical protein CAT7_08080 [Carnobacterium sp. AT7]  clstr ali  21  25..SIGKLVNYCKSYMIYIIIAFVFAIIGTVFNLIGPDRLSEITDVITEGITGEIDLERIKSIALLLVTLYVLGVILSYFQGFIMATVTQNVTKKLRTDISSKINRLPLRYFDSNNHGDILSRVTNDVDTIGQTLNQSLGQLVTAISLFTGSLIMMFYTNVPMAIAAILST-ILGFSLMIMIIKQSQKYFRQQQKSLGELNGHVEEIYTGHNIVKSFNGEEAAIKEFNVINDTLFDSAWKSQYISGLMMPLMNFIGNFGYVVVCVVGAYLAFNDQITFGVIVAFMMYIRFFTQPLSQIAQAFTSLQSAAAASERVFNFLEEEELEVETGKPTLGTVKGNVTFDHVKFGY-NPDRLIINDFSLEAKAGQKIAIVGPTGAGKTTLVNLLMRFYEVNSGEIYIDGTPISSVTREALHEQFCMVLQDTWLFEGTVRENIVYSKQGVTDEAVVNACKAVGVHHFILPHGYDTIL-DDTTSLSAGQKQLMTIARAMVADAPLLILDEATSSVDTRTEIIIQNAMDHLMNGRTSFVIAHRLSTIKNADLIIVMKDGDVVESGNHEVLLEQNGFYADLYN.. 593
27 0.000e+00gi|238917612|ref|YP_002931129.1| ATP-binding cassette subfamily B protein [Eubacterium eligens ATCC 27750]  clstr ali  23  6.STFVKLLKRIKKHSFFIILSLIMAAVTVATTLYVPILVGRGIDCII--GVDNVDFAKIVNILIRIGIFVGITALSQWLMNICNNRITYEVTRDIRNEAIEKIQVLPLKYIDGHSYGEIVSRVIADVDQFADGLLMGFTQFFTGVMTILGTLIFMITINAKITLAVVVITPLS-FLVASFIAKKTFSMFKLQSETRGEQTALIDEMIGGQKVVKAYGYEDEAVRKFDEINERLQKYSLKAIFFSSITNPSTRFVNSLVYASVAIVGAFSAINGGITVGQLSSFLSYANQYTKPFNEISGVVTELQNAIACAARIFELIEEDPEIPDKDAKVIDEVDGTVELNDVCFSYV-PDKKLIENFNLHVKKGQRIAIVGPTGCGKTTVINLLMRFYDVNSGSIDVSGTDIRQMTRKSLRQGFGMVLQETWLKSGTIRENIVMGKPDATEEEIIAAAKAAHSYGFIMSNGFDTVIGEDGGSLSQGQKQLLCITRIMLAKPPMLILDEATSSIDTRTEIKIQNAFAKLMEGRTSFIVAHRLSTIQSADVILVMKDGHIIEQGNHEELLAKNGFYHKLY... 579
28 0.000e+00gi|293376084|ref|ZP_06622335.1| ABC transporter, ATP-binding protein [Turicibacter sanguinis PC909]  clstr ali  20  24.KSVKKLLLFCQPHYLLIAFALIFSIVGTILTLIGPDKLSEVTDLITAGLMTGIDLDAVEDLCLLLVYMYGASFILSYFQGFIMNTVTQKVAKSLRTQISEKINRLPLRYFDSTSYGDILSRVTNDVDSIAQTLNQSVGNLVSAITLFFGSLFMMFITNAWMAITAILST-VIGFILMMFIMSKSQKYFIRQQRDLGLMNGHVEEIYSGHNIVKVYNDEAKAKAKFDEINEDLYESVWRSQFLSGLMMPLMSFIGNFGYVAVCIVGASLAMNEVITFGVIVAFMVYIRLFTQPLSQIAQAMTSLQQTAAASERVFEFLEEPEMQQENGKINDFTVKGEVEFKHVHFGYH-ADRTIINDFSVTTKPGQKVAIVGPTGAGKTTMVNLLMKFYEANSGEILIDGMPINQLTRHNVHDLFGMVLQDTWIFEGTIRENIVYSMKNVSDEEVEKACKAVGIHHFILPKGYETILNDK-ANLSAGQKQLITIARAMVENAPLLILDEATSSVDTRTEILIQEAMDKLMRGRTSFVIAHRLSTIKNANLILVMNHGDIIESGTHEQLMKQNGFYAELYN.. 593
29 0.000e+00METAHIT MH0086 GL0196307 [Complete] locus=scaffold31691_1:2193:3974:-  ali  23  15..TMRKVLKYVSRHGFFMVVSIILAVIVVALTLYAPILIGEAID-LLADGKGSVDFSQVTEKLLATAVVIGITSVVQWVMNAINNRIAYHVVRDIRNEAFRHIEVLPLSYIDANPTGDIVNRVIADADQFSEGLLLGFTQLFTGVATIVGTLIFMFTISWQIAIVVVVTTPLSLFVAKFIASR-TYRMFRLQTETRGQQTAFIDEMIGNQKVVQAFSHEKKSLEDFDRINDRLAEYSLKATFFSSLSNPSTRFVNSVVYAGVALCGALICISAAFTVGQLSCCLSYTNQYTKPFNEISGVITELQNALACAARLFELIEEKPQVSEPEAVTLTDVRGSVKLENVDFSYV-PDRKLIEGLNLSVNPGQRIAIVGPTGCGKTTIIILLMRFYDVDSGSVNVEGNDIRNVTRHSLRESYGMVLQETWLKSGTIRDNIVMGRPDATDEEVIAAAKASHAHSFIMPQGYDTVIGEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEIKIQDSFAKMMKGRTSFIVAHRLSTIREADVILVMKDGHIIEQGNHEQLLARNGFYANLYN.. 588
30 0.000e+00gi|269956232|ref|YP_003326021.1| ABC transporter [Xylanimonas cellulosilytica DSM 15894]  clstr ali  20  38.QSLLRFARSMRPERGRVVALMLCGVASVALAVTGPRILGHGTNIIFEGAGQGIDFDRLGRVLLGVLAIYGGAFLFGWLQARIMTVAVQNTMRRLRDEVEAKLHRVPLGYVDKQQKGEILSRVTNDIDNVAQTTTQTLAQLVTSVLTVVGVLAMMFSISWILALVALVTVPLSVWMTARI-AKRSQPQFVAQWAATGRLNAHVEEMFTGHSLVKVYGQQEAAAQKFAVENEALFAASQKAQAISGTIMPSMGFLANLNYVVVAVVGGLRVASGQLSLGDVQAFIQYSRQFTQPLTQVASMMNLLQSGVASAERVYALLDAPEQTPDPASPTVEQVRGRVAFEDVSFSY-DPAAPLIEHLDLVAEPGQTVAIVGPTGAGKTTLVNLLMRFYEVDSGRITLDGVDTRTMTRDALRSSIGMVLQDTWLFKGTIEENLRYGRRDISREDFLAATRATHVDPFVLPQGYDTVLDDDGTALSVGEKQLLTIARAFLADPEILVLDEATSSVDTRTEVLVQHAMNALRSGRTSFVIAHRLSTIRDADAIVVMEHGQIVETGDHASLLAADGAYARLYR.. 651
31 0.000e+00gi|347752514|ref|YP_004860079.1| ABC transporter-like protein [Bacillus coagulans 36D1]  clstr ali  24  1MGSVKRYMKFVKPYWFQIVATIIIGIIKFTIPLLIPLLIKYVIDDIIGNHGLSPDLHKLVWVMSFMLAIFVIRPPVEYYRQYFAQWTASKILYDIRDRFFTHLQKLSFRFYANTRGGEVISRVMNDVEQTKDFVITGLMNVWLDMTTVLIAIVMMFMMDARLTLISLAVFPFYIFSVKYFFGN-LRFLTRKRSQALAEVQGYLHERVQGMAVIKSFAIEDHEQKQFDKHNHNFLEKALAHTSWTAKSFAVVNTITDIAPLFIIFVSGYLVIKGSLTVGTLAAFIAYIDNLYSPLRRLVNSGTTLTQAFASMDRVFELLDEKYDIDDPDAVECRNVRGNIRFDGVEFRYDDEKEPVLKNINLEIRAGETVAFVGMSGGGKSSLVSLIPRFYDVTKGAVYLDGQDIRTFKVRSLRDKIGMVLQDNILFSESVKSNILLGNPQATDEEVVQAAKAANAHEFIMADGYETTVGERGVKLSGGQKQRIAIARVFLKNPPILILDEATSALDLESEHLIQEAIEKLARNRTTLIVAHRLSTITHADRIVLIENGEIKETGTHEQLMAKQGLYYNLFQ.. 576
32 0.000e+00Oral.Meta HOMD oot078_c_1_589 Oribacterium sp oral taxon 078 F0262 [201043 - 202932] ORF  ali  23  57.KTLLRVLRYIRQYRHXXXXXXXXXXXXXXMSLYIPVLIGRAVDRMV--GKGEVDFRALFGILRLMLFFIFASALSQWLMNHINNIVSYHVVEDIRTKLFSRIQCLPLSYLDSHPAGDTVSRVITDIDQFSQGLLLGFSQLFTGLLTILETLIFLFFIDIRIALLVVFLTPLS-FLAASFIAKSSYRLFRHQSELRGEITAYTNEMLGNLKVVKAFSRERESTERFSEINQKLSGYSMRATFFSSLVNPATRFINALVYALVGMTGAVFSIQGTLTVGELSAALSYATQYTKPFNDITAVITELQNALASASRVFELMDEPGILPDPDAEQLPEARGEVGISHVFFSY-DKTKTLLQDLTVRIKPGETAAIVGPTGCGKSTLINLLMRFYEVDRGSIEVDRRDIRHITRESLRNNFGMVLQETWLKSASIRDNIAYGKKDASEEEIIEAAKKAHCDSFIMEKGYDTVLGEDGGSLSQGQKQLLCIARLMLRLPPMLILDEATSSIDTRTELHIQHAFDRMMQGRTAFIVAHRLSTIRNADLILVMKEGNIIEKGRHEELLQKGGFYKKLYE.. 625
33 0.000e+00METAHIT MH0081 GL0143685 [Complete] locus=scaffold809_3:1084:2823:+  ali  23  25.................IITSIILAALTVALTLYVPILIGKAIDGIIY---GNVQFEFILKILIEVIVVVLITSIGQWIMNIINNKVTYNVVADIRKDAFTNIERLPLKYIDAHSSGDIVSRVVADVDQFADGLLMGFTQFFTGIVTILGTLLFMLSINIEITIGVVILTPISLFVAKFISSK-TYSMFKLQSETRGEQTSFINEIIGNEKVVKAYGHEEEAIKKFDNMNKKLQNYSLRATFFSSITNPATRFVNGLIYAIVAVVGAIVVLSGRLTVGSLSCFLSYANQYTKPFNEISGVVTELQNAIACAARIFEIIDQEPEEAEKAN-ELKNVKGRVNCENVYFSYVT-DKKLITDFNLNVKSGQKIAIVGPTGCGKTTLINLLMRFYDVNSGSIKVDGIDIRDVSRKSLRLSYGMVLQETWLKNATIRDNLTMGKPNATDEEIIAAAKSANSHGFILPKGYDTIIGEDGGVLSQGQKQLLCITRVMLCDPDMLILDEATSSIDTRTEMKIQDAFNKLMEGKTSFIVAHRLSTIQNADIILVMKDGHIIEQGNHDELLDKKGFYYELFN.. 574
34 0.000e+00gi|19552189|ref|NP_600191.1| ABC transporter ATP-binding component [Corynebacterium glutamicum ATCC 13032]  clstr ali  22  30....KRLFGILGHDRNTLIFVIFLAVLSVGLTVLGPWLLGKATNVVFEGPGSGIDFEKLAMILGLVIGAYLIGSLLSLFQARMLNRIVQSAMHRLRMEVEEKIHRLPLSYFDSIKRGDLLSRVTNDVDNIGQSLQQTLSQAITSLLTVIGVLVMMFIISPLLALVALVSIPVTIVVTVVVASR-SQKLFAEQWKQTGILNARVEETYSGHAVVKVFGHQKDVQEAFEEENQAVYKASFGAQFISGIIMPTMMFVGNLSYVAIAVVGGLQVASGSLSIGGVQSFIQYSRQFTQPLSQLGSMANLLQSGVASAERVFELIDEDEQDSDPAQPTVAAGANRLEFKDVSFGY-SEDRPLINNLDLEVRSGSTIAIVGPTGAGKTTLVNLIMRFYDINSGSITLDAVDIRTMAREDLRSRTGMVLQDTWLFAGTIRDNILYGRPEATEEEMLAASKAAYVDRFVLPEGYDTVLDDEAMNLSVGERQLITIARAFLANPRLLILDEATSSVDTRTELLIQRAMSKLRQDRTAFVIAHRLSTIRDANLILMMKDGEIVEQGNHRELMALEGAYWELYN.. 639
35 0.000e+00gi|309812835|ref|ZP_07706572.1| ABC transporter, ATP-binding protein [Dermacoccus sp. Ellin185]  clstr ali  21  53....RRLIGLLKPHRLHVIAVLALSVTAVIMNVVAPKVLGKAVDAVFAGPGAGIDFDRVATILLTVVALYVVASLLQVVQARLLNTVVQRTVEKLRADVDAKLQRVPLAYVDSRPRGELLSRVTNDIDNVGQSMQQSAGQLLVSICTVLGVVVMMLTVSWQLTIVALLTIPLVMLVAGQIM-KRSQGQYVAQWAHTGTLNGQIEEAFTAHELVKVFGRGPQVEAAFASTNASLTEVSRRAQFLSGLMMPIMMFVGNLQYVAICVIGGVRVASGQMTLGDVTAFIQYSRQFTQPVTQIASMINLLQSGVASAERVFEVLDAPEESRDANAHLPTSLRGEVVFDDVRFGY-DPDAPLITGLDLRIEPGQTVAIVGPTGAGKTTLVNLVMRFYDVDAGRILVDGVDVRDVPREELRCHFGMVLQDSWLFRGSIADNLRYGRLDASDEELLEAARATFVDRFVLPDGYDTIIDDDGGSISTGERQLITIARAFLARPDILILDEATSSVDTRTEATLQQAMAALRQDRTSFVIAHRLSTIRDADIILVMENGDIVEQGSHDDLLAARGAYWRLYEA. 664
36 0.000e+00gi|15613378|ref|NP_241681.1| ABC transporter ATP-binding protein [Bacillus halodurans C-125]  clstr ali  19  34.KTLRRIWTYLVNYRGRLLLVFLAVLLSSVLGLLGPFVIGMAIDHYLVEG----DTSSLFKVMIGLLAIYAVYSLSMWLQQVWMIGIAQQTVYSIRSDLFHHFHRLPIPFFDKKQHGELMSRMTNDIENISNTLNSSVIKIFSSVLTLVGIMIVMLWLSPLMTVITMTVVPLMVFGLKWIT-RRTAVFFKQQQKALGDLNGYIEETVSGQSVIQAFSREGAAIATFSEKNRELKTTSFWAQTYTGFIPKVMNVLNSLNFAVIAGVGGILAMRGSITIGIIVIFAEYARQFTRPLNDLANQFNMLLAAIAGAERVFDILDEQEERHHDQTKQVKSIKGEVSFEQVSFSYEQ--KTTLNNLSFHVNPGETVALIGPTGAGKTTIIRLLSRFYEWDGGAIYVDGEDVTTWDRESYRRHLAFVLQESFLFQGTIRENIRYGRLEATDEEVEAAAKMANAHSFIMPDQYDTVLDSDGSGISQGQKQLLSIARAMIANPSILILDEATSNIDTITELNIQEALHRLMNGRTSFVIAHRLNTIQHADVILVLEKGTLVEQGSHEELMAKKGVYYDM.... 596
37 0.000e+00gi|90418652|ref|ZP_01226563.1| ATP-binding and permease protein, ABC-type transporter [Aurantimonas manganoxydans SI85-9A1]  clstr ali  24  2...LARFFSYYAPWRGLFVLDFGCAVLAGLLELAFPIAVKVFIDTLLPSGEWN----LIIAAAVGLLAIYLLNTGLMAVVTYWGHMLGINIETEMRRRAFDHLQKLSFGYFDNQKTGHLVGRLTKDLEEIGEIAHHGPEDLFIAVMTFLGAFVLMLFVHVDLALITAVVVPVGTIL-TVRYGARMTDTWRAIYSSVGAFNARIEENVGGIRVVQAFANEDHERALFARDNAQYRGRKLDAYRIMSVSQSLNYLSMRLTQVIVMVAGTYYVIEGDLTNGGFVGFLLLVGVFFRPVEKIAAVLESYPKGIAGFRRYCDFLDTEPDIVDPGARAVDRLAGDICFSNVHFTY-STGHPVLNGIDLSVKAGETIAFVGPSGAGKTTICALVPRFYDLVEGAITIDGIDIRDLQLAALRSHIGVVQQDVFLFGGTIRDNVAYGRLDAGDAQIWEALERAHLADTVLPDGLDTIVGERGLKLSGGQKQRLSIARMFLKDPAILILDEATSALDTATERAIQTALAELARGRTTLVVAHRLSTIRHADRIVVVDAGRIVEEGAHDALLQKDGAYRRL.... 564
38 0.000e+00gi|167748558|ref|ZP_02420685.1| hypothetical protein ANACAC_03331 [Anaerostipes caccae DSM 14662]  clstr ali  20  12...ISRLRPFIAPYKWGFIGAVVMTVLSVAAMTSAPRIEGMITTQLAKDPGAGVQFDVIVKILAVLAVIYIIKMASQVISMFLLTNSIQSAMHDMRNAVQDKIRRLPVKYFDTHSFGDTLSRVTNDIDSVSNGLQQSFTQVISGVLTLILVLVMVFTIQPVMAWLVVLIIPVS-ILISVAVVRKSQKHFKAQQDSLGELNGTITELYTGYNEILLFGRQQSSQERFKEINGRLQKHALKAQFVSSMMSPLISLSVYLCIGGVAVSGTVFVIQGMLTVGNLQAFIRYIWQCNEPLSQVAQLSAQIQAAFAGMKRIFEILDEPEEIPDPPGTRILDVRGEVSFEHVAFGYG--DKPVIKDLDIHIKSGQMVAIVGPTGAGKTTIINLLLRFYDTDSGRILIDGVDIKSMKREDLRSMFGMVLQDTWLFSGTIYENIRYGRLDARKDEVIDAAKTVNVHHFILPKGYDMEIDEEGSNISQGEKQLLTIARAVLKDPKILILDEATSSVDTRLEKILQEAMHKLLSGRTSFVIAHRLSTIKNADLILVLKEGRIVETGTHTELLEKKGYYEQLYH.. 587
39 0.000e+00gi|221194985|ref|ZP_03568041.1| lipid A export ATP-binding/permease protein MsbA [Atopobium rimae ATCC 49626]  clstr ali  22  77.NIFMRFLSYYVGQRHLFFIDMACALVIAVTELAFPQILRQLAFGLFTEGEDAI-LGSLVFVAIGLIAMYALHFFCRVFVISWGHIMGARMESHMREDLFDAYERMGFSYYDRHKTGDLMSRLVSDLFDISETAHHGPEYLVIGVMEIVGSFVILSFINVPLTLVMAAIA-VALVVFNFFANVHMRTIFRENRVRISNVNTQLEDSLAGIRVVKGFAAEDYERAKFRKSNDAYLDSKARMYFAMGRYHGAIDSMMGILNTTIVVFGGWMIAHGQMRAADLATFALYVSLFTNPISNILNFTETFQKGLAGFQRFVEILDTRPDIEDPGAPDLRVSAGEIIYDDVRFSYDGSEE-VIKGLNLHIEPGKTVALVGPSGGGKSTTCALLPRFYDVQSGSISIDGQDVRGVTQHSLRDAIGLVQQDVYLFDGTIAENIAYGCPGATRQEIEEAARRANISAFVLPDGYDTEVGQRGTRLSGGQKQRISIARVFLKNPPLLILDEATSALDNESERAVQESLSELAKNRTTLIIAHRLSTIMGADEIITIENGRVVECGTHNELLAKGGTYATYYR.. 646
40 0.000e+00gi|51893861|ref|YP_076552.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863]  clstr ali  24  25.RIYRLLGTLIRPYVPKLAAGVLLMVATALTGLVGPYLTQVAIDRFV----AERDPAGLDLVALAFLATALLNWWSSYGQTYIVSYVGQSIIYDLRDRMFRHLQRLSFRFFDSMATGRIMSRLMSDVDAINQLVSSGLVSLFADSMVLVTIMGTMLWMNWRLALVSFITIPTLLLVLRLFRG-WMRDAFMAQRRRAADMNAHLAEAIAGIRVTQAYVREARNQAQFDGINERLRQANLGAVRVWATMMPSIEVVSAFGVTLVLWYGGILLRGGTVTVGQVAAFILYLNRFFQPIRDLSQVFNVFQAAVVSAERVAELLDQQPEIVDPGARDLPRVAGRVEFRDVVFGY-EPGQVVLKGINLRAEPGETIALVGPTGAGKSSVINLLARFYEPQEGQVLVDGVDLSTVTQRSWRSQLGIVLQDTFLFSGTIRDNIRYGRPDATDEEVEAAARAVGAHDFILEKGYDTEVHERGAKLSVGQRQLIAFARALCADPAVLILDEATSNIDTHTEAVIQEALQTLLRGRTAFVIAHRLSTIRSADRIYYIEDGQVVEQGRHAELLALGGRYARMYR.. 593
41 0.000e+00gi|291278750|ref|YP_003495585.1| ABC transporter ATP-binding protein [Deferribacter desulfuricans SSM1]  clstr ali  21  1MKLLKRVWLYFRPYKWHIFFSFVFSLFVAASNGASAYIIKPALDGIFI----NKEKEKLLLMPFVIVGIYLIKGIFRFLQNFLMRRTGQKVVQAIRNDLFDKIIMLPIRFFSESSTGVLMSRITNDVNMVQSSIP-SFVTAIRETFSILGLAAVVLYQDPYLGSFALFVLPLVVLPLIKIGKKIK-KYSRRGQEKMGDISSVLQESFSGIRVVKAFANEDKEKEKFKVHNEKLVRNEIKKIVYNEISSPMMELIGAIGLALVIYYGGLKVIEGVSTPGTFFSFIAAIAMMYDPFKRINSANNNIQSAIAAAERIFEIMDTENEILENDGELECDAKGDVIFDHVYFRYKDNEDYVLKNINLSVKPGTTVAIVGSSGAGKSTLVSLIPRFYDVTSGAIKIGETDIRDFKVHSLRKNIGIVSQEPFLFNDTVFNNIAYSMNNVTEEDVINAAKAAYAHEFILPEGYNTVIGERGVRLSGGQRQRITIARALLKNPPILILDEATSALDTESEKIVQKALENLMKHRTSFVIAHRLSTVINSDVIVVLDKGEIESIGTHKELLVKSKVYKKLYH.. 568
42 0.000e+00gi|310817271|ref|YP_003965235.1| ABC multidrug efflux transporter fused ATPase and inner membrane proteins [Ketogulonicigenium vulgare Y25]  clstr ali  25  2...LREFFSYYRPWRKLFILDFGSAVVSGLLELAFPLAITWFIDSLIPLG----DLQLTVFAALALAGVYGLNAYLMYVVIYWGHQLGINIETEMRRRAFDHLQKLSWSYYDTQRTGKLVARVTRDLEEIGEVAHHGPEDLFIAVMTFIGAFCLMAMLHVPLALLTLIVVPVSFLVV-LFFGRRMTQTWRAIYSRVAGFNIRLEENVGGIRVVQAFGNEEHERKLFAKDNAAYRNTKIDAYRYMAGSNALNYVGMRATQIIVMVAGAAFVLDGSLTTGGFVGFLLLVNVFLRPLDKIATVIEMYPRGIAGFKNFQELMSIDPDIADRATAKDAPVTGDIRFDDVHFAYSN-GREVLKGVSFAVKPGETVAFVGPSGAGKTSLLALLPRFYDVTGGQITVNGTDLRDLTLASLRAQVGIVSQDVYLFGGTLRDNIGYGRLGATDAEIMEAAALAQLSDMIMPAGLDTIVGERGVMLSGGQKQRVAIARLFLKNPPILILDEATSALDTQTEREIQGALDRLAVGRTTLVIAHRLATIRNADRIFVMEDGQIIETGTHAELVAAGGRYARL.... 564
43 0.000e+00gi|260438867|ref|ZP_05792683.1| ABC transporter, permease/ATP-binding protein [Butyrivibrio crossotus DSM 2876]  clstr ali  22  6..TVKKIFKYLTHYKPSIIFSLLFAFITVAGQLAIPVLQGKAIDRII--GAGNVDIKGIITILIIIAVTVAATALFQWIMNVINNKITYSIVRDIRKDAFEKLQILPVNYVDTHPAGEIVSKVIADVDQFADGLLMGFTQFFTGIMTIIGTLVFMFIYDWKITMVVVLVTPASFFIASFI-AKRTYNMFKKQSEARGEQTSLIDEMIGNEKIVQAYSMEDNSLDRFDEINGKLQKYSLDATFFSSLSNPSTRFVNNVVYALVAFVGAFSVMRGGLTVGSLSALLSYANQYMKPFNEISGVVTELQNAIACAGRVIDLIDETPMKKDPDNLVVKDGEGKIDLEDVCFSY-DKSKELIKNFNLHVKPGERVAIVGPTGCGKTTVINLLMRFYDVDSGNIKIEDVDINDVTKKSLRSNYGMVLQETWLKSGTIKENIITGRPDATDEEIVAAAKAAHAHGFILPNGYDTVIGEDGGNLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEMKIQHAFSIMMEGRTSFIVAHRLSTIKSADIIIVMKDGNIIEQGNHEELLAKGGFYSVLYN.. 573
44 0.000e+00gi|346311899|ref|ZP_08853897.1| hypothetical protein HMPREF9452_01766 [Collinsella tanakaei YIT 12063]  clstr ali  23  46....RRLMAYVRPHAASFATSFVSAGLSVVLQLYVPIVVGRAIDLII--GMGRVDFAALAPLLVQLALVVLAASALQWVQGYCVNLLTYRCVRDMRVDASEKIGRMPVSFIDAHPHGDLISRVVNDVDQIGDGLLQGFNQLFTGVVTIVGTLLFMLSISVPMAVVVVLVTPLSIMAATLI-AKFSNKSFAAQQRIQGQLGAHIEEYVGSQRLVSTFCYGDRAQERFDTMNGELYTAGERAQFLSSLSNPGTRFINNLIYAAVAVIGCMCVITGWLTVGGVQTFLSYANQYTKPFNEVTNVITQLQTAYASARRLFALLDADEESPEKADREALSARGEVVFDHVNFSY-TLERPLLQDICIHAAPGQRIALVGPTGCGKTTLINLLLRFYDVQGGRIELDGVDIASYARADLRSRFGMVLQDTWLFEGTVHDNIAYGRPGATREQVERAAVRAHADGFILPRGFDTVIGEGGGTLSQGQRQLLCIARVMLCDPEILLLDEATSSIDTRTEAQVQAAFDELMHGRTSFVVAHRLSTIREADRILVMRDGRIIERGTHEQLLSQGGFYAELYN.. 634
45 0.000e+00METAHIT MH0010 GL0023465 [Complete] locus=scaffold3746_1:8363:10174:+  ali  21  30.NTIIRLFSYMKETKLQLAGALCCVLASTASTLAASYMLRPVINNYIIGFNENGGIKSLAMALVVMASVYLLGVLATYFQAKLMLKVSQRAMFSLRRDLFVHMQKLPVSFFDMNSKGDLMSRYTNDVDVVGEMLNSTAVQLFSGIMTLVGTFAMMIYTNIWLSLITFVMAPVIIYSGRFLVSR-SRKYYAAQQKSLGALNGCIEETISGQRVVKVFCHEKQAVEDFRKYNYDLKDKQIKAQFFGGIMGPVVGNLGQVNYSLTAMIGGILCVLKGFDIGGLTIFVTYARQFSRPINEITMQMNTIFSALAGAERVFDICDMEEE--DVTGDIPDNVKGEIVMDDVTFGYR-KDTPVLKHISLVAKKGQKIAFVGSTGAGKTTITNLLTRFYEIWDGRITLDGRDIRTLNMEELRKNIALVLQDTHLFTGTVMENIRYGRLDATDEEVIAAAKTANADYFILSEGYDTVLEGDGSNLSQGQRQLLNIARAALSKAPVLIMDEATSSVDTITERQIQDGMDRLMSDRTTFVIAHRLSTIRNADAIMVLENGEIIEWGTHEQLLAMKGRYYELY... 596
46 0.000e+00gi|330465737|ref|YP_004403480.1| ABC transporter permease [Verrucosispora maris AB-18-032]  clstr ali  22  55....RRLMGRLRPHRLHLTAIIALAVVSVGLTVIGPKVLGYATDLIFTGPGVGIDFAALGRVLLLALGLYVVASLLLWWQGWLLNGVVQRTVFQLRAEVEEKLNRLPLPYFDRQPRGELLSRVTNDIDNISQTLQQTLSQLLTALLTVVGVLGMMFWISPLLALVALVAVPLSVVVTGQI-AKRSQRKFIAQWTHTGELNGQIEEAFTGHELVKVFGRQREVEAAFRAKNDELFAASFGAQFISGIIMPAMFFIGNVSYVAIAVVGGLQVASGSMSLGDVQAFIQYSRQFTQPLTQVASMANLLQSGVASAERVFAVLDAEEQQPDPAVPRVSDPHGRVEFEHVSFRY-DPDKPLITDLSLVAEPGHTVAIVGPTGAGKTTLVNLIMRFYELDAGRITLDGVDITALRRDDLRGRIGMVLQDTWLFGGTIRDNIAYGRPDATEEEILAAAQATFVDRFVLPDGYDTVIDEEGSNVSTGERQLITIARAFLAEPSLLILDEATSSVDTRTEVLLQRAMAALRSERTSFVIAHRLSTIRDADLILMMEDGRIVEQGTHTELLAAGGAYHRLYQ.. 659
47 0.000e+00gi|119960925|ref|YP_949156.1| ABC transporter ATP-binding protein [Arthrobacter aurescens TC1]  clstr ali  25  42....RRLLGTLRPERFWLILVLVFAVVSVALSVIGPRLLGEGTNLIFAGPGVGIDFGALASVLLWALALYVLASAFGWMQAYVLNGVVQRTVYRLRERIEAKIHRLPLRYFDSIQRGELLSRVTNDVDNISQSLQQSISQVVSSLLTVVGVLVMMFLLSPLLALIALVTIPLTL-GTTLLIAKRSQKLFVAQWKNTGELNGQIEETYTGHALVKVFGRQNEVQEKFRLKNSELYQASFGAQFVSGLIMPAMTFIGNLVYVGIAVVGGLQVASGSMQLGDVQAFIQYSRQFTMPLAQLGSMANMLQSGVASAERVFDLLDEEEESAEPEPSGAGPSRGRLVFENVSFRY-SPDKPLITDLSLVAEPGQSIAIVGPTGAGKTTLVNLMMRFYELDSGRITLDGVDIASLSRQELRSRMGMVLQDTWLFGGTIRDNIAYGRPTASEAEIMEAAQATYVDRFVLPEGFDTLLDDEGGNVSAGEKQLLTIARAFLSRPSVLILDEATSSVDTRTEVLVQKAMNALRSDRTSFVIAHRLSTIRDAHLILVMEAGQIVEQGTHSELLASGGAYSRLYEA. 646
48 0.000e+00gi|359425611|ref|ZP_09216707.1| putative ABC transporter permease/ATP-binding protein [Gordonia amarae NBRC 15530]  clstr ali  21  14..SIRRIVRLLSGYRVLMPTILLSLTCSVILLAIAPRVLGHATDLVFNGPGQGIDFGAVGRILLIVLGLYLVSMTMAWLASYLLNIVVVATIRRLRADVEAKIHRLPLRYYDSQPRGDLLSRVTNDLDNLSQSMQQTISQLLNSVLTVIALLVMMIIISPLLALIAIVTVPL-AIGATTIIAKKSKPHFIAQWGSTGKLNAQVEEAFTGHELVKAFGRQHEVEQVFDERNQKLYESSWRAQFISGITMPVIMFLGNLNYVAVAVVGGLRVASGALSLGEVQAFIQYSRQFSQPLTQIGSMVNLLQSGVASAERIFDILDATEETPDPDKPAPLEDHGRIEFDDVSFRYL-ADKPLIEDLSLVARPGQMVAIVGPTGAGKTTLVNLIMRFYDVDTGTISVDGLDSRLMTRADLRERTGMVLQDSWLFGGTIYDNIAYGDPTAEREEVIEAATLSHVDAFVLPDGYDTVLDDEGGGVSAGERQLITIARAFLAKPTILILDEATSSVDTRTELLIQKAMARLRTDRTSFVIAHRLSTIRDADIIIVMEDGHIVEQGSHEQLLATHGAYYRLYN.. 620
49 0.000e+00gi|339411334|gb|AEJ60899.1| ABC transporter related protein [Spirochaeta thermophila DSM 6578]  clstr ali  25  25LPILRRLWHYLRPYRIPLTVAVXXXXXXXXXXXXXPLFIRNAVNAM-ASGPGTVDLSTLLAAVLTMAALYLASTGLTWIQVRSLITVTQGVLYRLRRDLFSHLQRLPIPFLDRTPHGDLMSRLTNDVATLETTLSQTLTQLASNVLLLAGSLAMMLALSPLLTLLTAIIIPL-AILVTRTLARLSREAFRTQQQLLGSLNSLVEETAGGLREIKAFGREGVFLDEFTTTNEQFTATAYRAMVVSSVLPPIMNALNGLSFPIIALAGGYLALKGQLSVGVVAAFLTYARQFSRPINEISNQFTLIQSALAGAERIFQLLDEPIEQDLPEAENLNTTSGHLALHNLTFGY-DPTRPVLRDITLEAPPGSLIAIVGPTGAGKTTLVNLLMRFYDPQEGRILLDGRDTQHIRRASLRRHMGMVLQDTHLFTDTIRENIRYGRPDATDEEVEEAARIAEAHHFILPQGYDTLLTDRGSSLSEGQRQLITIARALLADPAILILDEATSSVDTRTERHLQKALRTLMKGRTSFVIAHRLNTVREADRILVIQEGRIVEQGTHDELMARKGLYWQFHQ.. 594
50 0.000e+00gi|229815444|ref|ZP_04445776.1| hypothetical protein COLINT_02492 [Collinsella intestinalis DSM 13280]  clstr ali  23  32.....KVVRYIAHDKLELFVAIACAVGSVAFNVMGPRVLGEATTELFVGGTGGVDFTLIGRILATVLCIYITSSALSLVQGWLMTGVTQRVCYRLRRQIIEKIDRMPLAYFERVSTGDVMSRVTNDVDTLGQSLNQSVTQLITSVAQLIGVSVQMLSISVALAGVTFLTIP-LSLLGVVLVVRTSQRHFRRQQVFLGSANGIIEESFAGQTLIQAYNRAERALGEFDEVNEKLYESGWRAQFLSGVMQPIMSLVGNLGYVAVVMMSAFLMISGRITVGNAQAFFQYIRNFTQPITQLSQVSNMLQMLAAAAERIFEFLDEEEEDDPAPLSESLRATGSVEFDHVRFGYI-PEKTVIHDFNCSVEPGQTVAIVGPTGAGKTTLMKLLMRFYDVNAGSIRVNGADVRSLPREDLRSNFAMVLQDTWLFKGSIRENIRYGNIEADDAMVEAAARTALADHFILPGGYDFELNEDASNVSQGQRQLITIARALLADRPILILDEATSNVDTRTEERIQRAMDILMAGRTSFVIAHRLSTIRSADVILVLRDGDIVESGSHEELLARGGFYAELYN.. 603
51 0.000e+00gi|317133408|ref|YP_004092722.1| ABC transporter [Ethanoligenens harbinense YUAN-3]  clstr ali  23  38.KTVLRLLGYFSKEKRILAVIVVFVLVDAALMLAVPYLEGRAVD-YMAGGRGKVAFSPLFAVIGLLLAVFAGDWLLTVLENRLIAGASQRIVGRLRSVLFDRIQALPIAFFDVHTHGDLMSRFTNDVDNISTTISQSTVSLLADVTGIVGAFGLMLALNVPLTAAALVTVPLVFLLSKTVTT-HTAKLFSAQQAALGRLGGHVEESISGLSVVKAFGREKQVVEEFNAANNALLDVSIQAQIWSGYMMPIMNVIGNLGFAAVAGVGGILAVRGMVTVGVIASFLSYSRQFTRPLNDVANTYNSLQTAVAGAERIFEVLDTPAEPGDPDAVELSHPRGEIAFEDVSFGYR-PDVQVLSHVSFRAEAGSVVALVGPTGAGKTTVISLLNRFYDVTGGRILFDGVDVRQYTRASLRRAFGIVLQDTSLMPGTVAENIRYGRPDATDAEVRAAAETAGADHFIMWDGYDTVIGEQ--SLSQGQRQLLTIARAVLADPPVLILDEATSNVDTRTEKRIQEAMVRLMRGRTCFLIAHRLSTIRDANQILVVSGGRIAEQGTHKGLLAQDGLYARLWN.. 605
52 0.000e+00gi|269926308|ref|YP_003322931.1| ABC transporter [Thermobaculum terrenum ATCC BAA-798]  clstr ali  24  17LNLIRRLLTYVVPYKGLVILGVFLLISTSLTDLAGPYIIKIAIDNYIARG----NFRGLLFISVVYFIINLLSFLFRYLQSYATGVLGQKIMYDLRMELFSKIQSLSLSFFDRTPVGRIVTRVTNDVDSLNELLTSGMVTIIGDTFTLLGITVLIFWLNWKLAIVTMLVVPV-LVVITNFLQKRMRAAFRALRVRLSRINAFISENVSGMHIVQLFNREDKNFQQFNDLNQDYKKSALRSLFYFALFGPLLSLITASATALVIWFGGRSVIAETLTIGSLVAFLQYVDRFFLPIRDLSEKYNALQSAMAACERIFQLLDEQPAIKDADAKPLQHIRGEIEFKNVWFAYND-EEWVLKDVSFKVSPGESVALVGATGAGKTSIISLLCRFYDIQKGQILIDGIDIKEISIKDLRRHIGLVLQDPFLFTGTIASNIRLHESSISDQQVEEAARYVNAHTFILPLKYNEPVLERGAGLSHGQRQLISFARAIAFNPELLILDEATSSIDTETEALIQEALAKIMKGRTSIVIAHRLSTVQNVDRIIVMHKGRIVEQGNHQELLAQRGYYYRLYE.. 585
53 0.000e+00gi|210633266|ref|ZP_03297731.1| hypothetical protein COLSTE_01644 [Collinsella stercoris DSM 13279]  clstr ali  22  18..ALLGLVRYLAHDWPIVLISLACAVGSVAFNVTGPRVLGEATTTLFVGGTGGVDFDAVGRILATALCIYLTSAALNLVQGWLMTGITQRVCYRMRREIIEKIDRMPLSYFERVSTGDVMSRVTNDVDTLGQSLNQSVTQLVTSIAQLVGVSIQMLSLSVALAGVTFLTVPLSLLGVILVV-RASQRHFRRQQAFLGQANGIIEESFAGQNIIQAFNRGERAVADFDEVNEKLYESGWLAQFLSGIMQPIMGFVGNLGYVAVVVVGAFLAVGGSITIGDVQAFMQYVRNFTQPITQLSQVSNMLQMLAAAAERIFEFLAEPEEADDAVTPGLARADGAVSFEHVRFGYV-PDKIVINDFTCDVEAGQTVAIVGPTGAGKTTLMKLLMRFYDVNGGSVRVNGVDVREYAREDLRANFAMVLQDTWLFKGSVRENIRYGNIDADDAMVEAAARAALADHFILPGGYDFELNEDASNVSQGQKQLLTIARALLADRPILILDEATSNVDTRTEQRIQQAMDILMHGRTSFVIAHRLSTIRSADKILVLRDGDIVESGTHDELLAKGGFYAELYN.. 592
54 0.000e+00gi|163790342|ref|ZP_02184774.1| ABC transporter, ATP-binding/permease protein [Carnobacterium sp. AT7]  clstr ali  19  4MKSIRRIWQYIKPYKLGFFSAIGLTIVCMIVNAIQPFIIGLAMDMLKGTPGATVNFPYIFNIVLIILGIAAIYQVTLYLSSYIMTNVVQNTMRDLRNEIEQKINRLPVAYFDRNQQGNILSRVTNDVDSISNAMQQSLVQMVNSFMGILFAIVMMLYISIPLALVIMATIPLSFIISKAVINK-SQPYFKGQQESLGAMNGHVQESFSGFTEIKLYGKEDDKLEEFKEINEMLNKNGFKAAFISGIMSPLVGFVSNVAYFGIAIGGGYLVIIGTLSLGNLQAFTQYIWQVNQPISQITQLSGVIQSAAAAINRVFEILDEPEEINEAERPLPSLIEGNVDFEHVAFGY-AKEKTLISDLNVSVKKGQTVAVVGPTGAGKTTLINLLMRFYDVDKGAIKIDGIDTKSMSRQDVRSLFGMVLQDAWVYSGTIAENIRFGKLDATDEEVIQAAKTANVDHFILPDGYNMKLNKETSNVSLGQKQLLTIARAVISDPKILILDEATSSVDTRLESLIQKAMKKVMEGRTSFVIAHRLSTIRDSDLILVMDQGEIIEQGTHEELLEKGAFYANLYN.. 584
55 0.000e+00gi|169823945|ref|YP_001691556.1| multidrug ABC transporter [Finegoldia magna ATCC 29328]  clstr ali  21  5LNLIKRVMPYFKKYKFILMFDLFCAALTTLTDMVLPMILRRLTNAGL--GTYTLTREMIFRMAGLLLIMKIIDLFAGFYMTKTGHIMGAKIETDMRYDVFQHLQKLSDSYFNETKVGQIMARITSDLFDITEFSHHCPEEYFIGLIKIIVSFAILVRLNTLLTVILFLSIPLMIVFASKY-NRRMRKGFKEQKRHIGVLNADIEDSLLGVKVVKSFANEDVEIEKFQKGNKKFLDIKSETYSSMAGFNTITKAFDGIMYIIVVLFGGLFLVEGKMSSGDIVAFILYVQTLLTTVRRIVEFTEQFQRGMTGIERFTEIMDQDIEIDDEDAVDLENVKGKIEIKNVSFKYNNNNENVLNNISFTINPGQKVALVGPSGGGKTTLCNLIPRFYDVEDGEILVEGIDVRKIKLQSLRSNIGMVQQDVYLFSGTVRENILYGKPDATEQEIIDASKAAGAYDFIMENGFDTYVGERGVMLSGGQKQRISIARVFLKNPPILILDEATSALDNKSEFIVQESLENLAKGRSSLTIAHRLTTVQNADLILVLTEDGIIERGTHRQLMEQKGYYYNLY... 574
56 0.000e+00gi|238924677|ref|YP_002938193.1| ABC transporter, ATP-binding/permease protein [Eubacterium rectale ATCC 33656]  clstr ali  22  13..TIRKVLSYMKRYIPLLVISLALSVVTVALTLYFPILTGRAIDLIV--GKGKVDFTAMTAILTRXXXXXXXXXXXQWLTNICNNRMTYNIVRDIRRDAFLNIEKMPLSYIDSHSHGDMVSRIIADVDTFSEGLLMGFTQLFTGIATIAGTLIFMLTIDVKISCIVVLITPLSLFVASFIT-KKTYSMFQLQTRTRGEQTALIDEIVGNEKVVQAFNHEDEALWQFDEINDRLQKCSLRATFFSSLTNPSTRFVNSLVYAGVGIFGAMSALTGGITVGQLSCFLSYANQYTKPFNEISGVITELQNALACAARIFELIEEKKEIPDADAVILEEADGRVDIEDVYFSYV-PDKKLIEDFNLHVKPGQRVAIVGPTGCGKTTIINLLMRFYDVNSGTIKVSGHDIRKITRESLRDNYGMVLQETWLKKGTIRDNIIMGKPDATDEEIIAAAKASHAHSFILPKGYDTEIGEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEIKIQKAFLTMMQGRTSFIVAHRLSTIREADIILVMKDGKIIEQGNHESLLAADGFYANLYN.. 580
57 0.000e+00gi|332982784|ref|YP_004464225.1| ABC transporter [Mahella australiensis 50-1 BON]  clstr ali  24  1MQYLLRLVKQARPYWKYLIAAALSMLAVTGLNLIGPNLISRLVEVVTNLDQYPDARRVILNLALILLISYAGRTLFAFLYRYLAHYAAWRLVADMRVIVYDKLQQLSLRYYHDKQTGQLMSRVTNDTATFEMLIAHAVPDLVTNVLILIGVAIVLFSKNAALAALTLIPVPFLAY-AGFVFVKKIQPNFRYAQRALADFNADLQDNLSGIREIQIFNRQEYETTKLRQRSYAHADAILRALKLSGIFHPIVEFFSSLGTVIVVAMGGLMAMAGNLPVEDIVGFVLYLGMFYQPIGALGQVMENLQQALAGAERVFEVLDTEPDVKEKEAIELKDVKGEITFEDVTFYYR-PDVYVLKDISFEIKPGQMVAFVGPTGVGKTTIMSLLARFYDPVSGCIKIDGIDIRDVTLRSLRDNISMVLQDVFLFNGTVAENIAYGTEDATMDDIINAAKIACAHDFIMPDGYDTYIGERGVNLSGGQKQRLAIARAVLRDTPILILDEATSSVDAETERQIQNAINNLANSRTILIIAHRLSTVKKADNIIVLDEGRIVEQGTHEELIKRGGLYSYLC... 571
58 0.000e+00gi|302527828|ref|ZP_07280170.1| lipid A export permease/ATP-binding protein MsbA [Streptomyces sp. AA4]  clstr ali  20  61............PQRAALTGVLVLGALGVALTVLGPKVLARATDLIFAGPGHGIDFTAVGQVLMIVLALYVFASFLGVIQARLTTNLVQGAVFRLRQDIEEKFARLPLRYFDRQPRGEVLSRVTNDIDNLAQSLQQTLSQIVTSLFTVLGVLVMMFVISPLLGVIVLLTVPVSVFVAAKI-GKRAQPQFIRQWGTTGKLNAHIEEMYSGHALVHVFGRRKEAEEVFRQQNEALYEASFKAAFISGTIQPGMMFIGNLSYVLVAVVGALRVASGSLTLGDVQAFIQYSRQFSQPVTQIASMANLLQSGVASAERVFALLDAKEQEPEPEHPQPEVVRGQVEFEHVSFRYLE-DTPLIEDLSLSVEPGHTVAIVGPTGAGKTTLVNLLMRFYEIDGGRITLDGVDIKAMDREELRSKTGMVLQDAWLFGGTIAENIAYGADNVTREQVIEAAKATYVDRFVLPDGYDTVLDDEGGTVSAGEKQLITVARAFLAKPAILILDEATSSVDTRTEVLIQHAMNSLRTGRTSFVIAHRLSTIRDADVILVMENGNIVEQGNHETLINAGGAYSRLYAA. 658
59 0.000e+00gi|373851797|ref|ZP_09594597.1| Xenobiotic-transporting ATPase [Opitutaceae bacterium TAV5]  clstr ali  24  43..TVLRLWGYLRRERLALILTGLLVAGSVAFDLAGPLLLGRVIDRHIVP----RELDGLARTLGLMLLVYALSAASGFLQAWIMAGASQRTLRALRIDLFDRLQRLPLRFFDRRAHGELMARVTNDVESINQVLGNSVTQLVSGALSTVGVAVAMVLINPWLALASVFFISLFTVTANRWLGARIRARYRVQQAALGRLYGFIEESVGGRKLVKACGQEAAIVARFDDINQASLRAGVQAQTFSGVTGPLMNMGNNLGLAIVAVLGGFMAIRGLATVGTIATFINYTRQFGRPLNEIANLYNQIQSAMAGAERVFEIIDEPPEADTPGAQPLGPVRGDIVFEDVHFSYRE-GVPVLKAINLHARPGQTIALIGPTGAGKTTIINLLTRFYEIDRGRVLLDGRDLRDIAKDDLRRHLGIVLQDTFLFSGTVRDNIRYGRLDATDAEVEEAARLANADPYILPQGYDTFLTGGGGSLSHGQRQMLSIARAILADPSILILDEATSSVDTRTEKHIQEAMARLMHNRTSFVIAHRLSTIRNADQIIVINHGEIQERGTHAGLLAQQGFYWRL.... 607
60 0.000e+00gi|269955871|ref|YP_003325660.1| ABC transporter [Xylanimonas cellulosilytica DSM 15894]  clstr ali  22  106..SFGRMLGLLAPYKVALVVVTLMGAASVVLSVWAPRVLGRATDVIFSGPGEGIDFDLLRTFMVTVLVIYVFAALLGWAQGFITNIIMVKAMWRLREDVEAKINRLPLSYFDRVQRGELISRVTNDIDNITQTMQQSLSGAITAVLTLVGVLAMMFSLSWQLALVTLATLPLMGVLFG-IIGPKSQKAFSLQWRKVGRLNARVEESFSGHALVKTFGRRKDFEARFAAENHELYEQSFKAQFLANIMWPAMSFIGNVSFIAIAVIGGLFVAGGTMTLGAIQAFIQYSQMFSQPLQQLGGMVAVVQSGTASAERVFQLLDVDEEADAADAPAPVEGDGVIEFEHVRFSY-SPDKPLIEDLSFTVRPGQTVAIVGHTGAGKTTLVNLLMRFYDPQGGRILVDGQDIGDLTRHDARARTGMVLQDTWLFAGTIRENIRYGRQDATDEEILAAAQATYVDRFVLPHGYDTVLEEDAANLSAGERQLITIARAFVSQPSILILDEATSSVDTRTEKLLQHAMASLRSGRTSFVIAHRLSTIRDADLILVMAHGAIVEQGTHAELLAADGAYAELYQ.. 713
61 0.000e+00gi|326202206|ref|ZP_08192076.1| ABC transporter transmembrane region [Clostridium papyrosolvens DSM 2782]  clstr ali  20  29..TSRRLLKYLAKQKFKLLAVLITVLVSSALNLVAPLVMGQVIDQLTKGIKESVDFNTIGRTVILLLVIYILTSLFIYFGQYLISGVAQTLTLGLRKELSQKLNRLPLRYYDCHKKGDILSRATSDLERVADSLQQGMMQLISSSVTIVAAIVIMLSIHPLLALITVFTLALSMFITTKI-AHRVEGHFADNQKYLGELNSTIEEAFTGQVVIKAFSGEAKSVKAFQKVNGQLCDANRKAQFTAFSIEPLIRFIGKIGYVIVAVVGGIFAVQGTMTLGNVQAFIQYIDMCSEPMTQISYILNMLQSAVASAERVFELLDEEEEVPDQNSKQLKNPRGEIAFEHVRFGYL-KDKVLMEDINIHFNSGDTIAIVGSTGAGKTTLVNLMMRFYEIQGGRITIDNVNIKEFSRGTLRKMFGMVLQDTWIFQGSIKDNIAYSRPDASLDEVILAAKAARADHFILPQGYQTILNEDGSNVSQGQKQLLTIARAILANPSILILDEATSSVDTRTEAEIQKAMNQLMQGRTSFVIAHRLSTIRDADLILVMQNGTIIEKGKHQELLNQKGLYEKLYN.. 606
62 0.000e+00gi|365178955|emb|CCE95810.1| ABC transporter, nucleotide binding/ATPase protein [Sinorhizobium fredii HH103]  clstr ali  23  5...LKRFAAYYRPHRRLFVLDFCSAVVSGLLELAFPVAVTLFIDRLLPTGEWG----LISLAVLGLLLIYLINAGLQVIVTYWGHMLGINIETEMRRKAFDHLQKLSFGYFDNLKTGHLVARLTKDLEEIGEVAHHGPEDVFIAVMTLAGAFLVMLWIHPILALITGVVVPVTAIVTAYYGGR-MTSTWHGLYNRVADFNARIEENVGGIRVVQAFANENHERRLFAEENRNYRATKLEAYKLMAASSSLSYLSMRFVQVIVMLAGSYFVLRGDLSAGGFVGFLLLVGVFFRPIEKINSVIESYPKGLAGFQRYIEFLDTRPDIADRGAQAVTRLAGTVSYEAVRFGYQD-GNVLLNGLNLSIRAGETVALVGSSGAGKTTLCSLLPRFYEISAGSIRIDGIDIRDMTLASLRSNIGIVQQDVFLFAGTIRENIAYGRLDASEAEIVEAARRARLDVLILPLGLDTVIGERGVKLSGGQKQRLSIARIFLKNPAILILDEATSALDAETERAIQRSLAELSAGRTTLVIAHRLSTIMHADRVLVVEAGRIVEEGTHATLLEKDGRYRRLHDA. 571
63 0.000e+00gi|313903930|ref|ZP_07837310.1| ABC transporter related protein [Eubacterium cellulosolvens 6]  clstr ali  22  15.QTLKRILAYIRPYSPLVICFLLLAVVSVVLQLLIPILIGEGVDQMV--GRGSVNTEALLQILTKILICIGATAAAQWLMNHMNNVITYRVVRDLRTRAFNHVHVLPLSYLDVNSSGDTLSRLITDVEQFSDGLLLGFTQLFTGVITIVGTIVFMLTLQPVVTVIVVLFTPLSFKVAKLISGR-SYRYFKNQSEARGKVTDLTNEMLGNLKIVQSFGREQAVMEEFEKRNRVLGENSLKATFISSLTNPSTRFVNTLIYNGVVFAGCLLCFMQAMSIGKLTSFLSYVKQYSQPFNDITAVITEFQNSLASASRVFEILDETPETPDADAITVDHAEGRVNLSDVSFSYL-PDKPLIEHLNVDVTAGKRIAIVGPTGCGKTTLINLLMRFYDVNEGSIAVDGTDIRHYRRSSLRSNFGMVLQDTWLKAGTVRENIAYGHPEASMDEVQAAAKKAHADGFIMPHGYDTVIEENGGNLSAGQKQLLCIARVMLSLPPILILDEATSSIDTRTEHYIQRAFDEMMKGRTSFVVAHRLSTIRDADEILVMKDGHIIEQGDHETLLAKKGFYSRLYHA. 589
64 0.000e+00gi|167749991|ref|ZP_02422118.1| hypothetical protein EUBSIR_00959 [Eubacterium siraeum DSM 15702]  clstr ali  19  34..TLKRLVGYIGKNRYLMILLLSVMLIITVLNLVAPYLQGLAIDKIVSNQRLNVDISGMLYCLIALGCVYLVNSLLTYFQGIFAAKLSQTTVKAMRKDLFDKISYLPIKYTDTHQHGDIMSRMTNDVENISNTVSQSIASLFSGVLTLVGCLVFMLYYSPMLTLVSLTSVVLTLIVTKNLT-KFMRKYFPLQQTLLGRLNGHIEEMVSGYRTVAAYSKEKKACEEFGEISDELQKAAIKAQICGGIMGPCMNVISNISFLLVAGFGAYFALKGIMTVGTIQAFLQYTKNFTRPINEIAQQYSSIQTAIAGAERVFEIMDTEPESDEGTDKDIDNVRGDLMFKNIDFSYV-QGEKVLHDFDLWIKSGQKLAIVGATGSGKTTVVNLLTRFYDIDGGSITLDGESIYDIPKKKLRGSIGIVLQDTVIFNDTIMQNIRYGRLDATDEEVIAAAKTAKVADFAMADGYDTMLTEGGGNLSQGQRQLIAIARAVLADPKILILDEATSSIDTRTEVHIQEAMLALMKGRTSLIIAHRLSTIRDADKIVVIDGGKVVEAGNHEKLLSENGAYARLYNT. 614
65 0.000e+00METAHIT MH0011 GL0099965 [Lack 5`-end] locus=scaffold42632_1:3:1763:+  ali  23  15MQVMKKLMAFIGNYKIFLGLSIVLAAVTVILQLYIPILFGDAIDEVVAAHQ--VNFPEMWFYLKRIVFFTLVSALSAWIMNLINNRMTYRIVRDLRSQAIRHIQVLPLSYLDQHSSGDIVSRVIADTDILSDGLLLGFTQLFSGIVTIIVTLFFMFSKNVWITLLVICLTPLSFFVAKFISGRSF-KMFQKQSETRGKQTALIDEMIGNQKVVKAFGYEEKASERFAEINKDLQKYSQQAVFYSSLTNPSTRFVNNVIYAGVALVGAFMIPGGALTVGGLSVLLSYANQYMKPFNDISSVITEMQNALACAGRIFALLEEKEESADP-AGTIDPVTGNVTIDDVAFSY-DKEKKLIENFNLDVQPGMRVAIVGPTGCGKTTFINLLMRFYDVDAGKICIDGKPIDELSRHALRSCFGMVLQDTWIKQGTVRDNISFGKPDATEEEIVNAAKEAHSWEFILPKGLDTVLSED--SISQGQKQLLCITRVMLCLPPMLILDEAPSSIDTRTELQVQEAFDKLMQGRTSFVVAHRLSTIRNASLILVMKDGKIIEQGCHEELLAKKGFYYNLYN.. 580
66 0.000e+00METAHIT MH0031 GL0069547 [Complete] locus=scaffold3329_8:1871:3637:+  ali  23  14..TLVKVLRYIKPYRVVLALTIFMAFISVALTLYLPILTGDAVDMLSLIGTEEF-WPGLFDILKKMAVVIILTALAQWFMSICNNKIVYGIIQDIREKAFRKLEILPLSYLDVHSHGDIVSRVVADVDQFADGLLIGFTQLFTGVITIIGTLGFMLSVNAWITAVVVVITPVSLLVASFI-AKKTFSMFKLQSETRGEQTALINEMITNQKVVQAFNREDETLEKFDEINGRLEKCSLRAIFFSSLTNPCTRFVNSLVYMGVGLTGALAAIGGGLTVGQLTCFLSYANQYTKPFNEISGVVTELQNALACAARIFELIEEEPQIPDQGARELTDVQGRVELSHVAFSYV-PDRKLIKDLNLAVQPGQRIAIVGPTGCGKTTIINLLMRFYDVDQGAICVEGTDIREITRKSLRASYGMVLQDTWLKQGTIRDNITVGKPEATEEEIIAAAKASHAHSFILPKGYDTVIGEDGGSLSQGQKQLLCITRVMLSLPPMLILDEATSSIDTRTEIKIQKAFAAMMEGRTSFIVAHRLSTIQNADVILVMKDGHIIEQGNHETLLKQNGFYAELYN.. 582
67 0.000e+00gi|320162369|ref|YP_004175594.1| putative ABC transporter [Anaerolinea thermophila UNI-1]  clstr ali  22  36.RVMVRLLAFLKPYWRPLAIAFIAMLGATGLTLLIPYLLKIAIDVHIAGGNA----RGLGQVALLTGAAYVGLYITSAGQQYLLSRVGQRVLGDLRARLFRHLQELSLSYHDTHIVGVTVSRVMNDVAVINELLSQGWISFFSDLFILSGIVVIMLSMNAHLALLAFLVLPLM-VLATRWFARAAQSAFRETRSRVAAVVGNLAEEIAGMRVIQAFAREEATQERFREVNVANRDANINAMSLSFLYMPAIEFLSTLATAVVLWFGGQMALGGTVTVGLLVAFLSYVSRFFQPIQELARLYTTLQAAMAGGEQVLALLDTQPDVQDPDAVEMPPIRGEIVFRDVSFRYRPDTPEVLHRINLHIQPGQRVALVGPTGAGKTTIANLTARFYEVSEGAVLIDGIDVRRVRQDSLRRQIGIVPQDSFLFAGTIADNIRFGKPDASDAEVEQAARLANAHDFILPEGYQTPILENAANLSVGQRQLICIARAILTDPRILILDEATANIDTVSEALIQEALERLLEGRTALIIAHRLSTIHNADVILVIQDGEIVQRGTHSELIAQPGLYRTLYE.. 603
68 0.000e+00gi|308067764|ref|YP_003869369.1| ABC transporter ATP-binding protein [Paenibacillus polymyxa E681]  clstr ali  21  39..TLGRIWAYLARRKAKLMLVLFMVLLSSGLALLGPYLVGVAVDDFLEGPGG----RTWIYFLIGLGAVYLLNSLTSWLQNIWMIEIAQETVYRMRFDLFSHLHRLPIPFYGKRQQGEIMSRLTNDIENVSSTLNSSAIQIFSSILTLIGTLTVMLWLSPLMTLLTFIVVPLMAAGMRWIT-RRTGPLYKERQKNVGELNGYIEETLSGQQIIKAFSQEKRVIHGFDERNDRIRLSGFWAQTISGFIPKLMNGLNNLSFAIVAGIGGILAIRGSITIGTIIVFVEYARQFTRPLNDLANQWNTLLSAIAGAERVFEILDEDEESKDEGAVEVGHVEGAVRFTDVSFGY-DEGSATLVGISFEAKPGEMIALVGPTGAGKTTLIQLLSRFYSPDKGTITLDGRDITTIQRESLRSRMAFVLQDSFLFQGTIRENIRFGRLDATDEEVEQASKLANAHSFIMKDGYDKVLEANGSGISQGQKQLLAIARAILANPSILVLDEATSSIDTITEMKIQEGLERLMQGRTSFVIAHRLNTIRQADRILVLKDGRLEEQGSHDELLAHKGFYSDLY... 603
69 0.000e+00gi|307243947|ref|ZP_07526071.1| ABC transporter, ATP-binding protein [Peptostreptococcus stomatis DSM 17678]  clstr ali  19  7...IKSVIPYFKKYKNILFIDLLCAGLTTASEMVLPLILRYMTNIGI-ADAGSLTLQLITRIAVLFILIKCVELVAVYYMASIGHIMGAKIETDMRFDMYKHLQTMSDNFYNETKVGQIMSRMTNDLFDITEFAHHCPEEYFIGFIKICISFVILFNINMPLTLAVYLMIPVM-FISSSRFKNSMRREQKKQRVHVGDLNSSIEDSILGIKVVKSFANEDIELKKFEKDNSKFLSIKKLFYKSMAGFNTVNRSIDGLMYFIVIVFGGYQMMKGRLVPGDMLAYIMYVSTLLLTVKRIVEFTEQFQKGMTGIERFNEIMSLEPEIVDPNAIDLTDVRGDIEFKNVSFKYNEKLDYVLDNFNLDIHAGKNIALVGPSGGGKTTVCALIPRFYDVTKGGIYVDGKNIKDLSLHSLRNNIGIVQQDVYLFSGTIMENIRYGKPDATKEEIVEAAKLASAYDFIMEHGFDTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNNSEAVIQESLEVLSKGRTTITIAHRLTTIQNADLIVVMTADGIIEKGNHQELMENKAYYYNLY... 574
70 0.000e+00gi|358065307|ref|ZP_09151854.1| hypothetical protein HMPREF9473_03917 [Clostridium hathewayi WAL-18680]  clstr ali  20  1MKTLKRFAPYYRKYLGIMTMDLFCAALTTICELVLPLILRY-ITNIGMNDLAALTVRTIVTIGALYFVLRMIDGLASFYMAYTGHVMGAAIETDMREDAFAHLQKLSDNYFNNTKVGQIMSRITSDLFDVTEFAHHCPEEFFIAFVKTVVSFVILARINVLLTLIIFILIPVMAISCS-YFNIQVKKAFKRQRNHIGELNARIEDSLLGNKVVRAFANEDVEIDKFNKDNQEFLRIKRETYKYMAAFQNTIRMFDGLMYVVVIVAGGIFMIKGLIEPADLVAYTLYVTTLLATIRRIIEFAEQFQRGMTGIERFTELMDASVDIDEEGAVPLHDVKGEITFRHVSFEYPDDHTPVLADINLTIRPGEKVALVGPSGGGKTTLCNLIPRFYDTTEGDILLDGQNIKNVTLQSLRGNVGVVQQDVYLFSGSVFENIAYGKPGASKEDVIRAAKLAGAHEFILKDGYDTYVGERGVKLSGGQKQRISIARVFLKEPKVLLLDEATAALDNESEHLVSESLDKLAAGRTTLTIAHRLTTIKGADRILVLSGNRIVEEGSHEQLLEKHGMYYQLYMT. 576
71 0.000e+00gi|323358225|ref|YP_004224621.1| multidrug ABC transporter ATPase/permease [Microbacterium testaceum StLB037]  clstr ali  21  42..SFRRLIGLLRPHAVAFAFVSLLGALGVVLAVLAPRVLGDATNIIFEQVGAGVDFDALRLVIVAVLAIYVGSSLLSWIQGYVINVIMVRTMWRLREDVEAKINRLPLSYFDKVQRGELISRVTNDIDNITQTMQQSLSSALTSVLTVVGVLIMMFTISWQLALVALVSLPLMAIIFGVI-GPKSQKAFGTQWKKVGRLNARVEESFSGHALVKVYGREKDAREKFEVENEELYQASFKAQFLSGMIMPGMMFVGNLTYVGIAVLGGLMVAAGQIRLGDVQAFIQYSQQFTQPLSQLGGMAAVVQSGTASAERVFALLDADEQDPDAADAPDPDGRGVIEFANVAFAY-TPERPLISDLSFRVEPGQTVAIVGPTGAGKTTLVNLIMRFYELDGGRILLDGQDIADLRRDDVRSRTGMVLQDPWLFAGTIRDNIRYGRESATDDEIVEAAVATRVDQFVLPEGYDTVLDEDAANVSAGEKQLITIARAFVARPSVLILDEATSSVDTRTELLLQQAMAALREGRTSFVIAHRLSTIRDADLILVMEHGDIVEQGTHDELITQHGAYWRLYQ.. 653
72 0.000e+00gi|23098687|ref|NP_692153.1| unnamed protein product [Oceanobacillus iheyensis HTE831]  clstr ali  21  34..TLKRIWKYLAVEKGMLTLVILMVLISSMFALLGPFLVGRAIDNFIITQEVN----GLGYLLLALIAVYIIHSVSLFFQNFWMVGIAQNTVHTLRKNLFEQFHRLPISYFDKRQHGELMSRLTNDIDNINNTLNQSVIQIFSSVLTLVGTLVVMLYLSPILTVVAMSIIPVMYVAMRWITQR-TGPLYKLQQRHLGEVNGYVEEIVSGQHVVKTYSQEKYVTNQFEKRNNELKNTGFWALTFSGFIPKVMNMLNFLSFGLIALVGGILVITSLVTVGTIVIFTEYARQFTRPLNELSNQFNMLLSAIAGAERVFNVMDETEEVDEKDAVTINDTDGQVIFRNVSFGYENNKT--LDNISFEARPGETIALVGHTGAGKTTIINLISRFYNYDSGSITLDGLDIKKIKRSSLRNHMAFVLQDAFLFQGTIRENIRYGKLTASDHEVEEAAKNANAYEFILQEGFDTILDQDGSGISQGQKQLLTIARALLAEPKILILDEATSNIDTITEIKIQEALKRLMKGRTSFVVAHRLNTIREADMIMMMKNGKIIEKGNHHSLMEQKGYYYELH... 600
73 0.000e+00METAHIT MH0012 GL0233053 [Complete] locus=scaffold3020_2:1665:3476:+  ali  21  20..TFVKLLKYMGNYKYAVLVVMLFAVGGTVFNILGPKVLSKATTELFIAGTGGIDFEKIGRILLLLLGLYVLSALLSFVQGYLMTGIAQKLSYRFRKEISEKINRMPMAYFESRTVGEILSRITNDVDTMGQNLSQXXXXXXXXXXXXXGVLVMMLSISPLMTLIALAILPISGGLIGLVI-RFSQKHFVAQQNYLGKINGQIEETFSGQNIIKAFNKEEDTLRDFKETNEVLYASAWKSQFLSGLMQPVMTFVGNLGYVAVAISGSILVIQGVIDVGEIQAFIQYVKNFTQPITQLAQVSNLFQSTAAAAERVXXXXXXXXDVTVENPVKLSHVDGAVSFDHVGFGY-TPDKIVIKDFSCQVKPGQTIAIVGPTGAGKTTMVKLLMRFYDVNKGAIKVDGHNVKEFNRSDLRENFGMVLQDTWLFKGTIMENIRYGKLDATDEEVIAAAKAAHAHHFILPGGYRMELNEDASNVSQGQKQLLTIARAILADNPIMILDEATSSVDTRTEGRIQKAMNNLMKGRTSFVIAHRLSTIKEADLILVMKDGDIVEQGTHEELLRKNGFYATLYN.. 595
74 0.000e+00METAHIT MH0081 GL0069000 [Complete] locus=scaffold21692_3:2317:4056:-  ali  22  2...LKRFISYYRPHRRLFILDMLASLAVSLVGILYPIITRLMLNDLIPE----KRYRTIILCGAGLLLLYIVRMLLNYFIQFYGHVMGVRMQAQMRSDMFRHLERLPYSFYDNHETGKIMSRMTNDLQDISELAHHGPENLITSTVSVIVSFTYLCTINWKLTLTIFICIPF-LLAAALVLRRKMREAFRQSRISIAQINAALESSISGIRVTKAFTNQAKEEEKFEEGNRSYIKARSEAYRAMGQFHSTTSFITDVFNVIVLVAGG-LILFGAMQLGDYTAFVTSISLFITPVMTLINFMEQYQTGVTGFERFVEIMDEPVEQDAPDATPIEAVRGHIEFRDLTYGYED-GKPVLDRISLDIRPGETFALVGPSGGGKTTICHLVPHFYDYTDGGIYIDGRELHSITAESLRRNIGIVQQDIYLFNASIRDNILYGRLDATQTEVEEAARRANIHDYIMEQGYDTVIGERGVRLSGGQKQRLSIARVFLKNPPILILDEATSALDNTTEILIQQALDELCRGRTTIVVAHRLSTIKNADEIAVIADGRVQELGDHDALMKQNGLYRALYD.. 569
75 0.000e+00gi|89096302|ref|ZP_01169195.1| probable permease protein of ABC transporter system [Bacillus sp. NRRL B-14911]  clstr ali  21  33.KTIKKLVSYCRAYLPFIVTALVLAMAASIFSIIGPDLLSRITDLIAEGLMTEINLDEVVSIASILAFLYGLGFLFNYIQGFIMATVTQRVSKNLRSDLSSKMNRMPLKYFDSGSTGDVLSRVTNDVDLIGQTMNQSLSTLVSAITMFLGSLVMMFYTNWIMAVSAILST-LIGFVFMSFLISKSQKYFAQQQAELGRLNGHIEEIYSGHSVVKVYNGEPEAKATFHKINTRLYESAWKSQFLSGLMMPIMMFVGNLGYVVVCVAGAVLAVNGSITFGVIVAFMIYIRLFTQPLSQXXXXXXXXXXXXXXSERVFEFLAEDEENEDNKKTVLNDVKGEVEFKNVRFGY-SEDKMIINDFSALAKSGQKVAIVGPTGAGKTTIINLLMRFYEVSGGEILIDGVPTKELSREKLRSLFCMVLQDTWLFEGTIRENIVYSRKGVSDQEVAEAAKAVGLHHFILPMGYDTILDDK-ANLSAGQKQLITIARAMVKDAPLLILDEATSSVDTRTEVLIQEAMDKLTAGKTSFVIAHRLSTIKNADLILVMKDGDIIESGNHEELLGQNGFYADLYN.. 602
76 0.000e+00METAHIT MH0026 GL0065465 [Complete] locus=scaffold95_12:6535:8379:-  ali  20  38..TWAKLLTNCKKYWGAMIFAIICAGIGTVLTLIGPDKLSKMTDLITEGVMTGIDMDGIKRIGITLICFYGCSALLSLVQNLIMGYVTQQVSKGLRSNISRKINRLPMWFYNQTSTGDVLSRVTNDVDTIAQSFNQSMGNLVTAVTLLLGSLIMMIKTNIIMTVAAILST-LLGFVFMALIMSKSQKYFARQQMHLGEINGHVEEIYAGHTVVKAYNGEKKSKEKFDKMNENLRDSAFKAQCLSGLMMPLMTFIGNLGYVAVCIVGALLVMNDKISFGVIIAFMMYVRYFTQPLSQIAQAMQALQSAAAAGERVFEFTDAEEEDESTKTKKLNDVKGEVSFEHVKFGYKDSDKVVIHDFSAVAKPGQKVAIVGPTGAGKTTMVNLLMRFHEILDGDIKIDGVSIKDMTREEVHDQFCMVLQDTWLFEGTVRENLVYSQENVPEEKIEQACKAVGLHRFILPKGYDTVLNDQ-VNLSQGQKQQLTIARAMIADRPMLILDEATSSVDTRTELIIQRAMDELMKGRTSFVIAHRLSTIKNADLILVLKDGDIIESGTHEELLAKKGFYADLYN.. 607
77 0.000e+00gi|293376864|ref|ZP_06623083.1| ABC transporter, ATP-binding protein [Turicibacter sanguinis PC909]  clstr ali  22  33..TIRRLLGYIGNQKLAIIIVFILCIITTLISVLATRLYGDIIDDYIIPG----DLSGLQRICLMLGGMYVISVLATYIQNLIMLTLSQKTTAKIRRHLFSSLQKLPLRFFDTHSSGDLMSRLTNDVDNINMTLSQSITQLFSGIIMILGMLVAMILLSPALTIVGLLTTPLM-FLVSRFLVKKTQPFFVKQQQDLGELNGYVEEMVSGQKAVFLFSQEEFAEENFATINRKLTKSAVMAQALSGFMGPVNNFINNITFLIVAVFGGIFILSGNMTVGIVFTFILYMRNFTRPINEILNLANTIQSALAGAERVFDIMDEAPEEDLADAKDVENLDGDVILNRVKFSY-DTGKTILKDASIHARRGETVAIVGPTGAGKTTIINLLTKFYDIESGEILIDGENINGMTRKSLRQSISMVLQDTYLFSETVRENIRYGRLSANDDEVIHAAKMANAHQFIMPDGYDTILADNGSNLSQGQRQLLAIARAILAQSSILILDEATSSIDTKTEVEIQKAMLHLMEGKTTFVIAHRLSTIRNADQILVLNQGEIIERGNHDTLLAANGFYANLYN.. 598
78 0.000e+00gi|302038335|ref|YP_003798657.1| lipid A export ATP-binding/permease protein MsbA [Candidatus Nitrospira defluvii]  clstr ali  25  4MKQYLRLLKYLNPYRFRLGAAFLCALLVAGLSAAYAWLVRPVLDGLFI----SKDESLLLVLPIAILAVAVLKGVFNYGQNYLMNYVGNQVIGDIREQLFSKLVRLPVHFHDTNTSGRLVSRVINDVNQMANAVAGVLKDLFQQGLTFLAMIGVIIYQNWKLAAVSMIVVPLSVVTMAR-MGKRLRNLATRGQERMGDMASTLQETLAGIRMVKSFGREEEEAKRFRLSNDAFIHTTMKAIQVSSLGSSHMEVIGVLGVAGIIWYGGYLVIHDEMTPGAFFSFLAAMFMAYTPIRRLSGANNTVQQALAAAERVFDVLDLPTEQEDNGGRELPAISRSLEFRQVAFQYEGQSEPALSGIDLTIRAGEIIAFVGSSGSGKTTLVSLLPRFYDPTGGQILIDGVDLQTCSLRSVRGQIGIVSQEVVLFDDTVRNNIGYGRQGATPDDVMRAAQLAYAHEFIMPAGYDTLIGERGLKLSGGERQRLAIARAILRDPPILILDEATSALDTQSERIVQLALTNLMHNRTTLVVAHRLSTIQNASRIVVLDRGKVAEVGSHEELLRKGGMYKRLH... 571
79 0.000e+00gi|160942922|ref|ZP_02090161.1| hypothetical protein FAEPRAM212_00399 [Faecalibacterium prausnitzii M21/2]  clstr ali  22  20...IRRFLPYLANYKMVLCLDLFCAALTTLCDIVLPKIMS-IITNSAMGVGITLTAGIVLKLAALYFVLRIIDGAASYYMSSIGHIMGVHIETDMRRDAFDHLLQLDHTYYNNTKVGTIMGRITNDLFDVTEFAHHCPEEFFIAGIKIVASFVILCRASIPLTLAVFACVPLMG-VVSVYLNGRLRARFRQQRVQIGELNSTIEDSLLGQGVVKAFAAEDEEREKFAKGNRAFEQIKTLGYYAMGAFNTSTRLFDGLMYLVVILAGGLSLVYGKITAGDLVAYMLYVTTLIATIRRIVEFAEQFQRGMTGIERFAEIMDTPVAIKDPDAVPLQPGPGEIRFEKVCFEYPDDHNKVLHDVSLDIRAGERLALVGASGGGKTTLCNLIPRFYEVTSGRILIDGQDIRRVTLKSLRQDIGIVQQDVYLFSGTVAQNIAYGKPGATRQEIEAAARLAGAEKFILKDGYDTYVGERGVKLSGGQKQRIAIARVFLKNPPILILDEATSALDNESEILVGQSLEKLAHGRTTLTIAHRLTTIKDYDRILVLGEDGIVEEGTHAQLLEKQGVYYRLWNQL 590
80 0.000e+00gi|269794270|ref|YP_003313725.1| multidrug ABC transporter ATPase/permease [Sanguibacter keddieii DSM 10542]  clstr ali  20  66....KRLVGLLAPERVRMXXXXXXXXXXXXXXXIAPRILGRAMDTIFNGPGQGIDFDRLGRLILVVLALYVVASILSWAQGYILNGLVMRVVYRLRQDIEDKINRLPLSYFDTRQRGDLMSRVTNDVDNIQAALQQAFSQLVQSVLTVLGITAMMFIVSWQLALIALIALPLSG-VIAGVIGTRSQKLFAAQWKNTGSLNGHVEETYSGLELVRSFGRDEEMLEEFDERNEKLYQASFGAQFVSGMIMPAMTFVSYLSYVLIAVVGGLRVASGQITLGDATAFIQYSREFSQPLGQIAGMANMLQSGVASAERTFELLDADEQDPERATATLPRTEGLVQLEDVSFSY-DPTTPLIEHLSFSAQPGHTVAIVGPTGAGKTTLVNLIMRFYELTGGRILLDGVDITALSRGELRSQVGMVLQDAWLFEGTIRENIRYGRLDATDDEVVAAAEATMVDRFVLPDGYDTVLDADGGSVSAGERQLLTIARAFIANPSLLILDEATSSVDTRTELLVQHAMAALRTDRTSFVIAHRLSTIRDADTILVMEDGRIVETGTHDGLLEQGGAYYRLYMT. 671
81 0.000e+00gi|317473070|ref|ZP_07932369.1| ABC transporter [Anaerostipes sp. 3_2_56FAA]  clstr ali  21  30..TIKKLLKYMRRYYGAIAFVILFAIASTVFNIVGPTILGNATTEIFVQGTGGIDFSKIRGILLTLLGLYLTSAAFSFLQGLIMTHVSNNTTYQMRKDISEKIHRMPMKYFESRTFGEVLSRITNDVDTLGQSLNQSMTQIITSVATIIGVFVMMIRISVPMTVAVVVILPVSFLMIGAIM-KKSQPYFQAQQALLGEVNGQVEEIYSGHNIVKVFNKEKSVVEEFEKVNGKLYNSAWRSQFFSGAMMPLMQFVGNLGYVVVAILGGFLAIKNTIEVGQIQSFIQYVRNFTQPITQLAQVGNMMQTTAASAXXXXXXXXXXXXXXXXXNPVVSSLDGNVTFEHVSFGYNEKQR-VINDFSVEVKEGQKIAIVGPTGAGKTTMIKLLMRFYDVSGGSIKIDGYDVRDFKRSDIRQMFGMVLQDTWLYNASVRDNIRYGKLDASEEEIQGAARAAFAHHFIEPKGYDMIINEESNNISQGQKQLLTIARAILADPKILILDEATSSVDTRTEERIQKAMDNLMEGRTSFVIAHRLSTIKDADMILVMNHGDIVEQGNHEELLAKGGFYANLYN.. 605
82 0.000e+00gi|159036442|ref|YP_001535695.1| unnamed protein product [Salinispora arenicola CNS-205]  clstr ali  22  51....RRLLGRLRPHRLHLAGVLALTVLGVGLNVIGPKVLGHATDLIFAGVLGGQLFADIITRMGVVPGVGIXXXXXXWWQGWLLTGVAQRTVHRLREDVAAKLNRLPLPYFDRQPRGELLSRVTNDIDNISITLQQTMSQLLTSLLTVVGVLAMMFWISPLLALVALVAVPLSVIVTQQI-AKRSQRKFVAQWTHTAELNGQIEEAFTGHELVKVFGRQRAVQAAFSAKNEQLFQASFGAQFISGIIMPAMMFIGNLSYVAIAVLGGLRVASGTMTLGDVQAFIQYSRQFTQPLTQVASMANLLQSGVASAERVFAVLDAEEQTPDPATPELTEPRGRVAFEHVSFRY-APDEPLIEDLSLTAEPGQTVAIVGPTGAGKTTLVNLVLRFYELNGGRITLDGLDITRLDRDDLRGHIGMVLQDTWLFTGTIRDNIAYGRPDATEEEILAAARATFVDRFVLPDGYDTVIDEEGGNISAGERQLITIARAFLAEPSLLILDEATSSVDTRTEVLLQRAMAALRSDRTSFVIAHRLSTIRDADLILMMVGGRIVEQGTHDELLAADGPYARLHQ.. 655
83 0.000e+00gi|224540862|ref|ZP_03681401.1| hypothetical protein CATMIT_00005 [Catenibacterium mitsuokai DSM 15897]  clstr ali  21  10......FISYFKPHRRLFFLDLACALMISLIDLAFPFVSRWCMYTLL----PNSIYKTFWMVMIIFLLAYLVRSFFTYIICYYGHTFGILVEADMRKDLFEHMQSLSYGYFDNNRIGQLMSRLTTDLFDITELAHHGPEDLFISTVTIIGSIIIMFTIEWRLALVIAIMIPVFILVV-WKSRHSMSEASIRVKQKVAVINTDIESGLTGMKTAKAFANETIEQQKFNTSNDTYKTSKKQFHKAMGRFNAIMEFFMCTLSLIVIAVGGALIMQGKMDTIDLITFSLYVSTFVNPVRKLSNFAELFANGTAGLHRFVELLNTKPQLEDRDAKELTHVSGQIDIDHVSFAY-EEDRNILTDIDLHIHPGETIALVGSSGGGKTTLSQLIPRFYDVTEGAILVDGHDVRDVTQTSLHNNIGVVSQDVFLFADSIAENIRYGKLDATMEDIIEAAKLAEIYDDIMPDGFETNVGERGVLLSGGQKQRISIARIFLKNPPVLILDEATSALDSVTEAKIQETFDKLSQGRTTIVIAHRLSTVKNADRIAVIDEGRIIELGTHHELLENNGAYAQLVHT. 572
84 0.000e+00gi|251796687|ref|YP_003011418.1| ABC transporter [Paenibacillus sp. JDR-2]  clstr ali  22  22...MKRLLGYLKPYRKTLTIIIGVVLVNMILSLAEPLLLGYLIDDGITKG----DFHAIHLFGITLLGIKLIGWGCGWVHTKYINFTGQRILYDLRQQLFNHLQKLSFRFFDGRPAGKIMSRITNDTNAIGELINGGLITTVMEVTHLVGIVAILLWMDWKLALLSFIMMPLLYLIVNRLRPR-IEGAWTRSRKTMSAINGHLNETIQGIRVVQAFSRQHKNSARFEGINFRNKQAFMRAIMLESTVYPLVELVGMIGTCIVVWFGAKQVMDGALTIGFVMAFINYLWRFWGPLSALSKVYSQVLSAMASAERIFEILDTDAEVTDAAARRMPAIRGEVAFENVSFRYEESKPDVLHNVSFKVRPGQRVALVGPTGAGKSTIVNLLMRFYDATGGKVTIDGLDVKDVTLESLRRQMGIVLQDSFIFSGTIEQNLRYGNDGATMEQMIQASESVRLDRVVMNEGYDTEVEERGSKLSVGQRQLLAFGRVLLSDPRILILDEATSSVDTETEQHIQEALETLLNGRTAFIIAHRLSTVRDADLILVVQDGRIAEQGSHNELMKQGGLYAKLVNT. 588
85 0.000e+00gi|307290314|ref|ZP_07570229.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0411]  clstr ali  21  2...LKRFFGYYRPYRRLFILDFGCAVFAGLLELAFPVAVNQVIDKIMPKG----DFRLIALASAGLFAFYIINTFLQFIVVYFGHMLGVNIETDMREELYQHLQTQPFEYYDNQKTGKLMSRLTTDLFEISEVAHHGPEDVFITIMTLAGSFLLMLTIHVKLAIATFILLPFITIALG-YFNKKMTKANTDIYDNLGEFNAGIEASVSGIRVTQSFANEPFERKQFNYLNQMYRKSKLYFYKVMGVSSAYNYLLIRLINLFSLIFGAYYTIKGEITEGQFVGFILLANIFIRPIEKVNNMIESYPKGFAGFKRFTEEMDKQPSIKDPGAVAVSHLEGTIAYKDVSFAYEN-GTKVLDHINLKIQPGETVAFVGQSGSGKTTLCNLLPRFYEVSSGEITIDDRNIQQMTLVSLRKQIGIVQQDVFLFPGTLRENIAYGNLNATEIDIQQAVKLAHLEHVIMPDGLDTIIGERGVKLSGGQKQRVAIARMFLKNPPILILDEATSALDTETEQVIQESLNSLADGRTTLIIAHRLATIKHADRIIVVSDQGILEDGTHETLYAQRGHYRRLYDA. 568
86 0.000e+00gi|320535289|ref|ZP_08035411.1| ABC transporter, ATP-binding protein [Treponema phagedenis F0421]  clstr ali  22  1.....................................MVRNITNKAIW-DISTLTMDFVIKICIIYFLLRLVDTAANYYMASVGHIMGAKIEKDMRRDLFAHLQKLSFSYFDNTKIGQIMGRITSDLFEIAEFAHHCPEEFFIAGVKILISFIILCQANILLTVIVFSVIPLMIIS-TVYFRRRMRLAFKRSREQIGDLNARVEDSLLGVRVVRSFANEETEEQKFERGNNGLLNIKRYQYRYMAGFKAVTQFFDGLMYVTVLLCTAYFLIKGKITAGDMIAYMLYVSMLLASIKRIVEFAEQFQRGMTGVERFIEIMDAKVEITDEGATEIKDAKGDILFDKVSFQYPEHDKVVLSNIDLHVRPEQKIALVGPSGGGKTTLCNLIPRFYEVSKGRILLDGKDIRDITQESLRSQIGVVQQDVYLFSGTVSENIEYGKIGASREEIIEAAKKAGAHDFIMEDGYDTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNENERIVQKSLETLAKGRTTFTIAHRLTTIRNADTILVLTENGIEESGSHETLMKKKGRYYSLYQ.. 535
87 0.000e+00gi|328956350|ref|YP_004373683.1| ABC transporter [Coriobacterium glomerans PW2]  clstr ali  22  2...FRRFISYYRPQRLLFAADTVCALVMAGIDLAFPSILR-ALTGGLFTRDSDAITGALGYIAAGLICMYALRCGCRYFVSAQGHVMGARMESRMRQDLFDQYERFSFSYFDRVNSGDMMSRVVNDLFDICEAAHHVPEWIVICGTEIIGAFVILFLISQTLAAVMAAVT-LIFVIVMVRQNLTMRAVYTDNRIKISEVNSQLQDSLAGMRVVKSFANEETERRKFYRSNDRYLGSKESMYKVMGTYQTTSALMTGSLYTIIVVLGGYLVAQRSMSPVDMATFALYITLFTGPIETLVNSTEVFQKAIAGFRRMDEVLESMPEIKDPGATDLVVRRGAIEYRDVSFSYENRERPVIDHMNLAIAPGETIALVGPSGGGKSTTCALLPRFYDVSAGAITIDGQDVRDVTQESLRRSIGLVQQDVYLFDGTIRDNIEYGRPGATDEEIADAARKANIHEFILEDGYDTVVGERGGRLSGGQKQRIAIARVFLKDPAILILDEATSALDNESEEAVQDSLEHLAENRTTVIIAHRLSTIKHADEIVTVEHGQVVERGTHEELLARGGTYARYYR.. 577
88 0.000e+00gi|89894006|ref|YP_517493.1| hypothetical protein DSY1260 [Desulfitobacterium hafniense Y51]  clstr ali  19  35..TWGKLIRYCKGYMPVIITALVIAALGTLLQIIGPDQLKNMTNEITVPVSGAIDFNAVFNIGMLLVCFYAASGIFSFAENFIMATVTAKISKSMRTDIAKKINKLPLKYFDKTSYGDVISRVTNDVDAIGQTLNQSLDNLVRAVTMFVGSLIMMFYNSWILALVAIGST-LIGFVLMALIMSKSQKYFTVQQQGLGDINGHIEEIYSGHNVVKAYNGGSKAKKTFEEINTSLYDSGWKSQFMSGMMMPIMGFIGNFGYVAVCVVGAALAMKGTISFGVIVAFMIYIRLFTQPLSQLAQSMQQLQRTAAASERVFEFFAEEELAGESQQKKLENVKGHVEFQNVHFGY-EKDKTIINNFSAQIRAGQKVAIVGPTGAGKTTMVNLLMRFYEIDSGEIRIDGIPISHVSRENVHDQFCMVLQDTWLFEGTIKENIIYNKQGVTDEEVIAACKSVGIHHFILPQGYDTILNDK-ANLSAGQKQLVTIARAIIQNSPLLILDEATSSVDTRTERLVQDAMNKLTQDRTSFVIAHRLSTIKDADLILVMKDGDIIESGDHEELLGKGGFYAELYN.. 612
89 0.000e+00gi|238062647|ref|ZP_04607356.1| ABC transporter transmembrane protein [Micromonospora sp. ATCC 39149]  clstr ali  22  65..................AAIVLLSLVSVGCNVYGPKVLGHATDLIFSGPGVGIDFTALGRVLLFVLALYLAASVLLWWQGWLLNGVVQRTVLRLRADVEDKLNRLPLPYFDRQPRGELLSRVTNDIDNISQSLQQTLSQLLTSLLTVVGVLAMMFWISPLLALVSLVAVPMSVVVTSLV-AKRSQQRFIAQWTHTGELNGQIEEAFTGHELVKVFGRQREVEAAFTAKNEELFRASFGAQFISGIIMPAMMFIGNLSYVAIAVVGGLRVASGSMSIGDVQAFIQYSLQFTQPLTRVASMANLLQSGVASAERVFAVLDAEEQSPDPAVPRVADQRGRVEFDHVSFRY-EPDKPLITDLSLVAEPGHTVAIVGPTGAGKTTLVNLVMRFYELDAGRITLDGVDITTLSRDDLRGRIGMVLQDTWLFGGTIRDNIAYGRPDASEEEIVAAARATFVDRFVLPDGYDTVIDSEGSNVSAGEKQLITIARAFLAEPSLLILDEATSSVDTRTEVLLQRAMAALRSDRTSFVIAHRLSTIRDADLILMMEHGRIVEQGTHEQLLAARGAYHRLYQA. 656
90 0.000e+00gi|299537410|ref|ZP_07050706.1| putative multidrug export ATP-binding/permease protein [Lysinibacillus fusiformis ZC1]  clstr ali  24  1MGSIKRYMRFVKPYTWEIILTIIIGIVKFAIPLFIPLLIKIVLDDIIAADDVEKTKELFYWLGGTIIVFFIIRPPIEYYRQYFAQHVSNKVLFDIRKEIYAHLQRLSLRYYANTRAGDVISRVINDVEQTKTFVMTGLMNVWLDLATIVIAIAIMLTMDVKLTLVALIAFPFYAFSVKYFFGK-LRDLTRKRSQALAGVQSYLHERVAGMSIIKSFTLEKHEQKLFDSANGEFLEKALDQTKWNAKSFAVVNTITDVAPLLVIAYAGYQVINGSLSVGTMVAFIAYIERLYGPLRRLVSSSTTLTQSIASMDRMFDLIDEPYEVKDKDNAELPRANGQVSFHNVSFQYEEAGSPIIDAIDLTINPGETVAFVGMSGGGKSTIISLIPRFYDTTSGQVTIDGKDVRDVTLHSLRSQIGIVLQDNILFSDSVKENILMGKPDATDAQVIEAAKAANAHDFIMPNGYDTKVGERGVKLSGGQKQRVAIARVFLKNPPILILDEATSALDLESEALIQESLDKLAHERTTIIIAHRLSTITHADKIFVIDHGQLIESGTHEQLMDSQGTYYNLFQ.. 576
91 0.000e+00gi|261406131|ref|YP_003242372.1| ABC transporter-like protein [Paenibacillus sp. Y412MC10]  clstr ali  23  46...LTRLISYMKPYAKQILLIGLMMIIGTITKLAIPFLTSLAIDQAIDPKEGNPSLTLLYQITIAVLAMYIIQWVAGIFRIKFTNIIGQRVIYDLRADLFQHIQRLSFNFFDKRPAGSVLVRVTNDVNSLQDLFTNGVVNLIIDCVQLVGIVVILLLINWKLGLAVIVTVPIMFF-ISTKLRVRIRRAWQEVRIRNSRINSHLNESIQGIRVTQAYTQEEENMKFFDNMNLDSKKSWDRASAMNQGFGPLIEITGGFGSLILFWLGAVLIQQGELTIGLLIAFTQYVGNFWEPINRLGQMYNQLLVAMASSERIFEFIDEKPSIDDPGAKKLPTIKGDIKLENVVFEY-EKGRQALKGINLDVKAGQSIALVGHTGSGKSTIINLLSRFYDITDGKLTIDGYDIQTVTVESLRNQIGIVLQDTFIFSGTIRDNIRFGRLDATNEEIEDVAKAVGAHEFIMPGGYDTEVEERGNMLSMGQRQLLSFARALLADPRILILDEATASIDTETELKIQSALKVLLQGRTSFIVAHRLSTIRHADHIVVLDHGKIIEEGNHDQLMQKQGTYHGLIEA. 616
92 0.000e+00gi|226326071|ref|ZP_03801589.1| hypothetical protein COPCOM_03889 [Coprococcus comes ATCC 27758]  clstr ali  22  5.SVMKKLFKYIGKYWILLILSIILAGISVVLQLYVPVLFGNAIDEIVAAH--NVDFTQMWLYLKQILLFVVIAAAAIWIMNLVNNRMTYHIVQDIRSQAIRHIQKLPLSYLDQHSTGDIVSRIIADTDILSDGLLLGFTQLFSGVVTVVVTLIFMFSKNVWITLMVILLTPLSFLVAKFISSRSF-TMFKKQSETRGKQTALIEEMIGNQKVVKAFGYEDKASKRFDEINKELKEYSQKAVFYSSLTNPSTRFVNNIIYAAVALAGAFLIPLGTLTVGGLSVLLSYANQYMKPFNDITSVITEMQNALACATRIFDLLEEPEEVND-SSEVLEKVDGNVDIDHIDFSY-DKSKSLIEDFNLQVEPGMRIAIVGPTGCGKTTFINLLMRFYDVDSGKICIDGKPIDELSRHSLRKSFGMVLQDTWIKSGTVRENISFGKPDATDEEIIWAAKEAKSWDFILPQGLDTVLHED--SISQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTELQVQEAFDNLMKGRTSFVVAHRLSTIRNASLILVMKDGKIIEQGTHEELLKEGGFYSHLYN.. 569
93 0.000e+00gi|237735114|ref|ZP_04565595.1| conserved hypothetical protein [Mollicutes bacterium D7]  clstr ali  21  15.KTIKRLLTYCRPYRVILGLIFILSFISVCLTLITPILFGQAIDLLI--GIGLVNFSRLFWQLLVIVGVVLAGALVQWILGQLTNKITYNITNDLRDRVFEKIHLLPLKYIDSTPHGDIIGRVINDIDLIAAGLLQSFTSLFTGVATIVGTIIIMCLINLSIAIVVIVLTPLSLLVASLIV-KRTHIYFKEQLELRGEMNGYIEEMIGNQRIIKAFNYEQMNEERFKEVNQRMHVSGVKSQFYGALINPTTRIVNSLVYGAVGVFGAISVLNGSFTVGLLSSFLTYANQYTKPFNEISSVMTEMQTALAASQRVFNLLDEPVEKPVSNPQNVEIMEGNVSLKNVYFSY-DPKVSLIENLSLEALPGQTIAIVGKTGCGKTTLINLLMRFYDQNSGSIMVDNVNTLDMERDYLRRMYGMVLQESWIFKGTIKENIAYGKSDATDEQIIAAAKKARVHKFIMPEGYDTMIDEDGGNISQGQKQLICIARIMLTKPPMLILDEATSSIDTRTELQIQEAFETMMKGRTTFIVAHRLSTIKNADMILVMDKGHILEQGTHQELLEKQGYYYNLHN.. 582
94 0.000e+00METAHIT MH0012 GL0161035 [Complete] locus=scaffold25218_3:3691:5487:+  ali  23  15..TLVKVLKYMKPYCFWLIAAIIMAAVSVVFTLYLPILTGDAVDVLIETVDSNFDWWYILRLLVKMGVVILLTAAAQWIMSLCNNHIVYSIIEDIREKAFDKIQKVPLKYLDGHSHGDIMSRVVADVDTFADGLLLGFTQLFTGVITILGTLLFMLSENVGITAVVVLITPVSLFVASFI-AKKTFRMFQLQSTTRGEQTTLINEMITNHKEVKAFGREAAVMEDFDEINGRLEKCSLRAIFFSSLTNPCTRFVNSLVYMGVGLTGSLAVIRGGLTVGQLTCFLSYANQYTKPFNEISGVITELQNALACAARIFELIEEEPQIPDADARVLTDVDGAVSLNKVSFSY-SRDRKLIEDLNLDVKPGQRIAIVGPTGCGKTTIINLLMRFYDVDGGSISVEGTDIRDITRKSLRTSYGMVLQETWLKQGTIRDNIIVGKPDATDEEVIAAAKASHAHSFILPEGYDTVISEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEIRIQKAFATMMEGRTSFIVAHRLSTIQNADVILVMKDGHIIEQGNHEELLARKGFYAELYN.. 592
95 0.000e+00gi|309390006|gb|ADO77886.1| ABC transporter related protein [Halanaerobium praevalens DSM 2228]  clstr ali  20  2...LKKFFSYYKNHWQLFLVDISCALLMSGIDLVYPVYVQRLIDDYFPQ----KNAEMMIKIGIILLLLYALRFVFQYIVHYWGHVVGIRMETDMRSDLFTHLQKLSFKFYDNNKVGYLMSRVVNDLNNISELAHHGPEDILISIMLLIGSFIILIKMHLQLALVTFALIPIMFF-FSLHLGEKMYHAFKLIREKMAEVNTIIEDSLSGIRVVKSFTNEDFENQKFCEGNHNYRRSREWAMKNMAQFHSGMNLFINLIRLSTLSVGGYFIYQGSLSVGQMVAFLFYVNMFMNPIRRLVNFNEQLQRGMSGFSRFQELLEVDPEIKDPEAQVLKDVQGLIKYEAVSFSYDNQEK-VLTNVNIEIEPGNTVAFVGPSGAGKSTLTKLLPRFYEIDSGRLSIDQIDIQAVTLKSLRSNIGIVQQDVFLFNGTVKENIAYGTTNPSDEEIIAAAKKANAHHFILSEGYETDIGERGVKLSGGQKQRVSIARSFLKNPPILILDEATSSLDNRSERIIQQSLEKLAAGRTTLVIAHRLSTVVNADQIIVLTEKGIVEKGTHSQLIKSGGEYSKLYD.. 566
96 0.000e+00gi|170747727|ref|YP_001753987.1| ABC transporter-like protein [Methylobacterium radiotolerans JCM 2831]  clstr ali  23  2...LKAFLAYYRPYRTLFLVDFGCAVLSGLLELGFPIAVKGFIDSLLPRQDWGLILLAAAALTL----VYVANAGLMVVVTYWGHVLGINIETTMRARAFDHLQKLSFRFYDGQKTGHLVARVTKDLEEIGEVAHHGPEDLFIAVMTLLGAFALMLYVHAPLALITAAILPLIAFVSIRYGGRMTRN-WQAQYGRVGAFNARIEENVGGMRVVQAFANEPHERALFALDNARYRDTKLEAYRLMAAGLSINYLGLRLVQIAVLLGGAAFVVRGDLTPGGFVGFLLLVGVFYRPLEKIGAVVETYPKGVAGFRRYQELLATEPDITDPEARAVGALRGDIRFEGVGFGY-GPGRPVFSGLDLAVAAGETVAFVGPSGVGKTTLCALLPRFYEVEAGRITVDGLDIRDITLASLRRQIGIVQQDVFLFAGTIRENIAYGRLDATEAEIDAAARRARLGGLILPEGLDTVVGERGVRLSGGQKQRIAIARVFLKNPPILILDEATSALDTETEREIQRALAELARGRTTLVIAHRLATVRDADRIVVLGEGGVVEEGRHAALLAAGGPYSRLHAA. 567
97 0.000e+00gi|343524005|ref|ZP_08760965.1| ABC transporter transmembrane region [Actinomyces sp. oral taxon 175 str. F0384]  clstr ali  22  79..SFKRMVGLLGAYRVSLMIVALAAVGTVVLAVAAPKVLGQATNVIFEGPGAGIDYTRLGRILTVVLGLYVGSSLLNWLEGWLINRITIKALYRLRAQVEDKVHRLPLSYFDTVQRGELLSRLTNDVDNVTNTLQQSLSGALTAILTVVGVLGMMFSISWKLALVALIMFPLMGVVFGVI-GPRSQKAFTHQWARTGKINTRVEESFSGHALVQVYGRTASVREAFAAENEELFRASLRAQFLSGIMMPIMLVIGNINYVAIAVVGGAMVASGSLRLGDVQAFIQYSQQFSQPLGQLGGMATAVQSGTASAERIFELLDAEEERPDDVAPKSTGAAGTIEMEHVRFSY-SPEVELIRDLSLRVDPGHTVAIVGPTGAGKTTLVNLLMRFYELDGGRILIDGRDIATMTRHDVRRRTGMVLQDPWLFAGTIRENIRYGRPRASDEEVEAAARACFVDHIILPQGYDTVLEEDAANISAGERQLLTIARAFVANPAVLILDEATSSVDTRTELLVQQAMNALREGRTSFIIAHRLSTIRDADTILVMEHGDIVEQGSHDELIAAGGAYARLHAA. 702
98 0.000e+00gi|182419589|ref|ZP_02950836.1| lipid A export ATP-binding/permease protein MsbA [Clostridium butyricum 5521]  clstr ali  20  2...LKKFISFYKPYRSLFVLDLIAAFIASMCDLVYPMMTRDLLNDSI----PNKNLKMIGMFAVVLIIIFIIKAACGYFMQYFGHVIGVKMQGDMRRDVFKHLQKLPNSYFDNNKTGDIMSRIINDLMEISELAHHGPEDLFISIVMLIGSFIILCNINIPLTILIFAFIPFIVI-FTIFERKKMNDAFMNTKVETGAVNAALENSISGIKISKAFVSHKSEEEKFEEGNEKFMNARKKSYKVMAEYFSGSGFGLDILNYVGLIGGGLFTFKGIIDIGDFMAYMLFIKMFTQPIKKLIDFMEQFQNGITGFQRYMEIMNHEAETDKEDATELKDVEGEIEFKNVDFSY--EGKQVLKDISIKIEKGKMLALVGASGGGKTTFCNLIPRFYEIDSGDILIDGKSIYDVKANSLRSNIGIVQQEVFLFTGTIKENILYGKSNATDEELIKAAKMANIHEFILPEGYDTYIGERGVKLSGGQKQRISIARVFLKNPSILILDEATSALDNVTEKIIQESLEKLCQGRTTIVVAHRLSTIKNADEIVVMGNNGIIEKGSHNELIESGGEYSTLHK.. 564
99 0.000e+00METAHIT MH0077 GL0081301 [Complete] locus=scaffold48154_2:1391:3124:-  ali  22  6..TIKKVLHYIRRYRFFLIVSLVLALITVVLTLYVPILTGQAVDLIVGKGQ--VDFAGVYHICVKIGIAILLTMVAQWVMNVANNKITYSVVRDIRTDAFEKIQVLPLSYIDSHSYGGIVSRVIADADQFADGLLMGFTQLFTGVITILGTLGFMLSVSVPIALVVVVLTPVSLFVAAFI-AKRTYQMFRMQSETRGEQTALIEEMIGNQKVVQAFGQENEVGDRFDEINDRLSKYSLQGTFFSSITNPSTRFVNALVYAAVGVFGAFFAIQGGISVGQLSCFLSYANQYTKPFNEISGVVTELQNAIACAGRVLELIEETPEIPDEDAIKLGKADGKVEIEDVYFSY-EPNQKLIEHFNLQVKPGQRVAIVGPTGCGKTTLINLLMRFYDVNSGAIKVSEKDIRKVTRESLRANYGMVLQETWLKQGTIRENIVMGRENATDDEVLAAAKASHAHSFILPNGYDTVIGEDGGSLSAGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEMRIQKAFATMMQGRTSFLVAHRLSTIQEADVILVMRDGKIVEQGNHEELLAANGFYKNLFDA. 574
100 0.000e+00METAHIT MH0053 GL0053991 [Complete] locus=scaffold7744_2:3648:5402:-  ali  22  10..TLKKVLHYVGRYKPPLAFSIILAAVSVAATLYIPVLAGRAIDNIVDER--NVDFAALKPLLIGIGILAAVTALAQWIMNALNNKITFCVVRDIRNAAMRRIQILPLSYIDSHPAGETVSRIIADADQLADGLLMGFTQLFTGVITILGTIGFMLSINVKITLVVVLLTPLSLFV-ARFIARRTYSMFRAQSETRGEQTAFIEEKIGSQKVVKAFTREAKTLEEFDEINDRYAKRSLKAIFFSSITNPSTRFVNSVVYAAVGLTGALFAVKGAISVGGLTCFLSYANQYTKPFNEISGVVAELQNALACAERLFELVEQPPQSPEKDAVTLTDAKGNVAMQNVAFSYV-KDRELIKNLNLNVKAGSRIAIVGPTGCGKTTLKNLLMRFYDVDGGVIAVDGIDINDITRSSLRRSYGMVLQDTWLKDGTVRENIAMGKPDATDEEIIAAAKASHAHSFIMPQGYDTVISDENSGLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEIKIQQAFSRMMQGRTSFVVAHRLSTIKNSDLILVMKDGSIIEQGTHAELMEQNGFYAALYN.. 577
101 0.000e+00gi|345022195|ref|ZP_08785808.1| ABC transporter ATP-binding protein [Ornithinibacillus scapharcae TW25]  clstr ali  23  1MSSIKQYMEYVKPYKWKIFWTIIIGIIKFAIPLLIPLILKYVIDDIIGHDTWNKITHLFWIMGISFLVFLILRPPIEYIRQYLAQWVGNKILYDIRARLFEHMQKLSLRYYSTTKTGEIISRVINDVEQTKNFVITGLMNIWLDLITILIAIGIMMSMDFWLSIVSIILFPLFGFTIKYFFGR-LRSLTKERSQALAEVQGHLHERVQGISVTKSFALEEHEQIHFNQQNKKFLDKAIEHTIWNAKTFAATNTITDLAPLLVITYSGYQVISGNLTLGTMVAFFAYLERVYSPLRRLINSSTVLVQSIASIDRVFEFMNEPYDIVDPTAIKPERVNGEIHFQDVSFQY-DDGLDVLKHINLNVKQGETIAFVGMSGGGKSTLISLIPRFYDVTGGSIKLDGIDIRDFQLHSLRDNIGMVLQDNILFGDTVAMNIRMGNPEATDEEVIEAAKAANAHDFIMPEGYHTLVGERGVKLSGGQKQRVAIARVFLKNPPVLIFDEATSALDLESEHMIQEAMEKLASDRTTFIVAHRLATITHADRIVVIENGEITEVGSHNELMEKKGSYYDLYQ.. 575
102 0.000e+00gi|89896557|ref|YP_520044.1| hypothetical protein DSY3811 [Desulfitobacterium hafniense Y51]  clstr ali  22  33..TMGKLLRYCQQYLPAMVIALLFAAIGTLLQIIGPDKIKDLTNEIAVPVLNSIDMTAVANIAWLLVLFYATSMLLSFVQSYMMATVTQKVSKKMRSDISQKINRLPLKYFDQTSYGDVLSRVTNDVDAIGQTLNQSIGSLVTAITMFVGALIMMFYNNWILALTAIGASLLGFILMTFIMSK-SQKHFVSQQNGLGAINGHIEEMYAGHNVVKVYNHSKASKATFEDINGKLYNSAWKSQFLSGLMMPLMSFVGNLGYVAVCVVGAVLAMNGTITFGVIVAFMIYIRLFTQPLSQIAQAFNNLQRTAAASERVFEFLGEAEMADERDKVKLEDVRGDVEFSHVKFGY-SPDKTIIHDFSAKVKAGQKIAIVGPTGAGKTTIINLLMRFYELDGGEILIDGTPISQVHRENVHEQFSMVLQDTWLFEGTIKENIIYSQQGVTDEQVIAACKAVGLHHFILPEGYNTVINDN-VSLSEGQKQLITIARAMIADTPLLILDEATSSVDTRTERIVQEAMDKLTRGCTSFVIAHRLSTIKNADLILVMKDGDIIESGNHEQLLAKNGFYAELYN.. 610
103 0.000e+00gi|335038577|ref|ZP_08531807.1| ABC transporter related protein [Caldalkalibacillus thermarum TA2.A1]  clstr ali  25  1MESIKRYFQFVRPYWKMIGITILVGILKFGIPLLLPLLLMYVIDELIQASQGERLNQLVLVMAASFFIFTVIRAPVEYYRQFFAQWVGNKILYDIRARLFEHLQKLSLRYYHNRKAGEIISRVINDVEQTKNFVMTGLMNLWLDFVTLFIAVGIMFYLDARLTLVAIAVFPLYGFAVRYFYQR-LRMLTRKRSQALAELQGHLHERVQGMAVTQSFALEEHEQQQFAKRNDHFLDRALTHTSWNAKTFAVINTITDLAPLLVISYGGYLGIQGQLSPGALAAFYGYLERIYGPLRRFVNSSTILTQAIASMDRVFELLDEPYEITDPGARTARNIKGEVSFEQVSFRYHEDSPYVLKNINLHVQAGETVALVGMSGGGKSTLISLLPRFYDVTAGSIRLDGVDIRDYQLRSLREQIGMVLQDSILFSDSVRENIMMGNPQASEEEMVQAAKAANAHEFIMPHGYDTEIGERGVKLSGGQKQRIALARLFLKNPPVLVLDEATSALDLESERMIQEAIEKLAKNRTTFIVAHRLSTITHADRIVVIENGEIVEEGTHESLMTKQGTYYRLYQ.. 576
104 0.000e+00gi|310657409|ref|YP_003935130.1| lipid ABC transporter ATP-binding protein [Clostridium sticklandii DSM 519]  clstr ali  21  16...FKRFVPYFSKYKTTLYLDLFFASLTTLCELALPLILRKIATVG-MEDAALLTKELIWQMAGIYFVLRIIDVLGNYYMSSVGHIMGAKIETDMRRDAFSHLQNLSDSFYNNTKVGQIMARITSDLFDVTEFAHHCPEEFFIGALKLVISFAILAKIDLVLTMAIFIFIPIMLVSVTK-FNRLMRSAFKSQRNHIGDLNAGIEDALLGMRVVRSFANEEIEKEKFERDNQKFLGIKKQAYKYLAGFHSMTRIFDGIMYLMVILLGGFFILNGRINAADLLAYIMYVTTLLATVRRIVEFMEQFQRGMTGIERFIEIMDTDVDIKDPDAVELKHVDGKITFDNVSFEYPDDHNKVLSKLSFVVEPGENIALVGPSGGGKTTLCNLIPRFYDVTEGNISIDDSNIKNFTLNSLRSKIGMVQQDVYLFSGSVFENIEYGRPGASKAEVEYAAKLAGAYDFIMNDGFDTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNQSERIIQQSLVELSKGRTTLTIAHRLSTIRGAHKILVLTEEGIKEQGSHSELMALKGMYYDLY... 583
105 0.000e+00gi|350269425|ref|YP_004880733.1| putative ABC transporter permease/ATP-binding protein [Oscillibacter valericigenes Sjm18-20]  clstr ali  22  10.SLLQIFISYFKPHGRLFFLDIACALVMSLIDLAFPFVSRWCMYTLLPADAW----QAFFGVMVIVVAAFTLRAGLSYVICYYGHTFGILVEADIRRDLFHHMQDLSFKYYDKNRTGQLMSRLTADLFDITELAHHGPEDVFISAVTIIGSLAVMFSIQWRLALVIALILPV-FFSVVWSCRKSMGEASDAVKRKTAAINADIESGLSGIRTAKAFANEQAELHKFDRSNETFKLSKRMFHKAMGRFNAAMEFFLCILQAVVIAVGGWLIMQGRMNVIDLITFSLYITTFVSPIRKLSSFMELFANGTAGLRRFVELMRIEPELRDPDAEDLQRVDGRIDLDHVGFAYRD-GLPVLHDIDLHIRPGETVAVVGPSGGGKSTLCQLIPRFYDVTEGSVRLDGRDVRRVTQRSLRRNVGVVQQEVFLFAASVLDNIRYGRPDATEEEIFKAAREAEIYDDIMPEGFDTYVGERGALLSGGQKQRISIARIFLKDPPVLILDEATSALDSVTEARIQATFDRLAKDRTTLIIAHRLSTVHGADRILVVENGEIVEQGPHKELLAKNGPYAALYRT. 577
106 0.000e+00METAHIT MH0066 GL0108781 [Complete] locus=scaffold8299_3:490:2172:-  ali  22  1.....................MALAVVSVAGTLYVPVLIGNIIDFIVDKGF--VNFDKIIPVLIQVCIIIGVVALAQWLMNVCNNKITFNVIRDMRDRAFTKIETLPVSYLDSHPTGEIVSRVIADVDQFADGLLMGFTQFFTGIVTILGTLGFMLSINVWITLVVVVATPLS-FVISNFIAKRTYKMFSLQSETRGEQTSFIDEMIGNQKVVDAYSHAEQNMQKFDEINGRLKEYSLKAVFFSSITNPATRFVNSIVYAAVALFGAILAVQQAITVGVLTCFLSYANQYTKPFNEISGVVTELQNAIACAGRLFELLEEESVPADKGAIEIKNVDGKLELSHINFSYI-ANKKLIEDFNLSVKSGQRVAIVGPTGCGKTTLINLLMRFYDPNSGSILIDGHDYNDVTRKSLRENFGMVLQDTWLKAGTIRDNLIMGTPDATDEEIIDAAKKAHSHSFILPDGYDTIIGEDGGSLSQGQKQLLCITRLMLCKPPMLILDEATSSIDTRTEIRIQKAFNTLMQGRTTFIVAHRLATIKEADIILVMNNGNIIEQGTHNELLAKKGFYFNLYN.. 552
107 0.000e+00METAHIT MH0014 GL0141981 [Complete] locus=scaffold74136_3:5217:6983:-  ali  22  11..TFKKVMTYIGKYRLLMFLSIVMAALTVALTLYVPVLIGDVIDLII--GKGQVDFKGIAKLLKEIALIAAATAAVQWLMNTVNNRITYHIVRDMRNEAFMKIQKLPLSYLDIHPAGETVNRVIADADQFADGLLMGFTQLFTGVVTILATLIFMLTINWKITLTVVILTPLSLF-IARFIAKKTYAMFRLQSETRGEQTAFIDEMISNQKVVQAFCHEDEAMEKFDEINDRLQKCSLRATFFSSLTNPTTRFVNNVVYAAVALTGAIACVKDPFTVGMLSVFLSYANQYTKPFNEISGVVTELQNALACASRLFELIEEEPQIPDADAKVLENAEGRITLDNVAFSYV-PDKKLIEDLTLSVEPGQRVALVGPTGCGKTTIINLLMRFYDVNGGSIQADGTDIRHITRKSLRRNYGMVLQETWLKSGTIRSNIVMGKPDATDEEVIAAARASHAHSFILPNGYDTVIGEDGGSLSQGQNQLLCITRVMLCLPPMLILDEATSSIDTRTEIKIQEAFARLMQGRTSFIVAHRLSTIHEADIILVMRDGHIIEKGNHEELLAKNGFYAKLYN.. 583
108 0.000e+00gi|304404818|ref|ZP_07386479.1| ABC transporter related protein [Paenibacillus curdlanolyticus YK9]  clstr ali  22  44FGAVKRLWGFIGTERRRLNVIFGLVIVSAGIGLVAPYWIGQAVDAM-EGGKDNVSFSLLRIVLLSLLVAYLADAVIGFMQGRWMAGIAQRIVLRLRRELYRKLQKLPLRYFDSRRHGDVMSRLSNDIDNVSNTISQSTVQLMSGVLSIIGALAMMLVLSPILTAASLITVPLV-YGLTRMIARRTSELFKAQQAQLGALNGHIEETITGVQVVQAFNQEQRAIQEFNDINNKLREISTNAQVWSGLLMPLLSVINNVGFAAVAIVGGILGVKGHISVGVIASFLTYSRQFVRPLNDLAATYNTLQSGIAGAERVFEALDEEEETPDAAAIPMIDPQGRIEFHNVSFGY-KPDELILKQLSFVSEAGTSTAIIGPTGAGKTTIIQLLTRFYEPTEGMITIDGKPLTAYTRDSLRRSFGVVLQDTYLFSGTIRDNLKYGKPDAMDDEIVQAAKLANADTFILPNRYETVLTENGGSLSQGQRQLLAIARAMLAKPSMLILDEATSSIDTRTELHIQEALAKLMQGRTSFIIAHRLNTIRDADSIMVIGQGNIVERGSHDELMAAQGVYYEM.... 612
109 0.000e+00gi|320162120|ref|YP_004175345.1| putative ABC transporter [Anaerolinea thermophila UNI-1]  clstr ali  24  1MKPLQLVSRFAQRYWKELLITVVSMLALVGIQLFIPWAVRTLINTVTGGLSSPQTLNIITTLTLAVIAVYLARGVFQYLRSYMAHIAGWGVVADLRKYVYDHLQRLSLRFYEDKQTGQLMSRVINDTDLFEQLIAHAVPDVLVNVVTLVAISAVLFQLNWILALLSLVPIPLVVLSLRLY-ARYVRPRFVERQKVLGELNAILNDNLSGIREIKAFTQEEEQYVRVGNGVENYKKANLKALRLMAIFQPFIDFASSLGTLVVIYFGGRLVFQQTLPVADLVAFFLYLEMFYQPVRNLSGAWEAVQNALAGAERVADLLEQQPELEKRSHPIVERAKGHIRFDQVSFEYI-PGEPVLENINLEILPEQVVALVGPTGVGKSTLASLIPRFYDVTSGSLKLDGYDVRDLSLESLRRQVSIVLQDVFLFHGTVRENLLFGNPDASEAQMIEAAKIANAHGFILPNGYDTLIGERGVKLSGGQKQRLSIARAVLKDAPILILDEATSAVDTETELLIQQALERLMRGRTTLIIAHRLSTIRNADKIVVLEGRHIVEEGAHEELLAKRGLYHRLC... 572
110 0.000e+00METAHIT MH0003 GL0134373 [Complete] locus=scaffold45999_6:14224:15951:+  ali  23  6..ILRKVLRYIKHYWLYLILSIVLALGTVAATLYIPILTGDAVDYIVAKGQ--VDFDSILSICKEIALLIGVTMIMQWIMNVCNNKISFGVVKEIREDAFDKIEKLPLRYIDSHSYGEVVSRVIADADQFSDGLLMGFTQLFTGVITILGTLGFMLSVSVPITVVVVLITPLSLFVASFI-AKRTYHMFQIQSETRGEQTALIEEMIGNQKTVQAYGREKKVLKEFDEINIRLQKCSLRGIFFSSITNPSTRFINSLVYAAVGVFGSIYAIHGGITVGKLSCFLSYANQYTKPFNEISGVVTELQNAIACAGRLLELIEEPGEVEET-VETLDEVDGSISLQDVCFSY-DPKKKLIEDFTLDVKPGQRIAIVGPTGCGKTTLINLLMRFYDVDKGKIVISGKEYKNVTRESLRKNYGMVLQETWLKRGSVAENIAMGRPEATREEIIQAAKDSHAHAFILPKGYDTVLGEDGGSLSAGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEMKIQEAFETMMKGRTSFVVAHRLSTILRADKILVMKDGMVLEQGNHEELLAKGGFYKELY... 570
111 0.000e+00Oral.Meta HOMD NCBIABZW_c_2_2878 Propionibacterium acnes SK137 [32756 - 30705] (REVERSE SENSE) ORF  ali  22  60..SLKRLLGQLKPHRITLTIVVIMATISVAFNVIGPKILGRATDVIFGGIGSGIDFHRLGVIIGWALGLYACAALLMFLQGFLLNTAIQRSMYDLRRQVSAKLDKLPLSYFDGQPHGELMSRMTNDIDNVSXXXXXXXXXXXNALLTIIGVLIMMFWISPLLAVISLVVIP-IAGVIAGLIGKRAQGQFAQMWKATGELNSRVEEAYSGHALVKTFGRSRAVAQEFHERNEELRQATAKAQFVSGLIQPVMFLLGNANYAIIVLIGCLRVAKGQMPLGNVQAFIQYSRMFTQPITQIASMANLLQSGVASAERVFQVLDADELSTD-AHGSLPATKGRVVFDHVRFSY-NPDKPLITDLSLVAEPGQTIAVVGPTGAGKTTLVNLLMRFYEIDDGTITLDGVDISAVPRAELRSRLGMVLQDTWLFSGTIHDNIAYGCPEASEEDILNAARAAHVDHFVLPDGYDTIIDDDGSNVSVGQKQLITIARAFLAAPDLLILDEATSSVDTRTEMLVQEAMANLRKERTSFVIAHRLSTIRDADLILVMEHGDIVEQGGHSELLEHQGHYYELYQA. 676
112 0.000e+00gi|329927793|ref|ZP_08281854.1| ABC transporter, ATP-binding protein [Paenibacillus sp. HGF5]  clstr ali  21  11....KKFLSYYKPYLGLLFADLACAFVVSAITLTLPLCIRYITINVLEGNSQSPLIQ-IYAVGAVMLAMVIIHTLCDMFISYKGHMMGAYMESDMRRELFDHFQKLSFGFYDEHKTGQLMTRTTNDILSLTELYHHGPEDIVISVLKFLGAFIILMYIDVKLTLIVFLFLPVMA-AFAFYYNKKMNVALRVSKDRIEDINAQVEDSLSGIRVVKSFTNEHIEKGKFAYANKRFVDSRREGYKSETYFHEGLVGFTQLITITVIVFGGAAIVDASLELADLLTFFLCIGILIEPIQRMVNFARLYQEGITGFDRFMEILEVEPDIEDADAETITQVQGNIEFQNVSFRYKDRYGFVLNQVSLNIKPGEYVALVGPSGVGKTTLCSLIPRFYEVSEGRILLDGRDIREVTQHSLRKNIGIVQQDVYLFAGSVFDNIRYGNMEASEDEIIAAAKRANAHDFIMPDGYETDIGQRGVKLSGGQKQRLSIARVFLKDPPILIFDEATSSLDNESERAVQDSLERLSDNRTTLVIAHRLTTVRNAQRIVVLSEDGIQEQGTHEELLARQGAYANLYQ.. 578
113 0.000e+00gi|226304923|ref|YP_002764881.1| ABC transporter permease/ATP-binding protein [Rhodococcus erythropolis PR4]  clstr ali  21  68..TMKRLLSLLQPHKFAVVCVVVATIASIALSVAVPKILGHATDLIFAGPGVGLNFDAIGKVVMLAIVVYLLSSLLAWLEAFLLNIIVQKTIYNLRASVEAKLHRLPLPYFDKTPRGEILSRVTNDIDNIXXXXXXXXXXXXXXXXXXXGVLTMMFVISPMLALIALIAVPVSVLLVARV-AKRAQVLYKAQWTETGKINAQIEENYSGRDLVRVYGHQAEAEREFAEQNKKLLDASFGAQFLSSLIMPVMNFVGNITYVLLAVVGALKVASGNMSLGDVQAFIVYSRQFSQPLTQIASMSTSLQSGAASAERVFELLDEPEQSPDIDVPLMPEPAGHIEFENVSFRY-EPDKPLIENVYLTARPGQMVAIVGPTGAGKTTLVNLLMRFYEVDSGRITLDDVDISQMRRSDLRKHVGMVLQDTWLFGGTIRDNIAYGRLDASEYEIHEAARAAFVDRFILPDGYDTVLDEEASNISSGEKQLITIARAFLSEPSLLILDEATSSVDTRTEQLVQQAMSALRVGRTSFIIAHRLSTIRNADLIVVMEAGKIVEQGTHDELIAAAGAYFRLYNA. 681
114 0.000e+00gi|291563597|emb|CBL42413.1| ABC-type multidrug transport system, ATPase and permease components [butyrate-producing bacterium SS3/4]  clstr ali  21  48..ALKRLLSYLEADRLRMGIAFFCVIVNTVATLTGSYMLRPIINRFIAPPDGSGNVAGLFKGLTMMACVYLLGVIANYLQSRLMLEVAQSALVRIRTDLFTKMQKLPVRFYDTNSNGDLMSRFTNDVDTIGNMLSSTLVQLFSGTLSIIGTLCLMLYTNIWLTAVTLIMIPLMLRAGGEV-AKRSQKYFSAQQSALGALNGYIEETITGQKVVKVFCHEEIAEEEFDILNRDLREKQIRAQFLGGMMGPVMNNLSQVNYSLTACIGGILCVVKNFDVGGLTVFLNFSRQFSRPINEISMQVSNVFSALAGAERVFSVMDEEPETEDKDAVSMDGMSGEVVLDHVTFGY-NPDKIILKDISLYAKPGQKIAFVGSTGAGKTTITNLINRFYDIQSGTITIDGVDICHIKRDELRRHIAMVLQDTHLFTGTVMENIRYGRLDATDEEVIQAAKMASAHSFIMPKGYDTVLESDGANLSQGQRQLLNIARAAVSRAPILILDEATSSVDTRTEKHIEQGMDALMAERTTFVIAHRLSTVRNANAIMVLENGEIIERGDHEDLLKEKGRYYRLY... 617
115 0.000e+00gi|302865325|ref|YP_003833962.1| ABC transporter transmembrane protein [Micromonospora aurantiaca ATCC 27029]  clstr ali  21  55....RRLLARLRPYRLQLTGVLALALASVGLSVIGPKVLGHATDIIFSGPGTGIDFDALGRVLAFAVVLYIGASMLQWAQGWVLNGVVQRTVLTLRADVEEKLNRLPLPYFDKQPRGELLSRVTNDIDNVSQTLQQTLSQLLTSLLTVVGVLGMMFWISPLLAVVALVAVPMSVVVTSLI-AKRSQGKFIAQWKHTGELNGQIEEAYTGHELVKVFGRQKEVEAAFHAKNEELFRAGFGAQFVSGLIMPAMFFIGNLSYVAIAVVGGLRVASGSMSLGDVQAFIQYSRQFTQPLTQVASMANLLQSGVASAERVFAVLDADEQSPDPAEPRVADPHGRVEFEHVSFRY-DPEKPLIDDLSLVAEPGHTVAIVGPTGAGKTTLVNLVMRFYELDAGRITLDGVDISTMRRDDLRGRIGMVLQDTWLFGGTIRDNIAYGRPDATEEEILAAARATFVDRFVLPDGYDTVIDEEGSNVSAGEKQLITIARAFLAEPSLLILDEATSSVDTRTEVLLQRAMAALRSDRTSFVIAHRLSTIRDADLILMMEQGRIVEQGTHDQLVAAGGAYARLYRA. 660
116 0.000e+00gi|345446199|gb|AEN91216.1| Multidrug resistance ABC transporter, ATP-binding and permease component [Bacillus megaterium WSH-002]  clstr ali  23  31.KTLHRIWSYMGKRKPPLAAAIILVIVTSLLNLLGPYLIGVIIDEHIIP----KDISGTIRMSLILAGIYITTSLLTWLQTYLMVNVSFTTIGMLRQDLFAKLQTLSLRFFDKRAHGELMSRVTNDIDNLNNALSQSVIQALSSILSLVGITIAMFSLNWILAIITLIVIPLMVIIVRQIL-KRSSENFVKRQKDLGELNGFVEEAISGGEVVTLFSKEKDFLTVFNERNEQLRSSATKAETFSGFLGPVTNFINNLGLALVIGAGAFMAVQGSVTVGMIASFVNYSRQFSRPISQMANLVNTILSAIAGAERVFAIMDEQPDVTNPNALSITKFAGDVAFENVSFGY-NDEKMILKNVTLTAKKGEMVALVGPTGSGKTTIINLLTRFYDIANGDIKIDGRSISDYKIHDLRNRIGIVLQDTYLFSGTIADNIRFGRLDANDEEVKSAAKMANAHSFILPQQYDTVISAGGGNLSEGQKQLLSIARAMLSDCDILILDEATSNIDTKTEIDIQRGMSNLLKGKTSFVIAHRLKTIENADQILVLKDGQIIEEGNHLELLEKQGFYHKLY... 596
117 0.000e+00gi|86751506|ref|YP_488002.1| ABC transporter [Rhodopseudomonas palustris HaA2]  clstr ali  24  2...LAKFFAYYRPWKTLFILDFSCAVVSALLELGFPMAIRAFVDDLLPTQQWG----LILLASAGLLVIYLTNTALIAVVVYWGHKLGINIETEMRRKAFDHLQKQSFRFFDDNNSGHLVARVTKDLEEIGEVAHHGPEDLFIAAMTFVGAFALMFAVNPKLALITAAIVPLIAWITSRY-GAQMTANWQQIYSRVGDFNVRIVENVGGIRIVQAFANEDHERRLFARDNANYRRTKLEAYRIIAASSSLSYMGTRLIQLVVMVAGSYFVLRGELSNGGFVGFLLLVNVFFRPIDKMLSVIETYPKGIAGFRRYLALLESEPEIVDPGAVSVTALRGDVRYSGVSFGY-AKGRSVFRNVDLEIRAGDTVAVVGPSGTGKTTLCSLLPRFYEIEAGSITIDGIDIRDMTLVSLRSQIGIVQQDVFLFGGSIRDNIVYGRLGASEADILEAARRARLDDMIMPDGLDTVIGERGVKLSGGQKQRLAIARMFLKNPPILILDEATSALDTRTEREIQRSLEELSRGRTTLVIAHRLATIRNADRIVVVDHSGIAEQGTHDELMRRGGAYSSLH... 565
118 0.000e+00gi|167750843|ref|ZP_02422970.1| hypothetical protein EUBSIR_01826 [Eubacterium siraeum DSM 15702]  clstr ali  23  10FTVLAKLLKYTKPYTFYLVFTIVSAVISAIATLYAPVLIGQAVDFIIE--INNVDFKKILPIIIKLAVVVIVGAGFQWFMGYCTNILTQRTVRDLRTDAFNKLQRVPLKYIDSTPHGDIIGRVVADIDTVSDGLLQGFQQIFTGSVTIIGTLCFMFSINVGIALVVIVITPVSLIVASTIARLCSKK-FKEQAALRGQITGLAEEYIGNQKVVKAFSREEYSEEKFEELNAKLYKVGVRAQFYSALTNPSTRFVNGLVYAGVGIFGALSAIGGGITVGQLSAFLSYANQYTKPFNEISGVVTELQSAFASARRIFALTESGDEISDADNKVLTDVSGNVKIDHVDFSYV-PEKELIKDLNLDVKSGQQIAIVGPTGCGKTTIINLLMRFYDTDKGGISVDGNNIKDVTRDSLRLSYGMVLQETWIFEGTVRENIAYGKQDATEEEIVAAAKAAHCHSFIMKDGYDTIISDN-DGISQGQKQLLCIARVMLAMPPMLILDEATSSIDTKTEMKIQNAFAKMTKGKTSFIVAHRLSTIKNADTILVMDKGRIIEIGNHEQLLAKNGFYAELYN.. 577
119 0.000e+00Oral.Meta HOMD gele_c_10_138 Granulicatella elegans ATCC 700633 [23811 - 22066] (REVERSE SENSE) ORF  ali  21  7...LKRLLSYLKPDRVIVTIVLVVSLVSVILDVQLPKILGDATTLIIASNYTSVDLEGVFAIAKTLAVLYLLAAGLNFLGKYFMSRVASDIIYRLQKEIDEKFTRLPVRYFDEQSRGDLLSRATNDIQTIDDSFSQVSNQIFTTVLTFFGIIIMMFTVNIPLAIIGVLGIPLSFFIIGMI-GKKSSTSFANRQETTGRLNGYIEEYYGGHEIVKAFNYEDRSQAEFQALNDELYEHAWKAQFFAGLMFPISRLINNIIYVFVAIVGGLFASGGMITIGGIQAILQYMRNISQPMGDAANMIGLTQSMLAAAERIFELLDAEEMEEEGDKKELPAIVGDVQFKHVSFGY-TPEVTLMEDLNIDVKAGETVAIVGPTGAGKTTVINLLMRFYDITSGAIEIDGHNIQDYKVDSLRSKVGMVLQDTWLFKGTIRENIRYSRPDATDEEVVQAAKQAFADDFILPDGYDTYITEETDNISGGQKQLLTIARAILASPSVFILDEATSNVDTRTEMQIQKAMDHIMEHKTSFVIAHRLSTIRNADKILVMQKGNVIEQGTHEELLAKQGFYAGLYRA. 579
120 0.000e+00METAHIT MH0040 GL0005694 [Complete] locus=scaffold6179_5:639:2387:+  ali  23  10.RTFRKIIKRIGRYKYLLLLSVIFAAASALLSLYVPILIGRAIDCIV--GKGNVDFDTIFALLVQVGATVGVSALLQWLMNTLNNRITFQVVRDIRNEAFSKLMILPLKFIDSNSHGDIVSRIIADVDQFADGLLLGFTQLFTGVVTILGTLVFMLTINPRITLVVVLLTPLSMLVAKFIASR-TYSMFSLQSKTRGEQTAFIDEMVGNQKVVQAFAHEDENLEKFDEINERLEKCSLRAAFFSSLTNPSTRFINSLVYAGVALVGALSAIGGGITVGGLTCFLSYANQYAKPFNEISGVITELHNAVACADRVFELIDQPPQTSDADAAELSDVHGSVQLDNVSFSY-TPERRLIENLNLSVKPGMRVAIVGPTGCGKTTLINLLMRFYDVDGGAISVDGNDIRRVTRRSLRRNFGMVLQETWLKTGTVRENISMGRPDATLDEVIAAAKAAHAHSFILPNGYDTVIGEDGGSLSQGQRQLLCIARVMLCLPPMLILDEATSSIDTRTEQKIQRAFAEMMQGRTSFVVAHRLSTVRDADVILVMRDGNIVEQGNHDTLLAKNGLYAQLYN.. 577
121 0.000e+00gi|52079324|ref|YP_078115.1| ABC transporter [Bacillus licheniformis ATCC 14580]  clstr ali  23  1MGVIRRYMEFVKPYKWKIVLTVLIGIIKFSIPLVIPLLLKYVVDDIIQGGTAEEKTSTLFMVMAVMFAIFLVRPPVEYYRQYFAQWTASKVLYDIRDKLFAHIQKLSLRYYANTRAGEIISRVINDVEQTKEFVIIGLMNVWLDVMTIFIAIAIMMTMDVKLTLISIVLFPLYGLSVKFFYGR-LRKLTRERSQALAEVQGHLHERVQGMPVIRSFAIEDYEQKQFDHENGNFLGKAIRHTAWNAKTFAVVNTVTDLAPLIIITVAGYHVIHGNLTVGTMVAFFGYIERLYNPLRRLINSSTTLTQSIASMDRLFEFIDEPYDLKDPNAVKAERLKGIVEFKNVSFQYEKSEEMILQDLSLKAERGETVALVGMSGGGKSTLVSLIPRFYDVSAGSLEIDGIDVRDYEARSLRNQIGMVLQDTFLFSESVRENISIGNPEASMEDIIEAAKAANAHDFIMPQGYDTKVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMEKLAKDRTTFIVAHRLSTITHADKIVVIENGRVAEIGTHDELMSRDGHYKHL.... 573
122 0.000e+00METAHIT MH0010 GL0017839 [Complete] locus=scaffold3183_5:5240:7063:-  ali  19  36..TILRLSKYLMKYKYLMAAALFLSIAGNVFALIGPKLSGQAIDAI--TGTGQVDFKKVTHYCILMAIFYIASSVMSYILSVLMIHITQKCVYQMRKDVYDSLMKLPVSYFDKHQTGEILSRISYDIDTVNTSLSTDLVQILTSVITVVGSFFMMLSISPMLILIFVVTIPLSFLITKFITGK-TRPLFRERSAALGRLNGFVEEMIGGHKTIKAYHREENTINKFKENNDDAVKCYYEAEYFGSMTGPCVNFVNNLSLACISVFGAVLYIGAKISIGDISSFVLYSRKFSGPINEAANVLNEFQSAIAAAERVFRIIDEPKEPVDPDAVSLSNVEGKVDFDNVSFGYV-RDKIILKDISLSAKPGQVIAIVGETGAGKTTIINLLMRFYDIASGKISIDDKNYRDYKMSDLRKSFAMVLQDTWMFNGTVYENIAYGNENATRQQVIEAAKAAKIHRYILPDGYDTVLTENATNISKGQKQLLTIARAMLLDSSMLILDEATSNVDIVTEADISGAMVKLMKNKTCFVIAHRLSTIQNADRILVVKDGNIVEQGTHQELLDKKQFYYSMYNA. 604
123 0.000e+00METAHIT MH0024 GL0038570 [Complete] locus=scaffold6428_1:433:2187:-  ali  22  8.STMKKVLRYIGKILVFLTCSIVCAALTVTFTLYIPILTGDAVDAIIGPGQ--VDFTVLLEILKKMGIAILLTALTQWIMSVCNNRIAYHVVQDIRKDAFDKIQILPLKYLDAHPYGEIVSRVIADVDQFSDGLILGFTQLFTGVLTIFGTLIFMFRQNVGITLVVICITPVSMLVANFI-AKKTYRMFKLQSETRGEQTALIDEMIGNQKVVQAFSYEEEAMKRFDVINEKLSRYSLQAIFFSSTTNPATRFVNSLVYTGVCIVGALSVISGRITVGVLSCFLSYANQYTKPFNEISGVFTEFQNALACAARIFELIEETPQVEEPDARVLTHADGRVELTDVAFSY-DPDRKLIEDLNLHVESGRRVAIVGPTGCGKTTIINLLMRFYDVDAGSIAVDDTDIRKLTRKSLRENYGMVLQETWLKAGTVRENLIMGKPDATDEEMIAAARAAHSHSFILPNGYDTVLSEDGEGLSQGQKQLLCITRVMLCLPPMLILDEATSSIDPRTEIRIQKAFAKMMKGKTSFIIAHRLSTIVDADIILVMRDGHIIEQGRHEELLEKKGFYAELYN.. 576
124 0.000e+00gi|23098355|ref|NP_691821.1| unnamed protein product [Oceanobacillus iheyensis HTE831]  clstr ali  23  1MSSIKQYMEFVKPYKWKIVLTLLIGVMKFGIPLLMPLILKYVIDDIISVSQSEKISQLFWVMGISFVIFLVLRPPIEYIRQYLAQWVGNKILFDIRGKLFDHLQKLSLKFYSQTKTGEIISRVIHDVEQTKNFVITGLMNIWLDLTTILIAIVIMLTMNVQLTLVSIILFPLFGFAVKYFFGR-LRKLTRERSQALAEVQGHLHERVQGVPVTRSFALEDYEQEQFDKRNSNFLDKALRHTDWNARTFAVTNTITDLAPLLVIAFAGYQVITGVVTLGTMVAFVGYMERVYSPLRRLINSSTTLVQAIASIDRVFELMNEKYDISDKDAVDPGRLSGKVEFEHVSFQYDEEELPVLKDVTLQVDKGETIAFVGMSGGGKSTLISLIPRFYDVTNGSVKIDGTDIRDYESRSLRDNIGMVLQDNILFSESIEMNIRMGNPEATDEEVIQAAKAANAHQFILPQGYGTMVGERGVKLSGGQKQRIAIARVFLKNPPILIFDEATSALDLESEHLIQETMERLASDRTTFIVAHRLATITHADRIVVVEDGQIIESGSHDQLMKLQGHYYDLYQ.. 576
125 0.000e+00gi|374602969|ref|ZP_09675955.1| xenobiotic-transporting ATPase [Paenibacillus dendritiformis C454]  clstr ali  22  39..TLLRIWRYMSGHTGLLALIFLMVLLTSGLSLLGPFLVGYAIDHHIKTQEGGN----FXXXXXXXXXXXXXXSAALFLQNYWMIGVAQKAVYAMRSDLFGKLHTLPVQFYTKRQHGELMSRITNDIDNVSQTLNSSFIQLSSSILTFVGMLTLMLWLSPLLTLITLTIVPLMFLGMKWIT-RRTGRFFKEQQRNLGDMNGFIEETFSGQKIVKSFSQEQKVIQEFAEKSERLKASGYWAQTYSGFIPKLMNVLNNMSFAIIAGAGGVLALHNLVSIGVIVTFSEYARQFTRPLNDLANQFNTFLSAIAGAERVFEVLEEREEGQDKDAIRLQRVRGEIEFVDVSFAYEKDGRT-LRDVSFRAEPGQTVALVGPTGAGKTTITQLLSRFYDYDSGQIYLDGVELSTIDRKNLRSHMGFVLQDSFLFQGTIRDNIRYGRLDATDEEVEQAARLANAHSFIMPQGYETELSQDGSGISQGQKQLLSIARAVLADPAILILDEATSSIDTITEMKIQEALYRLMEGRTSIVIAHRLNTIQQADCILVLEDGRIIEQGSHESLLRQQGFYHGLVQ.. 604
126 0.000e+00gi|325280576|ref|YP_004253118.1| Xenobiotic-transporting ATPase [Odoribacter splanchnicus DSM 20712]  clstr ali  22  18.QTLFRLTSYLVCDRLLLSVIGVLIVLSIAANLGGSYLLRPIINRYIIPG----DFLGLGKMLGILIGVYLTGVFAVYVEYRLLNKIGQRTVARMREDLFRKMEQLPVGYFDTHQHGDLMSRYTNDMDRISDALTDSLSDMLSSALTVVGIFCLMLVISPILTLVTLVTVPLMFWSARGIV-RKSRQYFKAQQASLGSINGYIEEMISGQKVVKVFGHEQKAISDFEELNQDLKGKSLKAQFYSGLMMPVMQNLSTLNYVLITIVGALLAIFRGFDVGGLAAFLQYSRQFGRPINELASLYNSIQAALAGAERIFEVIDEQPEAPDPEAVNLEKVKGEVVMKEVWFGYR-PEKMILKGISFQAAAGRKIALVGATGAGKTTILSMLPRFFDIRSGEIRIDRQEIRCIHRNSLRRSMAIVLQDTHLFTGTVRENIRFGRLEATDEEVIEAAKLTAAHSFILPHGYDTLLENDGANLSQGQRQLLNIARAAVADPAILLLDEATSNIDTRSEILIQKGLDQLMQGRTSLIIAHRLSTIRNADMILVLERGQIVERGTHEELLRMKGKYFSLNQ.. 584
127 0.000e+00Oral.Meta HOMD elen_c_1_5255 Eggerthella lenta VPI 0255, DSM 2243 [1627499 - 1630822] ORF  ali  21  517...LAKFASYYRPYTFLFVFDLVCATVLACVDLAFPQFLSFFTKDFF-QSSPEAIIGSLWWIALLFVVLYGVRTACQYFITSWGHIMGARMEADMRMDLFKQYQRLSFSYYDRNNTGEMMSKLVTDLFDISELAHHGPENLFICILKIVGSFALLFLINVPLTAIMLVAT-LLLAAYSFWRNYQKRVIFTENRKKMADINARLQDSLGGIRVVKSFGNEPVEIKKFDRTNARFVATKESSYRFMGSFHAVNSLFIGVLYTVTIVGGGYFVATGGLAVSDLAIYALYIGIFISPIEQLINFVETFQKGYAGFRRFMEVLAVRPDIADPDAVDLGHVAGEVRYRDVHFSYDGVHE-VLRGLDLAIPAGATVALVGPSGGGKTTTCSLLPRFYDPERGSVEIDGIDIRAVTVESLRDAIGIVQQDVYLFGGTIRDNIAYGRPDATTAEIVEAAKRANIDAFVLSDGYDTYVGERGARLSGGQKQRIAIARVFLKDPRILILDEATSALDNESERAIQKSLEELSAGRTTLVIAHRLSTIRGADLIAVVEDGRVAERGTHEQLLALGGTYAHYYE.. 1096
128 0.000e+00gi|332296882|ref|YP_004438804.1| xenobiotic-transporting ATPase [Treponema brennaborense DSM 12168]  clstr ali  21  7.RNVKRFFSYYRPHWKLFAADMVCAAFIAGVDLVFPVLTRFTVNQLL----PDRLYAFFFTLIAVMAGLYAVQTAASYFVAYFGHLFGTYVETDMRRDVFAHIEKQSFSFFDNHRTGHLMSRVTYDLFEVTELAHHGPEDVFISAATLIGSFCIMLTIRWELALVIFTVLPVLIFYTARTRGK-LNASSRAVKEKTAEINASIESSISGARVTKVFTNEPYENERFARSNGAFLCAKRTFYRAMAGFHCKVDFATHILNVVVLAFGGFLIMKGRMNLADLIAANLFVAAFLQPIRRLTNFVEQFTTGMAGFTRFVELMDTHTETPEPGAKPLAPVRGDIDYENVSFSYNN-NVAVLSAVNFNVKAAQKIALVGPSGGGKTTLCHLLPRFYEISGGSIRIDGVDIRDVTIESLRRQIGLVQQDVFLFAGTIRDNIAYGKVGASDAEVAEAARRAEIHEDIMPNGYDTVVGERGIKLSGGQKQRISIARIFLKNPPILILDEATSALDSATEVKIQRAFDELAKGRTTLVIAHRLSTIRNADAIIVVTDEGIAQSGTHETLMASGGLYRDLYTA. 574
129 0.000e+00METAHIT MH0006 GL0190909 [Complete] locus=scaffold7061_3:3334:5103:+  ali  20  14..TLLKVLKRIKKYSGFLILSILMAAVSVASTLYVPILVGRGIDHIVGPG--NVDFAGISRILVTIGVIVAITALSQWIMNICNNKITYHVTRDIRDEAMEKIQKLPLRYIDGQSYGDIVSRVIADVDQFADGLLMGFTQFFSGVLTIVGTLVFMLTINVRITLVVVLITPVSFFVASFI-AKKTFSMFKLQSETRGEQTAFIDEMIGGEKVVKAYGYEEEAVARFDEINERLQKYSLRAIFFSSITNPSTRFVNSLVYAGVAVSGAFIAISGGITVGQLSSFLSYANQYTKPFNEISGVITELQNALACAARMFELIEEEPELPDAEAADIKEVDGRVDLNNVYFSY-TPDKKLIEDFNLHVKKGQRIAIVGPTGWGKTTVINLLMRFYDVNSGSIDVSGTDIRDMTRYSLRHGFGMVLQETWLKAGTIRENIVMGKPDATEEEIIQAAKASYSYGFILPNGFDTVIGEDGGSLSQGQKQLLCITRVMLTRPPMLILDEATSSIDTRTEIRIQNAFAKLMEGRTSFIVAHRLSTIQSADVILVMKDGHIIEKGNHEELLAAGGFYKTLYE.. 581
130 0.000e+00gi|336429882|ref|ZP_08609839.1| hypothetical protein HMPREF0994_05845 [Lachnospiraceae bacterium 3_1_57FAA_CT1]  clstr ali  20  46.KTVKRLLSYIQEEKYKLVLVFACVIINTVSMLAGSYMLRPIINGLTSVDGSA---QKLLRSLLIMACIYLFGIVAQYLQARIMIGISQQAIFKIRNELFAKIQRLPVRFYDTNNHGDIMSRFTNDVDAVGEMLNNTVVQIISSVINVIGTFCLMVYTNIWLTLITVLMVPVMMQAARFVTMR-SRRFYKAQQAALGTLNGYIEETVSGQKVVKVFCHEEIAEEEFSYLNYDLRDKQIMAQFFGGIMGPVVGNLSQVGYSVTACVGGILCVLRGFDIGGLTVFVNYSRQFSRPINELSMQMNTIFSALAGAERVFAIMDEEPEPEDPDAVRLTDCRGNVRLEDVTFGYNS-DKIILKHISLYAKPGQKIAFVGSTGAGKTTITNLINRFYDINEGKITIDDVNIRDIARDDLRRNIAMVLQDTHLFTGTVRENIRYGRLDATDEEVEQAARTASAHSFIMDKGYDTMIEGDGANLSQGQRQLLNIARAAISKAPVLILDEATSSVDTRTEKHIEKGMDRLMTERTTLVIAHRLSTVRDADAIMVLEQGEIIERGTHEDLLAMKGRYYELY... 612
131 0.000e+00METAHIT MH0006 GL0275217 [Complete] locus=scaffold91739_1:458:2209:-  ali  21  18.KPFEIFVAYIVREKKLFIIDTICAVLVAAIDLAFPYVSKNSMQTYLPQSM----YKTFFIVMAILAAAYVLKAALYYVITVLGHRMGVNIESRMREDLYSHMQALSFGFYDKNRTGTLVSRLTGDLFEITELAHHGPENIIICALTIVGSMLIMFTINWQLTLVLAVLLPLCLW-FTLKCRVKMKDANMEVKRKMGVIYSALENGVSGVRTAKAFANEELEKQKFDAANDMYRGAKKEYYKTMGAFMSGMEFTTGIMPVVVIAVGGVLIMNGRFSYIDLITFTLYVSTFINPVRKLAQFAEIYMQGAAGFERFLEIMRTEPEIVDPDAVDIGRIRGDISLNDVSFTYDSAE--VLHHVSLRAEAGKTLALIGPSGGGKTTISQLIMRFYDVSDGSVTVDGKDVRGVTQASLRRNIGIIQQDVYMFAGTVRENIRYGRPDATDEEIVEAARLAELHDEIMPDGYDSYIGERGVMLSGGQKQRISIARVFLKNPPVLILDEATSALDTVTERRIQASLDRLCVGRTSIVIAHRLSTIRNADSIAVIEHGRIAEQGNHEELLALGGTYFSLAN.. 583
132 0.000e+00gi|77465095|ref|YP_354598.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]  clstr ali  24  2...LRDFFTYYRPWLGLFWLDFGCAIASGLLELAFPLAVQGFIDRLLPQGDWSLT----ILAAAGLLAIYLVNTGLMAIVTYWGHMLGINIETEMRRRAFEHLQKLSFRYFDRVRTGKLVARVTRDLEEIGEVAHHGPEDLFIAIMTFIGAFLLMLAINVKLALLTALVVPATVALVSIYGGR-MTATWRAIYARVADFNVRLEENVGGIRVVQAFANESHEKALFARDNARYRDTKLAAYRVMAASQALNYMGMRSVQVIVMVAGAAFVLSGELTTGGFVGFLLLVSVFFRPLEKIAAVIETYPRGIAGFRRYRELLDTEPEIADPGARPAPALTGEIRFEGVGFGY-DQGRPVLSGIDLSVRPGETLAFVGPSGAGKTTLLALVPRFYDPECGRITIDGMDLTDMTLESLRRRIGIVSQDVFLFGGTLRENIAYGRLEATEAEIRRAADQAQLGPMILPEGLDTVVGERGVMLSGGQKQRVAIARAFLKNPPILILDEATSALDTETEREIQAALDALAVGRTTLIIAHRLATIRHADRIVVMEAGRIVEVGTHAELATSGGRYARL.... 564
133 0.000e+00METAHIT MH0012 GL0060223 [Complete] locus=scaffold173997_1:131:1867:-  ali  20  2...FKKFCSYYKPHMKXXXXXXXXXXXXSICNLVYPLIAKYIIEELAGQKEK---INLILALGGLLFFIYIIKAILNFIIQYWGHIVGVRIQGDMRKEMFEHLQKLPFAYFDDHKTGTIMSRLINDLMDISELAHHGPEDIFIATITLIGSCILMLSVDPWLTLIIFSVVPFIIF-YAVFTRKGMRNAFTKMRGETGKINAQVESSVSGIRVSKAYVTEKYENEKFARRNENFKKARSSAYKQMGIFGSGMTFFTDFLYLLALVSGGIFYSKNYIDGAEFTALILYINNIIMPIRTIISIFEQIQSGMTGFARFMEVLNYKKEEDNPDAIDLDDIKEEISFNDVSFSYVNNDSLVLSHLTFKINKGTTVALVGPSGGGKTTICHLLPRFYEINSGQIEIDHIDIKKYSRFSLRKNIGIVQQDVYLFAGTIRENIAYGKIDASEDEIIDAAIKANIWEYILPDGLDTYVGERGVKLSGGQKQRISIARAFLKNPPILILDEATSALDNVTEMQIQKALENLSIGRTTLVVAHRLSTVKNADNIIVIDKNGIIEQGNHNELIKKNGVYANLYQ.. 573
134 0.000e+00gi|256377823|ref|YP_003101483.1| ABC transporter transmembrane protein [Actinosynnema mirum DSM 43827]  clstr ali  22  25....KRLVGRLSPERVPFIGVVVLGVASVALSVAGPKVLGHATDIIFNGPGAGIDFAALGSVLSWVLGLYVASSVFGYVQGLLLNGVVQRVVYRLRADVEDKLHRLPLRYFDSQPRGELLSRVTNDIDNIATTLQQTMSQLLVSGLTLIGVLAMMVSISXXXXXXXXXXX-XXSIIITSRIRKRSQALFVAQWKHTGDLNAHIEEAFSGHQLVKVFGRQRESEEEFRRRNDDLLGSALGAQFISGLIMPLMMFLSNVGYVAIAVVGGLRVTSGSMTLGEVQAFIQYSRQFTQPLTQVAAMANLLQSGVASAERVFELLDAEEQVPDPVEEQLPATRGRVEFHDVSFSYL-PEQPLIKHLSLVAEPGSTVAIVGPTGAGKTTLVNLVMRFYELDEGRITLDGVDITALKREDLRSQIGMVLQETWLFGGTIRQNIAYGRPDATEEEILTAARATYVDRFVLPDGYDTLIDEEGGNVSAGEKQLLTIARAFLANPSLLILDEATSSVDTRTESLVQHAMAALRSSRTSFVIAHRLSTIRDADLILVMEAGRIVEQGTHEELITKEGAYHRLYSA. 601
135 0.000e+00gi|310779109|ref|YP_003967442.1| unnamed protein product [Ilyobacter polytropus DSM 2926]  clstr ali  21  5FSMVKEFGKFYKPHKKLFTIDMVCAFFVAFIDLAYPMLAKYALNDLL----PGNEFRSYFVFVLVLLGLYVLRVFFQFVNDYWGHILGIRIEYDLRKELFLHLQKLSFRFYDKTRVGHIMSRMINDLNEMTEMAHHVPEDVFLSALMLIGSFFAMLYLNWQLALGVYTIVPIMVF-FAVKRRKKMSQGFKKVKEKISGVNAQLESSISGIRVSKSFANEEHEINKFNESNVLFKNSKNEAYMQMAVFMGGMHFFINLLNIIVLGLGGFLIYNGKMNFPDLVAFTLYTNAFLVPIRRLTNSVQQFESGMTGFARFNEIMAIEPLIKDEDALELESCKGKINFKNVTFAY-NENHNIISGINLNIEPGKAIALVGPSGGGKTTLCHLIPRFYEVDSGEISIDDINIKNIKINSLRKNIGLVSQDVFLFAGTIRDNIIYGDINATEEEMIQAAKNAEIHDFIMEKGYDTDVGERGIKLSGGQKQRISIARVFLKNPPILILDEATSALDNETEFKIQRSLEKLSKGRTSLIIAHRLTTIKHADEIIVINKDGIQEIGTHEDLLEEKGIYRSLYDA. 573
136 0.000e+00gi|326333364|ref|ZP_08199611.1| ABC transporter, ATP-binding protein [Nocardioidaceae bacterium Broad-1]  clstr ali  21  52....KRLLRRMAPYKIHAFATIVLAAISVTLMSLGPWLLGKATNIIFGGPGHGVDFDALRNALMVVLVVYLVASMLSFAQGWILNSVVQGTVKGLREDVEKKVHSVPLSYFDKQPRGELLSRVTNDIDNISQTLQQTFSQVLTALFTLVTVLFMMFWISPVLALIALLAVPVSLVVTGAVM-KRSQGQFVAQWRSTGKLNGHIEETFSGHDLVKVFGRQEEVEKTFAEENDKLFAAAFKAQFISGILMPLMMFVGNLMFVVVCVVGSLRVASGALSLGELQAFIQYSRQFTQPITTLASMMNLLQSGVASAERVFELLDAEDQSPDVGAAGDGSVAGEVRFEHVSFAY-DKDRPLIEDLSLVARPGQTVAIVGPTGAGKTTLVNLIMRFYELDAGRITLDGVDIASIPRADLRGRTGMVLQDTWLFEGTIRDNIRYGRPSATEEELLEAARATYVDRFVLPDGYDTLITDEGGNLSAGERQLVTIARAFLAEPSLLILDEATSSVDTRTELLLQHAMAALRSDRTSFVIAHRLSTIRDADLILVMRDGAIVEQGDHAELLEAGGAYAELYQ.. 657
137 0.000e+00gi|219682653|ref|YP_002469036.1| ABC transporter permease [Bifidobacterium animalis subsp. lactis AD011]  clstr ali  21  23..ALKELMRFSKRYIPAIVIALILGVGGAICQIIGPDYLGDMTDEILVHGKPSIDMTAVTRIGWTLVALYVGYALLSYVQSWMMATVTQRTAQRLRAAIDVKMNKLPLKYFDEHSTGDVMSRITNDVDAVGQTLGQSLGTLISSVTLFVGSLVMMFANNWILALCAVGAT-LLGMVLMLVVMRFSQKYFVKQQMALGDVNGHVEEMYSGHTVVKAFGGEADAIRRFERYNNDLYDSGWKSQFISGLMMPMMNLVGNLGYVVVCVVGAALAMNGSIEFGVIVAFMLYIRLFTQPLSQFAQAFQNLQRCAAGSERVFTFLDEPELADESDKQPLTPVEGRVSFEHVKFGY-EPNKLVIHDFSADVEPGQKVAIVGPTGAGKTTMVNLLMRFYEIAGGKISIDGIDTKSVPRWNVHDQFSMVLQDTWVFNGTVRENVAYAKEDVTDEQVVAACRAVGLDRYILPNGYDTVLDE-SATLSQGQKQLLTIARAMVQDSPILILDEATSSVDTRTEELIQTAMDKLTEGRTSFVIAHRLSTIRDADMILVMRDGDIVERGTHEELLAKHGFYADIYNA. 609
138 0.000e+00gi|325570838|ref|ZP_08146521.1| multidrug resistance ABC transporter ATP-binding and permease protein [Enterococcus casseliflavus ATCC 12755]  clstr ali  21  2...LKRFFRYYRPYRSLFMLDFTCAVFAGLLELAFPVAVNQVIDKIMPQN----NFRLILLACLGLFLFYVINTVLQYIVVFYGHKLGVNIETDMRQELFRHLQTQSFEYYDNQKTGKLISRLTTDLFEISEVAHHGPEDVFITIMTLVGAFLLMLNMHVQLAVATFALIPLITIAL-VFFNKKMTKVNTQIYDNLGEFNAGVEASVSGIRVTQSFANETFEHKRFDGLSEIYRQSKILFYKVMAISSAYNYFLIRLINLFALIFGAYYVIRGELTNGQFVGFILLSNVFVRPIEKVNTMIESYPKGIAGFKRLTEELDKEPTIKDPGARAVQSLKGDIVYQDVSFSYADATK-VLNHIDLSIKAGETIAFVGQSGSGKTTLCNLLPRFYEVTEGAITIDGINIQEMTLASLRQQIGTVQQDVFLFPGTIRENIAYGKLDATEEEILKAVKLAHLEKVIMTDGLDTVIGERGVKLSGGQKQRVAIARMFLKNPPILILDEATSALDTETEQVIQESLNSLADGRTTLIIAHRLATIKHATRIIVVSDKGILEEGTHEDLMAKKGHYRALHDA. 567
139 0.000e+00gi|310780396|ref|YP_003968728.1| ABC transporter [Ilyobacter polytropus DSM 2926]  clstr ali  21  1MKDLLCFARYYKPHFKLVILDFICAFAMAGLDLLFPLLVQRTLDDVIPRG----DLKLLYIFGAVLVALYILRYLASYVVYYWGKMLGILIEYDMRRDLFAHVQKLSFTFFDNTKTGAIMSRIVNDLSYISEFAHIGPEDFFLAILKFTGTFIIMFTMNKKLTLIIFSLVPLLIWFAAAKKN-LMKKSFGKSRKKISAINSQVEDSISGIRVVQAFTNEKFENEKFQKKNTEFREAKRENFKLSAEYFSGLSFIMNIIQLTTLFFGGIFILKGEITAGIVIGFLLYVSKFMEPIRRMMLLMQSFQKGMAGFVRFRELMDKDPDIKDPNAVALKKPMGTIQFENVSFKYASSEQDILKDFSMSIKSGEKVALVGSSGAGKTTICNLIPRFYEVERGAIKIDDRDIKNYTLESLRDNIGIIQQDVFLFSGSIEENILYGNLTASREDVIEAAKKARIYEFILSDGFDTNVGERGVKLSGGQKQRIAIARIFLKNPKILILDEATSALDNNTERLIQESIDELTTDRTTITIAHRLSTIENADRIIVLNSEGIVEEGTHNDLVEKKGEYFSLVE.. 569
140 0.000e+00gi|225389881|ref|ZP_03759605.1| hypothetical protein CLOSTASPAR_03630 [Clostridium asparagiforme DSM 15981]  clstr ali  20  53.RTVVRLLRYLEEDKAKMALAFVCVIANTVCMLAGSYMLRPIINTYIAPVNGSRDIQGLARALIALGFVFLAGVAANYYQAKVMLTVAQNALQKIRDDLFTKMQKLPVRFYDTNSNGDLMSRFTNDVDTIGQMLSSTLVQLFSGALSLVGTLALMIYTNIWLTLVTLVMIPLVMRAGGAVAGR-SQKYFSAQQSSLGAVNGYVEEMITGQKVIKVFCHEDTVADEFGLLNEDLRQNQIRAQFFGGVMGPVMNNLSQINYTLTAVVGGLLCVLRGFDVGGLTVFLNFSRQFSRPINEISAQVSNVFSALAGAERVFAVMDEEPEPADPEAMVLEPMKGHVVLDHVTLGY-DPEKIILKDVSLYARPGQKIAFVGSTGAGKTTITNLINRFYDIQSGAITVDGVDIRQISRENLRKNIAMVLQDTHLFTGTVMENIRYGRLDATDEEVVQAAKTASADSFILPEGYDTMLEGDGANLSQGQRQLLNIARAAISRAPILILDEATSSVDTRTEKHIEHGMDRLMADRTTFVIAHRLSTVRNANAIMVLEHGEIIERGDHDELLKLKGRYYELYTGL 626
141 0.000e+00gi|374307956|ref|YP_005054387.1| unnamed protein product [Filifactor alocis ATCC 35896]  clstr ali  22  14...ITRFLPYFRKYYSILAIDLICASFTTVCEIVFPLMVRNITNKAMF-DFQALTMSFVIKMCVIYFILRLVDTAANYYMASVGHIMGAKIETDMRRDLFSHLQELSFNYFDNTKIGQIMGRITSDLFEITEFAHHCPEEFFIAGVKILVSFLILCRINVLLTVIVFSVIPLML-VATMYFRKRMRLAFKRSREQIGDLNAQLEDSLLGVKVVRSFANEEIEKEKFEEGNSGLFHIKKFQYYYMAGFKGVTQFFDGLMYVTVLLCSSYFMIQREITAGDMVAYMLYVAMLLSAIKRIVEFAEQFQRGMTGIERFIEVMDEEVEIQDDDAVEITGATGDILFDHVSFQYPDHDKMVLSNIDLHIRPEQKIALVGPSGGGKTTLCNLIPRFYEVSEGHILLDGVDIRKITQKSLRNQIGVVQQDVYLFSGTVRENIEYGKVGASDEEIVSAAKKAGAHEFIMENGYNTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNESERIVQHSLVELSKGRTTFTIAHRLTTIQNADTILVLTENGIEESGSHKELMERKGKYYSLYE.. 582
142 0.000e+00gi|239623487|ref|ZP_04666518.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]  clstr ali  21  59.RTIGRLMHYLNEDKPKMMLAFFCVIVNTAATLAGSYMLRPIINTFIAPLDGSGNPSGLFRALAVLAVIFVVGVIANYAQARVMLTVAQNALQKIRNDLFGKMQKLPVRFYDTNSNGDLMSRFTNDVDTIGQMLSSTLVQLFSGALSIVGTLALMLYTNVILTLITLVLIPLMMKAGGAVAGR-SQKYFTAQQTSLGAVNGYIEETVTGQKVVKVFCHEDTAKEEFRILNQDLRNNQIRAQFFGGIMGPVMGNLSQINYSLTACIGGLLCVLRGFDVGGLTVFLNFSRQFSRPINEISMQVSNVFSALAGAERVFAVMDQEPEPADHDAVVLNPMEGHVVLDHVTFGY-EPDKIILKDINLYAEPGQKIAFVGSTGAGKTTITNLLNRFYDIQSGAITIDGADIRHMKRDELRRNIAMVLQDTHLFTGTVMENIRYGRLDATDEEVIQAAKTASAHSFIMPHGYDTMLEGDGANLSQGQRQLLNIARAAISKAPVLIMDEATSSVDTRTEKHIEHGMDRLMADRTTFVIAHRLSTVRGANAIMVLEQGEIIERGSHDELLAMKGRYYELY... 629
143 0.000e+00gi|350549173|ref|ZP_08918489.1| Xenobiotic-transporting ATPase [Thermobacillus composti KWC4]  clstr ali  24  41.SQLTRLYGYMKPYRRQLLVIIITMVLGTLTRLTVPALIAFAIDEAIAPADGSPSLTKLYLFGASALALYLIQWGTNVFRIRYTNIIGQRVIFDLRRELFTHIQKLSFRFFDQRPAGSVLVRVTNDINALQDLFTNGVVNLIMDCVQLVGIAVLLLVLNFKLGLAVMITVPLM-FIVSTSLRRRIRFAWQDVRIKQSRLNAHLNESIQGIRVTQAYVQEKANIGYFDKMNTVNRLAWNKASAMNQSFGPVIEITAAVGTLILFWYGSYLVQSGAMTVGLLVGFANYIGNFWEPINRLGQMYSQLLIAMASSERIFEFMDEKPTVGEPEAKRMPEIRGDVKFENIVFEY-EPGRPALRGISLEAAAGQSIALVGHTGSGKSTIINLLCRFYDPVEGRVFIDGIDIRDVTLESLRSQVGIVLQDTFIFSGTIRDNIRYGRLDATDEEVEMAARAVHAHDFIMPQGYDTEVQERGSVLSMGQRQLLSFARALLADPRILILDEATASIDTETELKIQEALKTLLTGRTSFIIAHRLSTIRHADNIIVLDHGRIVEQGNHDELMRKRGVYYGLIEA. 613
144 0.000e+00gi|325660671|ref|ZP_08149301.1| hypothetical protein HMPREF0490_00033 [Lachnospiraceae bacterium 4_1_37FAA]  clstr ali  22  7..TVGKVLKLIGPYKYLLLLSLVFAMISVALTLYAPILIGDGVDVLIGKGQ--VNFPEVFAILKKLAVVIVLTCVAQWLMNLCNNRITYRVVKDVRIKAFARLQVLPLKYVDSHPQGETISRIITDVEQFSDGLLMGFSQFFTGIVTILGTLVFMLGIHVQIALVVILITPVSLFVASFI-AKRTYTMFQKQSETRAEMTSLVEEMIGNQKTVQAFGYGEEALKRFDAINRNLQTCSLKAIFFSSITNPSTRFVNGLVYAGVGITGAVFAMRGAISVGQLSCFLTYANQYTKPFNEISSVITELQNALACARRVFDFIEEETETVDKDAVVLSQVQGEVKLVDVSFSYQ-PEVPLLEHLNLTVKPGQKIAIVGPTGCGKTTLINLLMRFYDLDGGQILLDGNAVSKVTKDSLRASFGMVLQETWLKSGSIAENIAYGNPGATREEVIAAAKAAHAHGFIMPEGYDTVITEDGGNLSQGQKQLLCIARVMLKLPPMLILDEATSSIDTRTEIQIQKAFQKMMQGRTSFIVAHRLSTIREADVILVMKDGNIIEQGAHKTLLARNGFYAELYK.. 574
145 0.000e+00METAHIT MH0014 GL0051076 [Complete] locus=scaffold20307_1:4137:5816:-  ali  20  1..................VLDLFCAGITSICEIVLPLMVRYLTNMGI-NDIEGLTLTIIIKITLLYVVLRAADCAAYYFMSSVGHITGAKIETDMRSDLFAHLQKLSFAYYSNTKIGQIMARISSDLFDVTEFSHHCPEEFFIAGLKIVSSFAILCTMNVPLTLIMFAAMPVM-IVISIKFNGSMRKVFRSQRAQLGEINARTEDCLLGIRVVKSFGREDTEVEKFEKDNSKFLDIKKQSYKYMGAFNCSTRAFDGIMYIIVVALGSYFMMKREISPADLTAYLLYASTLLASIRRIVEFTEQFQRGMTGIDRFFEVMDVEPDITDKEALELANVKGDIAFENVGFHYSDSDTAVISGLDLKIKAGSHAALVGQSGGGKTTLCNLIPRFYDVTEGKVTVDGHDVRDVTIKSLRKNIGVVQQDVYLFSGTVAENIAYGAENASRDDIIESAKLAGADEFILPDGYDTYVGERGVKLSGGQKQRISIARVFLKNPPVLILDEATSALDNESEFIVQKSLERLAKGRTTITVAHRLTTVKNADVIFVLTENGIAEQGTHDELMAQGGIYSRLYN.. 554
146 0.000e+00gi|56420166|ref|YP_147484.1| ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]  clstr ali  23  26..TLRRLWAFIAPQKRKLFAAMAMVVVSSALALAGPYVIGWTVDVYIIERR----TDGFLATLVLLLAIYMALGAATFLQNYWMIDVGQRTVHAIRERLFRHFHELPISFFDRRQQGELMSRITNDIDNMSQTFNSTVVQVVSSTLTLMGAIVVMLSQSVVLTIVTLVVVPLMYVGMRWITNR-TRVRFREQQRALGEMNGFIEEVISGQKVVKLFSQEERMESELARKNAELKQAGFWAQTYSGFIPKLMNFLNNVSFALIAGVGGWLAAKGAISVGTIVVFVEYARQFTRPLNDLANQWNTLLSALAGAERVLEILDLPEEEDEREAAALDRLDGRIEFRQVVFSY-DKQRPALDGVTFSIAPGETVALVGPTGAGKTTVLQLLTRFYDPDRGVILIDGRDSRTIKRASLRRHMAFVLQDTFLFAGTIRDNIRYGRLEATDEEVEEAARQANAHSFIMPDGYDTVLAPGGGGISQGQRQLLAIARAMIADPAILILDEATSNIDTVTEVRIQEALARLMNGRTCLVIAHRLNTIQHADRILVLNEGKVIEQGTHEELLAAKGFYFQLY... 590
147 0.000e+00gi|257069969|ref|YP_003156224.1| ABC-type multidrug transporter ATPase and permease [Brachybacterium faecium DSM 4810]  clstr ali  22  55....LRLAGTFGEHKLGLSVVLLFGLISTVLTVWAPTILGDAMDVIFDGTGDGVAFDALGRLLLIVLGMYVIAALFDWLQGRLLNDVVMEIVYRLRERIEAKVNRLPLSYFDTRQRGDLLSRTTNDVDNVQTALQQAFASLVYAVLTIVGITVMMFWLSWQLALIALIALPISGVVIGLIGAK-SQKLFTAQWRNTGRLNGHVEESFTGHDLVTVFDRQDSMREQFDERNEELWEASFKAQFYSGMIMPIMQWVTYLGYVGIAVVGGLRIASGQMSLGQVTAFIQYSREFNAPLGEVAGMANMLISGVASAERIFELLDAEEQEADEPAELTGPTRGRIEFEHVAFSY-TPDKPLISDLSLTAEPGQTIAIVGPTGAGKTTLVNLIMRFYEIDAGQIRLDGVDIRALDRGAVRSRVGMVLQDAVLFGGTIRENIRYGRLEASDEEVLAAARATFVDRFVLPEGYDTVIEDEGANVSAGERQLITIARAFLADPALLILDEATSSVDTRTEVLVQEAMAALRTDRTSFVIAHRLSTIRDADVILVMEHGDIVEQGSHEQLLEAEGAYHRLY... 640
148 0.000e+00gi|163791423|ref|ZP_02185832.1| ABC transporter, ATP-binding/permease protein [Carnobacterium sp. AT7]  clstr ali  20  2...LKRFFSYYKPYKKLFILDFGCAILAAILELSFPVVVNRVIDDLL----PSENWTLIVTVSLSLLFLYIVNTSLQYVVVYFGHKLGVNIETDMRRELYGHLQEQPFSYYDNQKTGKLMTRLTNDLFEISEVAHHGPEDVFITFITLGGAFLLMLNVHVQLALATFVMIPFITIAL-VFFNKRMTKINTKIFNDLGEFSAGIEASVSGIRVVQAFANEEHEAGKFEVLNQAYRKSKILFYKMMAISSSYNYLLIRLINLFALFFGAYYTIQGEISYGDFVGFILLSNIFVRPIEKVNTMIESYPKGIAGFKRLTEELDKEPAIQDKEAIEVERLEGNIDYKNVSFWYDSL-KKVLDGIDLSIRTGETVAFVGPSGAGKTTICNLLPRFYEVNAGEVTIDGINIQDMTMQSLREQVGVVQQDVYLFPGSIKENVAYGKLDASEDEIQEAVRLAHLEKVVMPEGLNTIIGERGVKLSGGQKQRLSIARMFLKNPPILILDEATSALDTETEQVIQESLNSLAEGRTTLIIAHRLATIKHATRIVVVTEEGIAEQGSHEKLLANDGPYKKLYEA. 567
149 0.000e+00gi|260589703|ref|ZP_05855616.1| ABC transporter, permease/ATP-binding protein [Blautia hansenii DSM 20583]  clstr ali  22  24..AMKRLLNYMKRYRLQLVVMMVFAVGSTIFNIVGPKVLGKATTELYISGGAGIDFGKIGEILLFALGLYLISSAFSFIQGFIMTGISNQVTYNLRKDISVKINKIPLKYFESRTHGEILSRITNDIDTLQTSINQSFTQLITSVTMLIGVLIMMLSINVYMTVAAILILPISMMIIGKVM-KHSQKYFQQQQKYLGEVNGQVEEIYSGHNVVKAFNKEEDVIREFEKTNEKLYTTGWRSQFFSGMMMPIMQFVGNLGYVMVALLGGFLVIKEKVMVGDIQAFFQYIRNFTQPIQQIAQVTNMLQSSAAAAERVFEFLDEEEEDQTVENPVITTIEGNVEARHVAFGYQ-PEHLIIHDFSGDVKAGQKVAIVGPTGAGKTTMIKLLMRFYDVNSGEILIDGHNIKDFNRIQLRELFGMVLQETWLFHGTIMENIRYGRLDATDEEVIAAAKAAHAHHFIMPGGYQMVLNEETSNISQGQKQLLTIARAILADNKILILDEATSSVDTRTEERIQAAMDNLMKGRTSFVIAHRLSTIRDADLILVMKDGDIIEQGTHQSLLAANGFYANLYN.. 599
150 0.000e+00gi|326792506|ref|YP_004310327.1| xenobiotic-transporting ATPase [Clostridium lentocellum DSM 5427]  clstr ali  21  14..TLKKVLRYIKKYRSLMLISILLAVIIVALTLYVPILIGKAIDGI---AYSQIQFDYILKQLMIVAIIVSITAIAQWFMNMINNKVTYQVVRDMRDEAFKKIEILPLKYIDTHSQGDIVSRVIADVDQFADGLLMGFTQLFTGVITILGTLLFMLTINVSITFVVVLVTPLSLFVASFI-AKKTYTMFKLQSETRGEQTAFIDEMIGNEKVVKAYGHEEEAIKKFDEINDRLAKYSLRATFFSSLTNPTTRFVNSVVYAGVAITGAFAVLNGKMTVGAWSCFLSYANQYTKPFNEISGVVTELQNALACAARIFELIEEEAQAPEPQAVTLENANGNVSCKNVSFSYV-PEKKLIENFNIQIKPGQKVAIVGPTGCGKTTLINLLMRFYDVNQGSIQVDDKDIREMTRRSLRLNYGMVLQETWLKKGTIKENIIMGKPDATDEEITAAAQAAHAHSFILPKGYDTVIEEDGGMLSQGQKQLLCITRVMLTEPPMLILDEATSSIDTRTEIKIQSAFNRLMEGKTSFIVAHRLSTIQNADVILVMKEGKIIEQGNHNELLGKKGFYYQLYN.. 580
151 0.000e+00gi|111021149|ref|YP_704121.1| bifunctional ABC lipid A exporter [Rhodococcus jostii RHA1]  clstr ali  21  39....KRLLRRLGPHRIAVGIVILVAAVSVVLTSIAPRMLGQGTNLIFDGPGVGIDFSALGRVLAIVLALYLGSAVFMWLSGFLLNIIVQGVVKNLRAEVERKIHRLPLRYFDSHSRGDLLSRVTNDIDNVSQSLQQTMSQLIVSAMTVIGILVMMIVISPLLALIAVLTVPLSILVTAQI-AKRSKTHFVSQWKSTGALNSHVEEAYTGHELVTVFGRSREVEARFEEQNEALYQASYRAQFISGLIMPAIMFLGNLNFVAIAVLGGMRVASGTMSLGDVQAFIQYSRQFTQPLTQIGAMVNLMQSGVASAERVFAILDEDEEEPDAEAPTPAEPRGRVEFSDVSFSY-SPEKPLIENLSLVAEPGQMVAIVGPTGAGKTTLVNLILRFYELDGGKILLDGVDTAEMSRDDLRSRIGMVLQDAWLFGGTIRDNIAYGRPDATEDEIQAAARISYVDRFVLPDGYDTVIDEEGSNISAGEKQLITIARAFISQPSILILDEATSSVDTRTELLVQHATAVLRSDRTSFVIAHRLSTIRDADLIVVMEDGRIVEQGSHDDLLLTRGAYYRLYN.. 651
152 0.000e+00gi|126700433|ref|YP_001089330.1| unnamed protein product [Clostridium difficile 630]  clstr ali  19  9.KTIGRLLPFVKKYKFSFIIAIICIISAATMNALAPKLTKDVISIAKGVPGASVNFDYVTKILVILACIYFANAIFTYTSSFLLTNAIQNTMRDLRNEVENKIRRLPISYFDSNSFGDVLSRISNDVDTISNALQQSFMQIVNSILVIILALSMMFTINIYMALIALFIIPISYFVSKFVV-KKSQSRFSLQQNALGKLNGKVQEMYTGFNEIKLYGKEEDSIKEFKKVNQELCENGFKAQFISSMMNPMVSLVTYFGIAAVAVVGSIYAVSGGITVGNLQAFVRYIWQINQPLSQMTQLSTVIQSSFAAIERVFEILDEEEEIPDVENPVIENVKGNVTFEHVNFGY-GENSTLIEDLNAEVKSGQMVAIVGPTGAGKTTLINLLMRFYDVKKGAIKIDGVDIRDMKRKDLRSMFGMVLQDTWLFNGTIFENIEYGRFGATKEEIIQAAKVANVHHFILPDGYNMFLNEEASNISLGEKQLLTIARAFISDPSILILDEATSSVDTRLELMLQKAMRNLMNGRTSFVIAHRLSTIRNADLILVMNNGSIIEQGNHDELMEKGGFYEKLYN.. 587
153 0.000e+00METAHIT MH0086 GL0036879 [Complete] locus=scaffold85822_1:4614:6350:-  ali  22  6..TIKKVLRYIKKYSFYVICSLVLAVITVALTLYVPILTGNAVDVIVGPGQ--VNFGKITQILMKIAIAIAVTMVAQWIMNVCNNKITYNVIRDIRSEAFEKLQDLPLKYLDGHSYGEIVSRVIADVDQFADGLLMGFTQLFTGIITILGTLLFMLSVNVSITLVVVVITPVSLFVASFI-AKRTYEMFKLQSETRGEQTALIEETLGNQKVVKAFGYEKRAEEQFDEINEKLRKCSLKGIFFSSITNPATRFVNSLVYAGVGISGAIFAIHGGITVGQLSCFLSYANQYTKPFNEISGVVTELQNAIACAGRIFELIEEKSQTKDADAVVLEQATGEVDLEDVYFSY-EPDQKLIEKLNLSVKPGQRIAIVGPTGCGKTTLINLLMRFYDVNSGTIRVSKKDIQEITRHSLRANYGMVLQETWLRQGTIRENICMGKPDATEEEMIAAAKASHAHSFILKNGYDTVIGEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEIHIQQAFSKMMQGRTSFIVAHRLSTIQEADVILVMKDGHIIGQGNHEQLLQQNGFYATLYN.. 573
154 0.000e+00METAHIT MH0056 GL0066388 [Complete] locus=scaffold19006_2:1223:2989:+  ali  21  10.SPLMIFLSYFKNHRWLFAADVTCAVGIAAIDLLFPLVTRSALYEML----PNQMYRTFFTIMVIVAVCYVLRSFLNYVVAYYGHTFGIRVEADIRRDLFRHMQELSVDFYDRNRTGKLMARLTSDLFELTELAHHGPEDLITSVLTILGALIVMASIRWQLAVIVALTIPVFLTVAMAMRGR-MGRASAAAKEKIGHINQEIESSLSGVRTAKAFANEAVEAARFDAANAEFKTSKRAFHKAMGMFHSSVEFFLCSLNVIIIGFGGYYVMQGEMDYRDLLTFSLYISSFISPMRKLANFSETFANGFAGLNRFVEVMRTEPTVQDPDAKELKNVRGEIRVDHVSFAY-DADLAVLHDVSLTVAPGETVAIVGPSGGGKSTLCQLIPRFYDVSSGSISIDGQDIRDVTQRSIHENIGIVQQDVFLFADTILENIRYGKPDATMEQVIDAAKKAEIYDDIMPDGFNTYVGERGTLLSGGQKQRIAIARIFLKIPPILILDEATSALDSVTEAKIQHAFDKLAAGRTTLIIAHRLSTIRNADRIISISDGVITECGTHDELLKKGGIYAELYKT. 577
155 0.000e+00Gut.JP.Meta  ali  21  14...LRIFLSYFGPHRRLFLLDMLCALFIGAVDLIFPLISRRAINTMLPAHA----YHTFFVVMGIMAAAYLVRAFFYYIIAYYGHTFGIRVEADIRRDLFRHMQSLGYEFYDHNRTGQLMSRLTTDLFEITELAHHGPEDLMISLLTIVGALAVMFTIEWRLALVVCVILPILLIVV-ITRRRKMSRVSRGVKKRTAAINAEIESSLSGIRTAKAFANEAVEFGKFSEANDRFKVSKREFHREMGIFSGSLEFFLSILSVAVITVGGTLIMQGRMDLVDLFTFSLYISTFTSPVRKLVNFAEMFANGFAGLGRFVELMRTEPKLRDPDAKALGHVRGAIDVEDVSFSY-EENQEVLEHVTLHVQPGETVAVVGPSGGGKSTLCRLIPRFYDVTSGRICIDGQDVRSVTQESLHHAIGVVQQDVFLFADTIANNIRYGRPDATMEEIREAARQAEIYDDIMPDGFDTYVGERGTLLSGGQKQRVSIARIFLKNPPILILDEATSALDSVTESKIQHALDHLAEGRTTLIIAHRLSTIRSASRILVVADGRICEQGTHEELMRLGGLYATL.... 576
156 0.000e+00METAHIT MH0068 GL0051133 [Complete] locus=scaffold6359_2:3041:4906:-  ali  22  44.QTMLRLLSYLKRDRMAMTVAFFCVILGTVTNLAGAYMLRPIINRYIVPLDGSRDVAGLFRSLCVMGAVYLVSVAAAYMQSRIMLQVAQNALQRLREELFNHMQTLPLRFYDTGSNGDLMSRFTNDVDKIGMMLSSTLVQLLSGALSIVGTLVLMIYTNVWLTVITLAMMPVMLRAGKFVAGR-SQKYFSAQQAALGAMNGYIEETVQGQKVVKVFCHEEIAEEEFGWLNADLKEKQIRAQFFGGVMGPVMNNLSQLNYGLTACIGGLLCVFRNFDVGGLTVFLGFSRQFSRPINELSMQVGNVFSALAGAERVFAVLDAEPEAADPDAVSIAPIRGEVVLDHVTFGY-EPGQVILKDISLYAKPGQKIAFVGSTGAGKTTITNLINRFYDIQGGSITVDGVDVRRMHRKELRENIAMVLQDTHLFTGTVRENIRYGRLDATDEEVVEAAKTASAHSFIMPDGYDTMLEGDGANLSQGQRQLLNIARAAVSKAPILILDEATSSVDTRTEKHIEHGMDRLMADRTTFVIAHRLSTVRNANAIMVLEHGQIIERGDHEDLLAQKGRYFELY... 614
157 0.000e+00gi|253576468|ref|ZP_04853797.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786 str. D14]  clstr ali  23  43...FRRLFAYMKPYKQMLPLIILMTVLGTVTKLAVPYLTSLAIDRAIAPANGQTNLLLLYGITASVLVLYLIQWASGVYRIKFTNIIGQRVIYDLRADLFKHIQKLSFNFFDKRPAGSVLVRVTNDVNSLQDLFTNGVVNLMIDCVQLAGIVVILLLINWKLGLAVMVTVPIM-FLISTKLRQKIRMAWQEVRMKNSRINSHLNESIQGIRVTQAYTQERENMRYFDSMNLSNKKSWDKASAMNQAFGPLIEITGGIGTFVLFVLSVYLIQSGELTIGLLVAFSNYVGNFWDPINRLGQMYNQLLVAMASSERIFEFIDEEPNIADPGAKPLPVITGEIRFNHVVFEY-EQGRPALKGIDLEVQPGQSIALVGHTGSGKSTIINLLSRFYDPSGGSVVIDGHDIRDVTVQSLRSQIGVVLQDTFIFSGTIRENIRFGRLEATDEEVEAAAKAVNAHDFILPNGYDTEVEERGNVLSMGQRQLLSFARALLANPRILILDEATASIDTETELKIQEALKVLLKGRTSFIVAHRLSTIRSADKIVVLDHGEIRESGTHRELMERKGIYYGLVQA. 613
158 0.000e+00gi|340757748|ref|ZP_08694342.1| lipid A export ATP-binding/permease MsbA [Fusobacterium varium ATCC 27725]  clstr ali  21  2...FKKFIAYYKPYKKMFFLDLLVATISALCDLVYPMITREIANHTI----PNREFRAIGVFAGVLIGIYVIKMFCAYFMQYWGHLVGVGMQADMRRDVYSHLQNLPIRYFDNTQTGSIMSRIVNDLQDISELAHHGPEDLFISFFMIVGSFLVLIRINVGLTIIIFCLLPLIII-YSLFQRKRMLAAFVKTREKTGDINARLQNSISGIRVSKAFVINENERERFEEDNQRFVDARSKSYKIMAEYGAGVGFLTDLLDYAVLIFGGIFAYMGKINIGDFLAYLLYIKIFTQPIKRLIAFVEQYQNGMSGFKRFLDIISEEEETDKPNAEELGKVEGEIDFQNVSFK--HEDKEVLKNVSLKIPKGKMLALVGPSGGGKTTLCNLIPRFYTIDDGDIKIDGKSIYDVKLESLRKNIGIVQQDVFLFTGTIKENILVGNSEATDDEVMIAAKKANIHDLIMPDGYNTFVGERGVKLSGGQKQRIAIARIFLKNPPILILDEATSALDNITERLIQKSLEELCKGRTTIVVAHRLSTIQNADEIIVLTDNGIEERGTHKELLENKGFYHKLHN.. 564
159 0.000e+00METAHIT MH0060 GL0101712 [Complete] locus=scaffold47795_1:4336:6132:-  ali  22  18FAAIKKLLKYARPYVPVIIIALVLSALQIAATLLAPVVVGKTVDYII--GENNVNFGVIFKNAGILAGLIACVFVFQYLASLCINFASFRTIRDLRSSAYAKLNDVPLSYVDSNSHGDLMSRVGNDIDQISDGLIQGFSQLFNGVVTIIGTLGFMLWYNWVIALVVVCLTPLSLF-VAYFIAKGCHNMFAMQAKKRGELSGLVTEMLSNQRVVKIFGYEKRAEDRFAVINGDLKVWGQNAAFYSAMVNPCTRFVNNVIYVVVCVLGVYLVIKGTLSVGALSCVLSYATQYTKPFNEITGVVTELQGATAAASRVFDLLEAQNQSSDAGFEELTDAHGNIDIDDVYFSYV-KDKPLIQGFSLHVKSGQRIAIVGPTGCGKTTLINLLMRFYDPDSGKIEVEGKDISKVTRKSLRLSYGMVLQDTWLKKGTVRENIAYGNPDATFEEIVDAAKAAHIHNFIMENGYDTVLDDDGGNISQGQKQLLCIARVMLTHPPMLILDEATSSIDTRTEIKIQQAFEKLMQNKTSFIVAHRLSTIKNADMILVMNKGNVIEKGTHEQLLAKGGFYANLYN.. 593
160 0.000e+00gi|15895658|ref|NP_349007.1| unnamed protein product [Clostridium acetobutylicum ATCC 824]  clstr ali  19  1MKTLFRLASYVGKYKMYMFISLIFALISNVLIAFMPLIVGKGIDNI--KSQGKVDFNNLLKIIIVLAAVYLISSIFTWLFTAVANILAYNTVRDLRNEALSKISTLPLKYFDVNPHGDIMSRLTNDMDAISDGLFQGITQFFPAIVTIISSILLMLSLSIKLTGIIILMTPLCFFIASFIT-KRSNKMFKQQQNTVGELNGYIEEIIGNEKIVKLFGYEKRAEKKFSEINSRLYNCGQLAQFYSSLTNPSTRFVNNITYVLVGAVGGLLAVLSGLSIGTISSFLTYSTQFSQPINNVTGVATQLQAAFASAERVFSILDEIPEKKDEGAKKFEHCEGNISFNNVSFSY-NKKQPLIENFSVDIKKGSTIAIVGPTGAGKTTMVNLLMRFYDIDGGKITIDGKDINKMKRNDVRGQFGMVLQDTWLFEGTIKENIAYGKPDASMEEIESAAKKAYIHNFILSDGYDTRITESGGNLSEGQKQLLTIARVMLINPPMLILDEATSSVDTRTEIKIQNAFLKMMEGRTSFVIAHRLSTIKDADLILVMKNGHIVERGKHEELVNSEGLYREIYE.. 572
161 0.000e+00gi|182416847|ref|ZP_02948233.1| ABC transporter, ATP-binding/permease protein [Clostridium butyricum 5521]  clstr ali  21  34..SMKKLFNYLFKYKFSVILVIFFAIGSTAFSIIGPKILGNATTEIFNGGGSGIDFTKISRILITLLVIYLISAVFSFIQGFIMTGVSQKLTYRLRKEMIEKIDRMPMNYFDRRTHGEVLSRITNDIDTLNQSLNQSMTQIITSITTIIGIVFMMCTINVIMTCTIVLIVPISLIFITFI-AKKSQKYFKEQQDYLGHVNGQVEEVYGGHNIVKVFNGEEDAINRFNTDNETLYKSAWKSQFLSGLMQPIMMFISNIGYVAVAILGGFFAIQNKISVGDIQSFIQYTRSFTQPLAQIAQISNMLQSIAASSXXXXXXXXXXXXXQFADNPEIENIEGNVEFRNVKFGYY-PDKTIINNFSLKVNEGKKVAIVGPTGAGKSTIIKILMRFYDINNGDILIDGKSIYNFNRRDLRKLFGMVLQETWLFNGSIKENIRYGNLDASDEEVHNAAESAEADEFISTEGYDMILNEEVSNVSQGQKQLLTIARAILKDPKILILDEATSSVDTRTELKIQKAMDTLMEGRTSFIIAHRLSTIKNADIILVLKDGDIIEQGNHEELMAMNGFYTNLYN.. 609
162 0.000e+00gi|206901744|ref|YP_002250360.1| multidrug resistance ABC transporter [Dictyoglomus thermophilum H-6-12]  clstr ali  22  45..TLKKLLKYMVLYKWGFIFAFLLVVISSILGIIGPYLIGRAIDLYILPRR----FEGFFNFLLLLGGIYLLSSFLAWLQGYIMLKTTQSLVFTLRRDLFNKFHSLPIKFFDLRPYGDLMSRITNDVDNISMVLATSVIQFLSAVVSLTGIIIMMLRISLPMTLVSLLNIPLTIILTNFI-SKKTRNYFYANQTLLGKLNGIIEEDISGLKIIKIFNREEKEIRKFEEVNNDLTQVGIRAQIFSGSIGPLMNLLNNLGFALIAGVGGFFAYRKMITVGDITVFINYSRQFTRPINELANQYNMIQSAIASAERLFEIMDEEDEKDTVDAVELQDIKGEVEFKNVWFSYV-KEKPVIKNVSFHVKPGEIFALVGPTGAGKTTIASLVARFYDVDEGEILXXXXXXXXXXXXXXXKYLGIVLQDTLLFSTTVRENIRYGRLDATDEEVEEAAKLAHAHDFILPQGYDTVLSEDGGRLSQGQRQLIAIARAILANPRILILDEATSNVDTVTEKYIQKAMLNLMSGRTSFVIAHRLSTVKNADMILVINNGEIIERGTHEELIRKKGFYYHLY... 609
163 0.000e+00gi|153811099|ref|ZP_01963767.1| hypothetical protein RUMOBE_01490 [Ruminococcus obeum ATCC 29174]  clstr ali  22  14METLWKVLRFIGKYRFLLVLSIILAAVSVILQLYVPVLFGNAIDQVVAKRE--VNFRMMWYYLSRILVMIIVSSVATWIMNIINNRMTFRTVQDIRAKAIRHIQVLPLSYLDSHSTGDIISRVIADTDILSDGLLLGFTQLFSGIVTIIGTLLFMFSKNIWITLMVIVLTPLSFFVAKFISSRSFH-MFRKQSDARGRQTALIEEMIGNQKIVQAFGYEDKSSGRFALINEELKECSQKAVFYSSLTNPSTRFVNNVIYAGVALAGAFMIPGGSLTVGGLSVLLAYANQYMKPFNDISSVITELQSALACAARIFALLEEEPESADSKD-TITDVRGEVNIDNVCFRYV-PDKKLIENFNLHAEPGKHIAIVGPTGCGKTTFINLLMRFYDVTSGTISIDGHPINEISRHSLRSSFGMVLQDTWIKNGTVRENLNIGKPDATDEEIIEAARHSHSWEFILPNGLDTRLKED--SLSQGEKQLLCITRVMLCLPPMLILDEATSSIDTRTELMVQEAFDRLMEGRTSFIVAHRLSTIRNADEILVMKAGSIVEQGSHDELMAKGGFYQNLYN.. 579
164 0.000e+00gi|334138104|ref|ZP_08511527.1| ABC transporter transmembrane region [Paenibacillus sp. HGF7]  clstr ali  21  46..TLRRLWAYFGSERKLLTVIFALILIGAALTLVGPYLIGVSVDAM-SHPEQGVDFGILKTMVLVLLLAYLIDAVFTFLQSWLMAGVSQRIVMRLRGALFAKLQKLPVAYFDTRPHGELMSRLSNDIDNVSSTISQSTTQLMSGVIAIVGSLAMMLVLSPTLTLASLVTVP-ILFVLTRTITKKTSVLFKNQQIQLGKLNGHIEETISGLQVVKAFNHEEKAIAEFEQVNAELCEVGLKAQIRSGFLMPLLNVINNIGFAAVALVGGILAVRGDITVGVIASFLSYSRQFVRPLNDLANIFNILQSGVAGAERVFEVIDEKEEPSDAEAVELLHPKGHVVFENVSFGYR-PDVPILKNVSFDSAQGSSTALVGPTGAGKTTIVNLLTRFYDVTGGRILIDGRDIREYTRDSLRRTFGIVLQDTYLFSGTIKENIKYGRPDATDXXXXXXXXXXXXDVFILPAKYETLLSENGGNLSQGQRQLLAIARVILAKPSILILDEATSSIDTRTELHIQDALLKVMQDRTSFIIAHRLNTIRDADTIMVIDHGEIVEKGAHDTLIGQQGVYSRM.... 612
165 0.000e+00gi|332637434|ref|ZP_08416297.1| multidrug resistance ABC transporter ATP-binding/permease protein [Weissella cibaria KACC 11862]  clstr ali  19  27.QTIGRLFGYLGNYRAGVIVSLVITAISVVLSVRAPKVLGEATTVIFDDVTKSIQMDKVVQILMLVSALYLIAALFSVIQQYIMTRVAQGTVYQLRKDFKDKMARLPVSYYDSHQNGDIMSRMVNDMDNIQGTLNQSLIQLVNSALTFVGVIYFMLTISWQLSLVAFLTVPLSLLIVRIIAPR-SQRYFARQQAALGLLNDQVEETFAGHTVVKTFNQEQPMIMKFDAQNEDYYKAAWKAQFVSTVIFPSMRFVNNLDYLAMAVIGGIKVASGTVSLGDVQAMLQYTNQFSQPITQIANLTNTIQATVASAERIFQVLDEPEELTPVGPITTDDI---VTFEHVAFSYQT-DQPLMTDYSMSVKPGQMIAIVGPTGAGKSTMINLLERFYDTTSGVIRLRGADTRGMTREDLRQHFAMVLQETWLFEGSIMDNLRYGRLEATDDDVITAAKMAHADEFILPDGYDTILNQDATNISQGQRQLLTIARAFIANPEILILDEATSSVDTRTERMIQDAMAKLLAGRTSFVVAHRLSTIRYADQILVMENGNIVERGRHDDLLAAGGEYAKLYN.. 603
166 0.000e+00gi|374294829|ref|YP_005045020.1| unnamed protein product [Clostridium clariflavum DSM 19732]  clstr ali  23  11...LRKVLKYIKEYRILMLISIVLATATVALTLYVPILIGRAIDCIIGPG--NVDFEAISKLLFKIGITVAATCTLQWLMNHINNKITYHVVRDIRKKAFRKIEILPLSYIDAHPHGEIVSRIISDVDQFADGLLMGFSQLFTGIVTIAATFIFMLAINVKITFIVVILTPLSLFVADFI-AKRTYSMFKLQSETRGEQTSLIDEMIGNAKIVQAFSYQEEALKRFDEINERLEKHSLRAVFFSSLTNPCTRFINSLVYASVALAGGLIVIGGAMTVGGLSIFLSYANQYAKPFNEISGVITELQNALACAGRVFELIEEQPQIPDPNAINLEKASGNVALENVAFSYV-PERPLIRDFNLRVKPGQRVAIVGPTGCGKTTVINLLMRFYDINSGSIKVEDIDIRDITRKSLRANYGMVLQDTWLKSGTIRENITLGKPDATDEEIIAAAKASHAHSFILPNGYDTVIGEDGGSLSQGQKQLLSITRVMLCLPPMLILDEATSSIDTRTEIKIQEAFARLMQGRTSFIVAHRLSTIREADIILVMKDGNIIEQGTHEELLSKNGFYANLYN.. 581
167 0.000e+00gi|350568726|ref|ZP_08937124.1| multidrug resistance ABC superfamily ATP binding cassette transporter, membrane protein [Propionibacterium avidum ATC  clstr ali  22  39..SLRRLLGQLKPHRLVLTTVVIMAVISVTFNVIGPKILGRATDVIFGGIGSGIDFHRLGVIMAWALGLYACAALLMFLQGFLLNTAIQRSMYDLRRQVSAKLERLPLSYFDGQPHGELMSRMTNDIDNVSXXXXXXXXXXXNALLTVIGVLIMMFWISPLLAVISLVIIPVAGVIAGAI-GKKAQGQFAQMWKATGELNSHVEEAYSGHALVKTLGRTQAVAQEFHERNEELRRATAKAQFISGLIQPAMFLLGNANYAVIVLIGCLRVANGQMPLGNVQAFIQYSRMFTQPITQIASMANLLQSGVASAERVFQVLDADEMSTEADD-SLPATKGRVVFDHVRFSY-SPDKPLITDLSLVAEPGQTVAIVGPTGAGKTTLVNLLMRFYEIDGGVITLDGFDISTVPRTELRSRLGMVLQDTWLFSGTIHDNIAYGRPEASEEEILDAARAAHVDHFVLPDGYQTVIDEDGSNVSVGQKQLITIARAFLSAPDLLILDEATSSVDTRTEMLVQEAMANLRKGRTSFVIAHRLSTIRDADLILVMEHGDIVEQGTHTELLERRGHYHDLYQ.. 654
168 0.000e+00gi|163789468|ref|ZP_02183907.1| ABC transporter, ATP-binding/permease protein [Carnobacterium sp. AT7]  clstr ali  21  22.RTLRRLLSYMSTRLIAIIAVFALAIIAIVLQTQTPKILGEATTEIFNGVVEGIDFDLIARILFTVAVFYILSAIFRYFQQFTMTRVAQRTVYDLRKDLKAKMNRVPMNYYDTHSNGDIMSRAVNDMDQIANTLQQTLTQFVNSLVTFFAVLYMMLTISGTLTLVTLITVPISALVIGLIAPR-SQKSFAAQQKSLGILNNQVEETYSGHVVVKSYNHEETEIKTFEEKNDQLYQASRNAQFLSGLIMPLMAFVRNLGYLVVAVVGGVFVANGTVTLGNVQAMLQYSNQFNQPIREMANLINMIQATVASAERVFEVLDEEEMTDESASIQPPNSPYKVQFEHVQFGYGGKDEPLLKDFNLNVEEGQMVAIVGPTGAGKSTLINLLERFYDVSGGSIKIDGVDTRDFSREEVRSRFAMVLQDTWLFNGTVLDNIRYGSAGQDDERVYNSAKAAHVDDFVLPHGYETILNEEASNLSAGQRQLITIARAFLADPEILILDEATSSVDTRTEVLIQKAMRKLLKGRTSFVVAHRLSTIRDADNIIVMDHGDVIETGTHDELMAQKGFYADLYN.. 610
169 0.000e+00gi|219855249|ref|YP_002472371.1| hypothetical protein CKR_1906 [Clostridium kluyveri NBRC 12016]  clstr ali  21  37.KTLFRLWKYFGSERKLLXXXXXXXXXXXXXGLLGPYLIGKSIDAM-SELKGKVNFDILSVMVILLLFTYVLDAILTFFQGWLMAGTAQKIVMNLRRSLFDKLQKLPISFFDRNTHGEIMSRLTNDIENVSSTISQSTTQLMSAVVTVLGSFIMMLVLSPILTFVTLITVP-MVFFLTKGIAKNTSVLFKEQQVQLGKLNGHIEENISGIHVVKAFNHEQKAIEEFKKINYSLSQVGLKAQIWSGFLMPIMNVINNIGFAAVAGVGGILAVKNIITIGIIASFLSYSRQFARPLNDIASIFNTLQSAVAGAERVFDILDEKEEIKDAEAVTLENTSGQVTFENVNFSYR-KDFLILKDINFNINQGTSVALVGPTGAGKTTIVNLLVRFYDVSSGKILIDGIDIRNYTRDSLRKCFGIVLQDTYLFTGTILENIKYGRLDADFSQVKEAAQAAGADQFIFPHKYDTMLQEGGSNLSQGERQLIAIARAILSDPYILVLDEATSNVDTRTELKIQKAMRKLIRKRTSFIIAHRLSTIRDSDIIMVIDGGTIVEVGNHSDLIGKKGIYYNMY... 605
170 0.000e+00gi|156742466|ref|YP_001432595.1| ABC transporter-like protein [Roseiflexus castenholzii DSM 13941]  clstr ali  21  24....RRLLGYLLPYWKRXXXXXXXXXXXXXSQALGPLLIGVAIDSAIAQRDGGE----LNRLMLALLVVYVAGMAAGRYQFMLMGEVGQQVLAHLRSEIFAALQRMSLRFFDRRPAGELMSRLVNDTEVITQLMGQGLVQVLGSLFGLIGILVAMVALDWRLALASFIVIPVMIWMTSL-FSQMSRRAFRRTREAIGDVSAEIQEEIAGVKVAQAFTRTNLNQQRFAQRNAANRDANVSATAITSAFMPAVDVLSTVAIAIVAGFGGWLVIQEAVTVGVVVAFLTYVQQFFRPVQALSAFYTTAQSALAAGERIFALIDTPPDLVDPDAQPLGRIEGRVEFDHVWFSYRDEERYVLKDICLTAEPGQAIALVGPTGAGKTTLVNLIGRFYDVSAGAVLIDGIDVRKVTRASLRSQMGVVLQDSFLFSGTIADNIRYGRLDATDADVEEAARAANAHEFIMPDGYQTQLSERGGNLSQGQRQLIGIARAILADPRILILDEATSSVDTRTEQLIQQALRRLLRGRTSFVIAHRLSTIHDADLVLVLDQGRIVERGTHDELLARGRLYAELHRR. 597
171 0.000e+00Oral.Meta HOMD bcla_c_1_2860 Bacillus clausii KSM-K16 [1432762 - 1434549] ORF  ali  23  15LKTIKRYLVFVKPYRKEIIGTILIGLLKFGIPLLFPLAMMYIIDDVLLNEELSIQSSQLYWIIGGMAFLFIVRPPIEYYRQYFAQWIGNKVLYDIRDHLFTHIQKLSLRFYSNRKVGEVISRVIHDVEQTKNFVITGLMNIWLDLATILIAIAIMLQLNVWLTLVAISMFPFYGFSIKYFYQR-LRKLTRTRSQALADVQGHLHERVQGMNVIRSFANEEYEQKQFAVRNQRFLAKALDHTAWNAKTFAVVNTVTDIAPLLVLFVSALFVLNGSLELGAMSAFVLYMERLYGPLRRLVNSSTTLTQSIASMDRVFEFIDEKYDITDKGADVLTDVKGAVTFEHVTFSYDNEADPALQDIHLNIPAGQTVALVGMSGGGKSTLVSLIPRFYDVTKGRILIDGKDIRDLVVRSLRDNIGMVLQDNILFSDSVKSNIKIGKPDATDEEVIQAAKAANAHEFILENGYDTEVGERGVKLSGGQKQRIAIARVFLKNPPVLVFDEATSALDLESEHFIQEALEKLARDRTTFIVAHRLSTITNADTIVVIDDGKVVEQGTHKELMEKQGSYYKLY... 589
172 0.000e+00METAHIT MH0016 GL0109969 [Lack both end] locus=scaffold37161_1:2:1798:-  ali  22  37...IRRFLPYMAKYRGVLAFDLFCAALTTLCDIALPSIMRTLTNTV---SAAALTVDTVLRLAALYFVLRIIDGAASYFMSGIGHIMGVHIETDMRRDAFDHLLRLDHTYYNNTKVGQIMGRITNDLFDVTEFAHHCPEEFFIAGIKIAASFVILCQASVPLTLVVFACVPLMG-VVSVKLNRKLRERFRQQRFQIGELNATIEDSLLGQRVVKAFAAEDMEREKFAQGNRDFEQIKTLSYHAMAAFNTSTRLFDGLMYFVVILAGGLSLVCGAISAGDLVAYVLYVSTLIATIRRIVEFAEQFQRGMTGIERFAEIMDTPVTIADPDAKPLVVKDGGIDFDDVSFEYPDDHNKVLRHVDLHIRPGENVALVGPSGGGKTTLCNLIPRFYDVTGGKILIDGQDVRGVTLHSLRGAIGVVQQDVYLFSGTVAENIAYGRPGATRAEIEEAARLAGADAFVLKDGYDTYVGERGVKLSGGQKQRLAIARVFLKNPRILLLDEATSALDNESEILVGQSLDKLAKGRTTLTIAHRLTTIKNADRILVLGRDGIEEEGSHDELLAKQGVYY...... 599
173 0.000e+00gi|300854078|ref|YP_003779062.1| unnamed protein product [Clostridium ljungdahlii DSM 13528]  clstr ali  20  35.KTILRLWKYFGSERKLLVIILISVIIDSVVGLIGPYLIGRAIDAM-SESYGKVNFNMLWIMIMLLLLTYVVDAILTFFQGWIMSGVAQRIIMGLRKNLFGKLQKLPLSFFDMNTHGEIMSRLTNDVENVSSTISQSTVQLMSGVITVLGSFVMMLILSPFLTFVTLITVP-MVFLLTKSIAKKTNPLFKDQQIELGKLNGHIEETISGIQVVKAFNHGEKCIEEFNKINSSLCEVGLKAQIWSGFLMPIMNVINNIGFAAVAGVGGVLALKNIITVGIIASFLSYSRQFARPLNDIASIFNTLQSAAAGAERVFEVLDEKEELEDSDAKVFEHVKGRVSFENVSFCYR-KDVKILKNISFDISPGTKVALVGPTGAGKTTIVNLVTRFYDVSAGKILIDGEDIRNYKRDSLRKCFGIVLQDTYLFAGTILENIRYGKLDADFTEIKQAVRFANAETFILPQKYNTLIHEGGNNLSQGERQLIAISRAILSNPAILVLDEATSNVDTLTELKIEDAMNKLMKGRTSFIIAHRLSTIKNSDIIMVVDKGEIVEKGSHKDLIKKKSMYYNMYN.. 604
174 0.000e+00gi|157691600|ref|YP_001486062.1| ABC transporter ATP-binding protein [Bacillus pumilus SAFR-032]  clstr ali  23  1MGVIKRYMAFVTPYKKQIALTMVIGMIKFSIPLTLPLLLKYVIDDVIQGGSADEKTSSLLMIMGIMLVLFLVRPPVEYYRQYYAQWTGSKVLFDIREKLFSHIQKLSLRYYANTRTGEIISRVINDVEQTKEFVITGLMNIWLDLMTVLIVIAIMCTLDIKLTIVSVIIFPLYAFAVKFFYGR-LRKLTKERSQALAEVQGHLHERVQGMPVIRSFAIEEYEQENFHDENKNFLNKAINHTNWNAKTFAVVNTITDIAPLLIIAFAGYTVINGSLSIGTMIAFVGYIDRMYNPIRRLINSSTTLTQSVASMDRIFEFIDEPYEVTDPNAKEADHLKGEVEFKHVSFRYEHTQEEILRNISLKVEKGQTVALVGMSGGGKSTLVSLIPRFYDVTNGSLEIDGIDIKEYKARSLRNQVGMVLQDTFLFSDTIKENIAVGDPEASFEKIVSAAKAANAHDFIMPEGYDTKVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMQKLAKDRTTFIVAHRLSTITHADLIVVMEQGEIVEKGTHEELMNRDSHYRHL.... 573
175 0.000e+00gi|342732805|ref|YP_004771644.1| ABC transporter ATP-binding protein [Candidatus Arthromitus sp. SFB-mouse-Japan]  clstr ali  19  2...LKSFISYYAPYKKLFFMDMLAAFMVAIIDLVYPMITRNIINDAV----PNRNIRMIFVFCIILLVIFIIKAGLNYFIQYYGHVVGVRMQGDMRRKVFKHLQKLPNEYFSNNKTGAIMSRIVNDLMEISELAHHGPEDVFVSLVMFVGSFTLLCRINVLLAIIIFAFVPVI-VVFSIIKRRKMSSAFRETRIKTGDVNAVIENSISGIRVTRSFVNEKSELNKFDNSNDMFREAREYAYKKMGEFFSGTFFLVDMLELIALIASAVFTFNGYITIGDFVAYVLYVKMFIQPIRKLINFSDQFQNGMSGFQRFEELLKVETEKESKDAKELKNVNGEIIIDNVTFRYESNNEEVFNGFNLKIDAGKTVALVGPSGGGKTTICSLIPRFYDVCDGSIKIDGIDIREVTLDSLRRNIGIVSQEVFLFTGSIRDNIIIGKPDATDEEVMDACIKARIHDFIMKDGYDTFVGERGLKLSGGQKQRISIARVFLKDPKIMILDEATSALDNITEREIQESLEELSRGRTNIIVAHRLSTIQNADEILLIGKSGIVERGTHNELIDKGGVYKSLYSTV 568
176 0.000e+00METAHIT MH0065 GL0021160 [Complete] locus=scaffold23164_4:1280:3040:-  ali  20  9.KPFSIFMSYIAGHKKLFGIDMLCALLVALIDLIFPYVSRYSMKVML----PNKLYATFFTVMAVMVLAYVLKAGLYYVITVIGHKMGVLVESDMRRDVFTHMQSLSFSYYDHNRTGVLMSRITSDLFEITELAHHGPENIVICTLTIVGALAVMFAMQWQLALVITLALPLCAW-FTIKQRIKMKEANIEVKRKTAEIYSAIESSISGIRTAKAFANEDQESDKFDRANEMFRGSKVEYYKSMGLFNSGMEFTTGIVQVVVIAVGGLLIMREKMNYIDLITFSLYVSTFVSPVRKLTQFAELYMQGTAGFARFLEVMRTEPTIKDPDAMELGAVEGKIDYNHVSFNYGN-GIPVLSDVDLHIAAGQCLAVVGPSGGGKTTLCQLLPRFYDVCEGSVTVDGIDVRHVTQASLRRNIGVIQQDVFMFAGTIRENIRYGRPDATDEEIVEAAVRAQIHSEIMPDGYDSYIGERGVMLSGGQKQRISIARVFLKNPKILILDEATSALDTVTEQRIQASLDELSEGRTTIIIAHRLSTVKNADVIAVVEGEHIVEMGSHSELMAKNGEYAALCRA. 576
177 0.000e+00gi|357383382|ref|YP_004898106.1| unnamed protein product [Pelagibacterium halotolerans B2]  clstr ali  23  2...LRRFFSYYAPYKGLFFLDFGCAVIVGLLELSFPVVVQLYVDQLL----PSQNWFWILAAAAGLLVVYILNAGLLSVVNYWGHALGIGIETDMRRQAFDHLHKLSFRYFDNKKTGHLITHVTKDLEEVGEIAHHGPEDVFIAIMTFIGAFIIMALMNLKLAALTLFIVPVAAFLI-FKYGSAMTMTWKSLYGRVGDFNQRIEESIGGVRAVRAFANERHERKLFEGDNQSYRTTKLKAYKIMTASISMSYMAKSLVQLMVMLAGTALVMYGEMTYGQFVGFLLLITVLFRPIDKIISVIESYPKGIAGFKRFTDLIDTEPDIVDPNARKVSNLRGDIVFDSVNFAY-SENRPILRDITLSVKAGETIALVGPSGAGKTTICSLLPRFYEIDSGAITIDGIDIRDMTQDSLRSQIGIVQQDVFMFGTSIRDNIAYGRLGATDEEIMAAARSAQFDSVILPDGLDTMIGERGVKLSGGQKQRLAIARIFLKNPPILILDEATSALDTETEMQIQRALSALSEGRTTLVIAHRLATIRNADRIAVVADGRIVEEGAHDALVAKAGAYARLHNA. 567
178 0.000e+00gi|296140321|ref|YP_003647564.1| unnamed protein product [Tsukamurella paurometabola DSM 20162]  clstr ali  23  24..SLKRLLGMLESQRSAVVAAVVLAVGSVVAAVLAPKVIGSAVDAIYDGGGPGIDFDRVGTILLWVVALYIGSALLQYIEGYLLNGAVQRVMYELRRDVEEKLNRLPLSYFDKQPRGELLSRVTNDIDNLGQSLTQALGQLIISALTVIGVLVMMLVVSPVLTLVAILVIPLVVILTGQIM-KRSQKHFVGQWQHTGALNGQVEEAFSGHALVTVFGRRDAVKQRFDVENDALMTASYKAQFLSGLVMPISMFVGNLQYVAICVVGGLRVASGSMSLGDVIAFIQYSRQFTQPLTQMASMVNLLQSGVASAERVFTVLDADDEVADQAGALPVPTRGRVAFEDVAFGY-DPDEPLIEHLDLVAEPGRTVAIVGHTGAGKTTLVNLILRFYELTGGRITIDGTDIAQVRRAELRSKIGMVLQDTWLFEGTIADNIRYGRLDATDEEVRAAAKATFVDRFVLPDGYDTVLDDESGSASAGERQLITIARAFLAEPAILILDEATSSVDTRTEVLLQRAMRALRADRTSFVIAHRLSTIRDADVIVVMDHGRIVEQGAHDELLAAGGAYARLYRA. 599
179 0.000e+00gi|353184270|gb|EHB49797.1| Xenobiotic-transporting ATPase [Mycobacterium rhodesiae JS60]  clstr ali  23  31....LRLIRRLTPQRWPTAAVIALSIGGIALGVIGPRILGHATDLLFNGPGRGVDFTAVAHTLLLALGLYIVAALLVWAQARLLNVIVQRTITALRADVENKIHRLPLSYFDSRQRGELLSRVTNDVDNIQSSVSMTISQLLTSVLTVVAVLAMMLSISPLLALITVVTVPLSLWVTRAI-ARRSQRMFIAQWTNTGRLNAHIEETYSGFTVVRTYGHRAVAQEKFRDFNSDVYHASFGAQFFSGLVSPATTFIGNLSYVAVAVVGGYQVATGQITLGSIQAFIQYVRQFNQPLTQVAGMYNTLQSGVASAERVFDFLDEPEESPDAPITLPDNARGRVEFQNVSFCYL-PGTPVIEELSLVAEPGSTVAIVGPTGAGKTTLVNLLMRFYDVDAGRILLDGADIADISRESLRSRIGMVLQDTWLFGGTIAENIAYGKPGATRDEVIEAARAAYVDRFVLPGGYETRVSDDGGNISAGEKQLITIARAFLARPQLLILDEATSSVDTRTELLIQHAMTELRRERTSFIIAHRLSTIRDADKILVMDAGRIVEAGSHAELLARRGSYYSMAKA. 635
180 0.000e+00gi|374813674|ref|ZP_09717411.1| lipid A export ATP-binding/permease MsbA [Treponema primitia ZAS-1]  clstr ali  20  6.SSLRIFASYYRPHWKLFAADMFAASLIAAVDLSFPMMTKYTIEHFL----PNSLYKFFFIMIAAMGIMYLLRMGFTYFITYWGHTVGVYLEADMRRDLFSHLQQLPFSFYDNHRTGHIMSRVTTDLFEVTELAHHGPEDLFISIITFVGSIFLVFSIRWEMALVLLVFVPFMIVHILRSRSNMMKTA-RKVKERTAEINAALESSISGVRIAKAFTNESYETTKFRGGNENYKTARKYYFRSMANFQSRLDFLLHILNVVVIAAGGFLIMKGRMTLPELIACNLFVAAFLQPIRRLQNFVEQYTTGMAGFNRFIEIMRIRSDIIDKDAAALDKVRGDIEFADVSFSYNN-NIMVLNHINLSVPAGKTIALVGPSGGGKTTLCHLLPRFYEIQKGSITVDGMDIRDITLESLRRNIGIVQQDVFLFAGTIRDNIKYGRIDATDDEVIAAAKRADIHDDIMKEGYDSLVGERGVKLSGGQKQRISIARIFLKNPPILILDEATSALDTATELRIQRALGELSRGRTTLVIAHRLSTIRNADSIAVITDDGIQQQGSHNELLAKGGIYAELYAA. 573
181 0.000e+00gi|359766019|ref|ZP_09269838.1| putative ABC transporter permease/ATP-binding protein [Gordonia polyisoprenivorans NBRC 16320]  clstr ali  20  30..SMKRLVRLLMAYRWRMATVLTAIVGSVILLAAAPRILGHATDLIFDGPGVGIDFTTVAWTLLIVLICYVASSLLSWLAFRILNVIVVNTVRELRAEIEQKVHRLPLRYYDTTPRGDLLSRVTNDLDNLSQGLQQTISQFVNSVLTVIALLVVMIWISPLLALIAVVTVPL-AVAATTIIARRSKPHFISQWSSTGKLNSQIEEAFTGHELVKVFGRQREIEQTFDERNEKLYQSSWRAQFISGMVMPTIMFLGNLNYVAVAVVGGLRVASGSLSLGEVQAFIQYSRQFTQPLTQIGSMINLMQSSVASAERIFEILDAQEQTPDPAQPSPSEDKGRIEFDDVAFRYL-PDKPLIEDLSLVASPGHMVAIVGPTGAGKTTLVNLIMRFYDVDSGQIRLDGVETRAMTRDDLRERTGMVLQDSWLFGGTIYDNIAYGDPTASREEVMAAAMTSHVDHFILPDGYDTVLDDEGGGVSAGERQLITIARAFLARPTILILDEATSSVDTRTELLIQQAMANLRADRTSFVIAHRLSTIRDADTIIVMEDGHIVEQGNHDELLAAQGAYCRLYR.. 636
182 0.000e+00gi|325261692|ref|ZP_08128430.1| ABC transporter, permease/ATP-binding protein [Clostridium sp. D5]  clstr ali  23  8..TVKKILCFIKPYLHYLALSLVFAVISVALTLYAPILTGNAIDDII--GTGQVDFDSIFYILKILAVVIFITSAAQWLMNLCNNTITYRVVKDVRTRAFAQLEILPLRYIDSHQYGETISRIITDVEQFSDGLLMGFTQLFTGIVTIVGTLIFMLSINVKISLVVVLITPLSLFVASFI-AKRTYTMFRAQSEARAKMTSLVDEMVGNQKVVQAFGYGERALDRFDEINGRLQEVSLKAIFFSSITNPSTRFVNGLVYAGVGIVGAFTAISGAISVGQLSCFLSYANQYTKPFNEISSVVTELQNAFACAKRVFDFIEETPEIPDPDAAAMGQADGSLKLEDVSFSY-KKEVTLLEHLKLEVKPGQKIAIVGPTGCGKTTLINLLMRFYDVDAGQIILSGHDIREVTRDSLRANYGMVLQETWLKSGTVEENIAYGRPDTPREDIIAAAKAAHAHGFIMKDGYDTFIQEEGGNLSQGQKQLLCIARVMLNLPPMLILDEATSSIDTRTEIKIQEAFQKMMEGRTSFIVAHRLSTIREADVILVMKDGNIIEQGNHEELLRVGGFYKNLYE.. 575
183 0.000e+00gi|259046562|ref|ZP_05736963.1| ABC superfamily ATP binding cassette transporter, permease/ABC protein [Granulicatella adiacens ATCC 49175]  clstr ali  19  6...LKRFLGYLKPYRFVVIMVLIVSFISVVLDVQLPKILGNATTLIIESNYTSVDIAGVFEIGKLLAILYVLAAGLNFLGKYFMSRVSSDIIYRLQKEIDEKFTRLPVRYFDEQSRGDLLSRATNDIQTIDDSFSQVSVQFFTTVLTFIGIIIMMFTISIPLAIVGILGIPLSMFAIGMI-GKKSAASFASRQETTGTINGYIEEYYAGHDIVNAFNYEDRSEKAFSQLNDELYEHSWKATFFAGLMQPISRLINNVVYVFVAIIGGFLATGGMITIGGIQAILQYMQNISQPMGEAANMMGLTQSMLAAAERIFELLDAEEMEEETGKPALPEVHGDVTFKHVSFGY-TPEVQLMKDLNIDVKAGETVAIVGPTGAGKTTVINLLMRFYDITGGAIEIDGHNIQDYTKESLRSKVGMVLQDTWLFKGTIRENIRYSRQDATDEEVVAAAKQAFADDFILPKGYDTVITEESDNISQGQKQLLTIARAILASPSVFILDEATSNVDTRTEVEIQKAMDHIMTNKTSFVIAHRLSTIRNANKILVMQKGNVVEQGSHDELIAQNGFYAGLYRA. 578
184 0.000e+00gi|154484678|ref|ZP_02027126.1| hypothetical protein EUBVEN_02395 [Eubacterium ventriosum ATCC 27560]  clstr ali  23  9.QALMELLKRIKKYWHLLIGSLLFALVYVVLSLYVPKLIGLGTDKIVSKG--NVDFQGLERXXXXXXXXXXXXGIAQWIMGLLNNRITYHVIKDIRQESFERIQKLPLAYLDTHSTGSLVSSIIADVDQLADGLLMGFSNLFTGVVTIVLTIVFMLQINWKIALVVICITPVSFFVAGFI-AKRTYSMFRKQSEIRGSQTAFIDEMISGQKVVKAFGQEEKAVQDFDEINDELAKYYLKGTFFSSITNPSTRFVNNIVYAGVAISGGLAIMTGGITVGGLATILSYANQYTKPFNEISGVVTELQNAIACGAKIFSLINQEKEIDEESENQLQNIEGKVDINDVDFSYV-PDRKLIENLNLHVKPGQRIAIVGPTGCGKTTIINLLMRFYDVDKGSITIDGKDIRDISRKNLRSSYGMVLQETWLRNTTVRENIAFGKPDATDEEIENAAKASYAHNFILPNGYDTVIGEDGGSLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEVKIQDAFSKMMEGRTTFIVAHRLSTIKEADVILVMKDGKIIEQGNHEELLEKRGFYYKLYN.. 579
185 0.000e+00gi|126698602|ref|YP_001087499.1| unnamed protein product [Clostridium difficile 630]  clstr ali  19  34.....RLLKYMAKQKFKILIIFISVLISSALTVLAPMVMGKAIDQLFTGTKFSVNFSTMGGIVSILLGLYLISAVFIYIQQYIMSGVAQNLVLSMRKDLSDKLNKLPLKYYDSHKKGETLSIVTNDLEKVADSLQEGLMQLITAVVTVVGSIVMMISISVPLTIVSAITL-LVSLGITVVIARKSQERFSENQKALGELNSNIEEIFTGQIVVKAFSKEKDTIRNFKILNQNLYNASRKAQFSSYAISPIIRFINLIGYVIIAVVGGIFASTGAMTLGSIQAFIQYVNQASEPTTEISYIVNMLQAAIASAERVFTVMDEVEEIKDEESKVISMPKGKVQFEHVKFGY-SDDFILMKDININLNAGDKIAIVGPTGAGKTTLVNLLMRFYEIQGGRITIDGVNIKDLKRGELRTMFGMVLQDTWLFNGSIKENIAYSKSDATMDEIVRAAKSARVDHFILPQGYDTILTEDSSNLSQGQKQLLTIARAILSDPSVLILDEATSSVDTRTEVEIQKAMNNLMKGRTSFVIAHRLSTIRDADLILVMKEGTIIEQGSHKELIEKKGFYEELYN.. 608
186 0.000e+00gi|329769357|ref|ZP_08260773.1| hypothetical protein HMPREF0433_00537 [Gemella sanguinis M325]  clstr ali  22  2...LKEFFSYYKPYKKLFSIDFGCAILSGVLELLFPVAVNKVIDTVLPTG----NFKTIILVCSLLFALYLFSMTLNYIVVYLGHTLGINIETDMRRKLFAHLQKHSFEYYDEKKTGELMSRLTTDLFDISEVAHHGPEDVFITVMSICGAFVLMWNVHEQLAIGTIILIPILAIGLS-IFNKKMKNVNRKIYSQLGEFNAGLENSLSGIRVVKAFANEEFEKKIFEGMIQNYRKNKLAFYKTMATSSSFNYVLMRLITLTSLVFGAYFTIKGELTTGELVGFVLLANTFVKPIERINTMVEMYPKGFAGFKRFNEELARKPAIVDPNAKAAPHFNGNIHYDNVSFEYGD-GRPVLENINLEIKAGEMVAFVGPSGAGKTTLINLLPRFYDTTKGSISIDGVNIKDYTLSSLRGQIGTVQQDVFLFNGTIRENVLYGKLDTSDEEVERAIEAAKLKEVIFPEGLETPIGERGVKLSGGQKQRLSIARIFLKNPSILILDEATSALDTQTEQFIQNSFDELSKGRTTLVIAHRLATIKNVDRIIVVTPDGIVEQGTHKELLEKNGHYAELYYA. 567
187 0.000e+00gi|54022228|ref|YP_116470.1| ABC transporter [Nocardia farcinica IFM 10152]  clstr ali  21  21..SLKRLLGRLAPERFYVWCIVVLAIVSVVLNTLGPYLLGKATNIVFDGPGVGVDFTAVGRXXXXXXXXXXXXXXFSWLQAYLLNIVINRTVKRLRSDIEDKIHRLPLRYFDSQPRGDVLSRVTNDVDNVSQSLQQTMSQLLMSVFSVLGILIMMFWISPLLAVIALLTVPAAIVVTAQI-AKRSKPHFVNQWKYTGLVNAQVEEAYTGHEVITAFGRNREVGEEFDQRNDKLYESSFKAQFISGLIMPSIMFLGNVNFVLVALVGGLRVATGQLSLGEVQAFIQYSRQFSQPLTQIGTMVNLLQSGVASAERIFEILDAEEQSPDPQLPDVRPLRGRVEFEAVSFRY-EPDKPVIERLSLVAEPGHVVAIVGPTGAGKTTLVNLLMRFYELDAGTITIDGVDITRMSRDALRSRIGMVLQDTWLFRGTIRENIAYGNPNASEEEILAAARAAYVDRFVLPDGYDTMIDEEGSGVSAGEKQLITIARAFLAKPSILILDEATSSVDTRTELLVQQATAALRRDRTSFVIAHRLSTIRDADLIVVMEAGRIVEHGTHQRLLEERGAYYRLYN.. 629
188 0.000e+00gi|336177952|ref|YP_004583327.1| unnamed protein product [Frankia symbiont of Datisca glomerata]  clstr ali  23  48....RRLLGLLRPQRHLFVAVIALATVSVGLTVLGPRLLGHATDLVFAGPGQGMDFGAIGTVLLWVLAVYVLAGVCGVAQARLTNLALQRVIGTLRADVQAKISRLPLRYFDRQPRGEVLSRVTNDIDNLQQSLQQSLSQIIASVLTIVGVLAMMIWISWELALIAVVAVPLSVIVATRI-GKLAQPQFVTQWKVTGRLNAHIEEMYTGHALVRAFGRQQESAQTFRDLNEQLYAASWRAQFISGLMQPAMMFIGNLNYVLVAVVGGLRVASGSLSIGEVQAFVQYSRQFSQPLSQVASMANMVQSGVASAERVFDLLDTPEQTPDPAIPAPGRLRGRIAFEHVAFRY-EPDKPLIEDLSLTAEPGHTVAIVGPTGAGKTTLINLLMRFYEVTGGRITLDGVDIATMSREELRASIGMVLQDTWLFGGTIAENIAYGAEGATREQIVAAATAAHVDRFVLPDGYDTVLDDEGTGVSGGERQLITIARAFLAEPLILVLDEATSSVDTRTEVLIQRAMSTLRAGRTAFVIAHRLSTIRDADTILVMDNGAIVEQGDHTSLLAAGGAYARLYQA. 653
189 0.000e+00gi|332670236|ref|YP_004453244.1| ABC transporter-like protein [Cellulomonas fimi ATCC 484]  clstr ali  22  56....RRFLRELRPERVPLVAVLVLGVLSVVLAVIGPKLLGNATNVIFDGPGVGIDFERLRDILLVVVLIYAGSFLFGWLQGRITAGVVQRTVYRLRERVESKLSRLPLSYVDSQPRGELLSRVTNDIDNVAQSLQQTLSALITSVLTVVGVLVMMFWISPLLAVVALVTVPLSVVVAGAI-AKRSRPQFIEQWAWTGKLNAHIEEMFTGHALVTVFGRQHEAAQTFEERNEALYQASFKAQFISGIIQPALGFLANLNYLVVAVVGGLRVASGAMSLGDVQAFIQYSRQFTQPITQIASMANLLQSGVASAERVFELLDAPEQSPDPPATTLDPVRGRVTFEHVAFRY-DPATPLIEDLSLVAEPGATIAIVGPTGAGKTTLVNLLMRFYDVPSGRITLDGVDTRELTRDELRSQMGMVLQDTWLFGGTLAENIAYGVDGATHEQIVAAAQATHVDRFVLPDGYGTVVDDEGANVSAGEKQLLTIARAFLADPPILVLDEATSSVDTRTEVLVQQAMNALRAGRTSFVIAHRLSTIRDADTILVMEHGSIVEQGSHDELLAAGGAYARLYE.. 661
190 0.000e+00METAHIT MH0063 GL0107179 [Complete] locus=scaffold3845_2:45468:47201:-  ali  23  4.KTTARVLSLIKPYSLSVAASILLALISTAAQLLIPVFCGNAIDAMIDKGK--VDFETVLKTIIMVAVTAALGAIAQKFLANCNNNIAFSVCRDLRDKISKKINKLPLAYLDTHPSGDTVSRMIADVDTFSDGLLMGFTQLFTGVITILSTLGIMLYLNWKIAIAVFVLTPLSFFVAKFIASR-TNRFFKEQAIARGEQTALTNELVEGQSVVKAFGHEDESLKDFDEVNEKLGKAAMNATFFSSLTNPSTRLINNIVYAVVTLISALYAVSGHISVGQLSVFLSYASQYAKPFNEISGVITELQNAFTCAGRVFELLDESDEIPESRDPKSPEPKGNVEIKNVSFSYV-PSRPLIENLSLSVKSGQRIAIVGPTGCGKTTLINLLMRFYDVNQGSIEVDGVDIRDMTRKDLRTRYGMVLQDTWLSSGTVRDNIAFGKPDATYEEIEVAAKAAHAHSFILPDGYDTVIKENGSNLSAGQRQLLCIARAMLSLPQMLILDEATSSIDTRTEMKIQSAFSKMMAGRTSFIVAHRLSTIKEADVILVMKDGHVIERGNHSSLIEQNGFYAKLY... 570
191 0.000e+00gi|149182565|ref|ZP_01861036.1| YwjA [Bacillus sp. SG-1]  clstr ali  21  1................................LGFPLAVSWFIDELLPEGNWGR----ITAVSAGLLTLYVMSSGMQFVVNYWGHKLGINIETDMRRELFNHVQRQSFRFFDNTKTGHIMSRITNDLMDIGELAHHGPEDFFIAIMTFIGAFWIMLTINVKLALVAIIIVPFLVWLIS-YSNIKMNAAWTKMYGNIADVNARVEDSVSGARVVQSFTNEEYEKERFNKNNLFFRKTKLQAYKVMSWNLSGIYITTRVMTLVILVYGAWLSFTGELSYGELVAFILYLNALFKPIDKISALLELYPKGMAGFRRFSELMDAEPDIENPDAIEAPALRGDIRFTNVSFGYEN-NRTILNDMSFSIKAGSTVAFVGPSGAGKTTICSLIPRFYDVEAGAITIDGMDIRDMTKESLRANIGIVQQDVFLFTGTLRENIAYGRLGASQGDIEEAVRKAHLTDLILPDGYDTQIGERGLKLSGGQKQRLAIARMFLKDPSILILDEATSALDTETEAIIQEALNDLSKDRTTLIIAHRLATIKKADRIMVITEEGIAEDGSHAELLSQNGLFAKLH... 536
192 0.000e+00gi|159897213|ref|YP_001543460.1| ABC transporter-like protein [Herpetosiphon aurantiacus DSM 785]  clstr ali  24  17...LRRMFQYVYPYRWRLSLALLCLAISSGIGLVMPLAIRNLVETV----KDASSTAALDKVAIGLMGVFIAQMVFNYIQGYFLTYVGERAVADLRIEVYSHLQRLSLAFFSERRVGELTSRVTNDVTVIQGIGTNAVAAFLQNGITFIGSFIMMINLSWQLTAITLLLI-PLLIVLAIIYGRRIRNMSTEVQDRMAEASSVLEETISGVRIVQSFAREPYEVERFSGAIEHAFSASMRRTKTRAQFVPIVSFSGFGALVFVLWFGGRQVLNGTMQLGDLIAFLLYAAVIAGSLGTFTSLYSQLQEALGSTARVFGILDTAPEIASKNAINLPPIEGEIYLEDVSFNYGEAATPVLSNINLKVEPGEVMAIVGPSGSGKSTLVNLIPRFYDVTAGRITVDGFDIRDVDLPSLRSQIGIVPQETLLFSGTIADNIRYGNLDAPMEAVIEAAKAANAHEFIFEGGYESIVGERGIKLSGGQRQRVAIARALLKNPRILILDEATSAMDSESEGLVQEALERLMQGRTTFVIAHRLSTVKNATRIAVIEAGKVTELGSHSELLAQAGTYARLYQ.. 582
193 0.000e+00gi|227513050|ref|ZP_03943099.1| possible xenobiotic ABC superfamily ATP binding cassette transporter, ABC protein [Lactobacillus buchneri ATCC 11577]  clstr ali  20  1.......................MAIGGVIMDIVSPKVLGSATTVVFDGVIAGIDFKKIVSILMIVVVLYVLSGIFQLVQQVVMTRISQSIVYQMRKDLKAKITRLPVSFYDGHSKGDILSRAVNDMDNINTMLQSSLTQLITSFFMFFGVLFMMLTISWKLTLVALLTLPLSILVVSFFAPK-SQTFFRAQQHELGVLNGQVEESYNGHNVIKTFNREEDAIKEFKEKNGRYFQASWKAQFVSSFMFPMMNLIKNLDYVFVAVIGGIQVTQGAVTLGNVQAFLQYTNMFSQPITRLANLTNTIQSTIASAERIFEIFDEPEMDFEPGHPIVKSDKNEVTFDKVDFSYV-PDQSLIQSFNLNVVPGQKIAIVGPTGAGKSTIINLLERFYEVNDGAIRMKGEDIRNKPRSEIRKRMAMVLQESWIFNGTIFDNIKYGRFSATKDEVIEAAKAAHADLFILPDGYDTILNEDATNISQGQRQLLTIARVFLADPEIIILDEATSSVDTRTEKLIQAAMDKLAEQRTSFVVAHRLSTIRNADKIVVMNQGQIVETGNHEQLMAKNGFYANLYNA. 564
194 0.000e+00gi|339442016|ref|YP_004708021.1| hypothetical protein CXIVA_09520 [Clostridium sp. SY8519]  clstr ali  21  1MQTFRKFIQFYRPYKGVFIFDLICAAFISLVDLAYPQVLRTLTNTLFT-RDPDRILHALPGIALVLLAAYILQALCKYYVSCQGHIMGAKMERDMRKKLFDQYEALSFSYYDRNNTGQMMSRLVSDLFDISEMAHHGPENLFISLVKIAGSFVFLFLIQKKMTLVSAA------------QNRRMQATFLDNRRKIGSINATLQDSLSGIRIVQAFGNEKIEQAKFRRGNEAFLDSKRDNYRAMGTFQAGSLFFQGIMYLLVIAAGGYFVAKRQMSAGDLAMYSLYIGIFISPIQILVELTEMLQKGMSGFRRYLDVMETRREITDPDAVPIADAHGDIVFQDVSFAY-EAEEPVLIHLSFTVKSGESLALVGPSGGGKTTICSLIPRFYDVTGGTIRIGGQDIRKIRLESLRQSIGIVQQEVYMFSGTIRDNIAYGRPDASMEDIVEAAKKANVHEFVLPDGYDTFVGERGTRLSGGQKQRISIARIFLKNPPILILDEATSALDNESERYIQKSLDALAENRTTITIAHRLSTIRSADEILVIEGQGIAERGTHEELMEKNGIYARYYN.. 571
195 0.000e+00gi|86739095|ref|YP_479495.1| ABC transporter [Frankia sp. CcI3]  clstr ali  23  39....RRLLGLLRPQRHLLIAVVVLATLSVGLSVIGPRLLGHATDLVFAGPGHGMDFDAIXXXXXXXXXXYAVSGLCGVLQARLANLALQRVISDLRRDVQAKISRLPVRYFDGQPRGEVLSRVTNDIDNFGQSLQQSMSQIVASTLTIVGVLSMMLWISWILALIALVTVPVSIMMATRV-GKLAQPQFVAQWRITGGLNAHIEEMYTGHTLVRAFGRQEESAEIFREQNERLYAASWRAQFISGLMQPSMLFIGNLNYVLVAVIGGLRVASGSLSIGDVQAFIQYSRQFSQPLSQVASMANLVQSGVASAERVFDLLDTVEQEPDRAVPAPERLRGRVAFERVSFRY-EPNKPLIEDLSLVAEPGHTVAIVGPTGAGKTTLINLLMRFYEVTGGRITLDGVDVAAMSRDELRASIGMVLQDTWLFGGTIAENIAYGAEGATHEQIVAAARAAHVDRFVLPAGYDTVLDDEGVGVSGGEKQLITIARAFLVEPLILVLDEATSSVDTRTEVLIQRAMSTLRAGRTAFVIAHRLSTIRDADTILVMENGAIVEQGTHTELLAADGPYSRLYQ.. 643
196 0.000e+00METAHIT MH0012 GL0008663 [Complete] locus=scaffold41277_3:1845:3551:-  ali  22  1...MKKLLKLIGKYKIFLAFSVIFAAISVVLQLYVPVLFGDAIDEVVSAHQ--VNFDMMWYYLKQILIFIVISAFATWFMNLLNNRMTYRIVQDIRSQAIRHIQVLPLSYLDQHSTGDIVSRVIADTDILSDGLLLGFTQLFSGIVTIVVTLIFMFSKNVWVTLLVIVLTPFS-FVVAKFISSRSYTMFRKQSETRGRQTALIEEMIGGQKVVKAFGYEKESSRRFDEINKELQNYSQKAVFYSSLTNPSTRFVNNIIYAGVALLGAFLIPGGTLTVGGLSVLLAYANQYMKPFNDISSVVTEMQNALACADRIFDLLEQKEETLDAEGA-FAKVDGNVTIDDVAFSY-DKEKELIENFNLDVKPGMRIAIVGPTGCGKTTFINLLMRFYDVDEGKILVDGKDIREVSRHALRSSFGMVLQDTWIKSGTVRDNICFGKPDATDEEIIRAAKEARSWEFILPKGLDTVLHED--SISQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTELQVQEAFDKLMKGRTSFIVAHRLSTIRNASLILVMKDGKIIEQGNHEELLKKGGFYHKLYH.. 563
197 0.000e+00gi|377562339|ref|ZP_09791744.1| putative ABC transporter permease/ATP-binding protein [Gordonia otitidis NBRC 100426]  clstr ali  21  35..SIKRLIGLLFSYRTFMSVVVASIVGSVILTALAPRVLGDATNIIFDGPGVGIDFGDVGRVLLIVLALYVGSAVLSWLGAYLLNKVVVGTVRHLRGEVEAKIHRLPLSYYDTTARGDLLSRVTNDLDNLSQTLQQTISQLLNSILMVIAILVMMLWISPLLALIALITVPLAAGATALI-ARRSKPHFLAQWSSTGKLNAQVEEAFTGHELVTAFNRQADVEAEFDERNEKLYQSSWRAQFISSTVMPTIMFLGNLNYVAVAVVGGLRVASGALSLGEVQAFIQYSRQFTQPLTQIGSMVNLLQSGVASAERIFDILDADEQTPDPAHPEPEHDNGLIEFDDVSFRYVE-DKPLIEHLSLVARPGHMVAIVGPTGAGKTTLVNLIMRFYDVDSGTITVDGVESRKMTRDDLRERTGMVLQDSWLFGGTIYDNIAYGDPTASREEVLEAARLSHVDHFILPDGYETMLDDEGGGVSAGERQLITIARAFLARPTILILDEATSSVDTRTELLIQKAMAALRTDRTSFVIAHRLSTIRDADVIVVMEDGHIVEQGNHDELLAAQGAYCRLYR.. 641
198 0.000e+00gi|269795466|ref|YP_003314921.1| multidrug ABC transporter ATPase/permease [Sanguibacter keddieii DSM 10542]  clstr ali  21  55..SLKRFAGYLRIERMRXXXXXXXXXXXXXXSVLGPKLLGNATNIIFEGPGQGLDTTALRNVLFGVIAVYVGSFLFGWLQGRFTAVVVQNTVLRLRAEVESKINRLPLGYFDKQQRGEVLSRVTNDIDNVAQTLQQTLSQLVTSLLTIIGVLAMMFWISPLLAVVALITVPLSVLVTAMI-AKRSQPQFIKQWAATGTINAHIEEMYSGHALVKVFGHQQSAIDTFEQENAGLYESSFKAQFISGIIQPAMGFIANLNYVIVAVVGGLRVASGTMTLGDVQAFIQYSRQFTQPITQVASMMNLLQSGVASVERVFDLLDADEQTPDPAEPRVETVQGRVAFEHVKFSY-SPDVPLITDLSIVAEPGQTVAIVGPTGAGKTTLVNLIMRFYEVDGGRITLDGVDTSTMTRDALRSSIGMVLQDTWLFKGTIADNIRYGATGVSEERLLEAATATHVDSFVLPDGYETVLDDEGGSVSAGEKQLLTIARAFLADPPILILDEATSSVDTRTEVLVQKAMNALRQGRTSFVIAHRLSTIRDADVILVMEDGDIVEQGSHDELLASGGAYARLYQ.. 662
199 0.000e+00gi|229820798|ref|YP_002882324.1| ABC transporter [Beutenbergia cavernae DSM 12333]  clstr ali  21  63..TLSRLLGDLRDHRVALVGIIVLGVLSVALAVIGPKLLGNATNIVFAGPGAGVDFRALAIILAWVLVVYLGSFLFGWLQARITAIVVQTSMYRLRQRVEAKLGRVPLKYFDGQPRGEVLSRVTNDIDNIAQTMSQTLAQLITSVLTVIGVLVMMFVISPLLALIALVTVPLSALVTALI-AKRSQPQFIRQWRTTGELNGHIEEMYTGHALVKVFGQQPAAQRTFDDKNGELYDASFKAQFISGTIQPAMGFIANLNYVIVAVIGGLRVASGTMTLGDVQAFIQYSRQFTQPITQIAAMMNMLQSGAASAERVYALLDAEEQTPDPAAPELERVSGRVAFEDVSFSY-SPDAPLIEDLSLVAEPGQTVAIVGPTGAGKTTLVNLIMRFYDVDAGRITLDGVDTREMTRDDLRRSVGMVLQDTWLFEGTIAQNIVY-PIEATRARMMRAAEATHVDAFVLPDGFDTVVTEEGGSLSAGERQLLTIARAFVADPPILILDEATSSVDTRTEVLVQKAMNALRVGRTSFVIAHRLSTITGADVIVVMEHGRIVEQGSHAELLERDGAYRRLYQ.. 678
200 0.000e+00gi|336427857|ref|ZP_08607848.1| hypothetical protein HMPREF0994_03854 [Lachnospiraceae bacterium 3_1_57FAA_CT1]  clstr ali  21  14..TFVKVLRYLKPYWFYLGLSLVFAAVSVALTLYVPKLTGRAIDHIIAPGK--VDFPAVLAILKQIAVAIVFTGLAQWIMNICNNKMTYHIVRDIRNEAFRKIEILPLKYIDSHSYGEIVSRVIADVDQFADGLLMGFTQLFTGVMTIVGTILFMLATNVGITFVVVLITPLSFFVAAFI-AKRTFTMFRLQSETRGEQTSLIDEMIGNQRVVQAFSHEEKAMEQFDEINDRLEKCSLKAIFYSSITNPATRFVNNVVYTGVGLVGALTAVAGRISVGDLSCLLSYANQYTKPFNEISGVVTELQNALACAGRIFDLIEEEPQVPEKENAVANAFQGKINLSHVYFSY-APEQRLIEDFNLAVKPGQRVAIVGSTGCGKTTMINLLMRFYDVDSGEIRIDGTDIRDMTRKSLRTGFGMVLQDTWLKAGTIRENIVMGKPDATEEEIVAAAKASHAHSFILSDGYDTVISEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEMKIQEAFARLMEGRTSFIVAHRLSTIREADVILVMKDGKVIEQGRHEELLKAEGFYAQLYN.. 582
201 0.000e+00METAHIT MH0009 GL0093718 [Complete] locus=scaffold16597_2:1996:3711:+  ali  22  2...LKKFAGYYKPHMKLFILDMVCAFTVSVLNLAYPKIAGKIIEV--------KQLDYVLTFSAVLLGIFLLKAALNYLIVYWGHVVGVRIQGDMRAELFAHLQKLPFAYYDETKVGSIMSRLVNDLFEVSELAHHGPEDVFLSVLSIIGALIMICFINPWLSLILLAIIPIMVFVASRLRMNLIR-AFSASREKTSEINAAVESSISGIRVAKAYTAERHEKEKFVAANEGLKAARSMQYKAMSRFNTAMSLSMDILYLVAFAAGGLFFVKDLISSADLTSYVLYVAMLVTPIRTFVTIFEQIEEGMTGFKRFMEVMSVAPEKETKTPVKVDRLKGDIVFDNVSFRYDDEKSLILNDLSLEIKAGSTIALVGPSGGGKTTLCNLIPRFYDIDSGRITVDGIDINDMSLYDLRRNIGSVAQDVFIFSGTVRENIAYGNFDATDEQIENAAKLANIHDFILDNGYDTYVGERGVKLSGGQKQRVAIARAFLKNPPILILDEATSALDNVTEMQIQQALERLSAGRTTIVVAHRLSTVKNADEIIVFGDGGIEERGTHDELIAKHGIYAELYE.. 566
202 0.000e+00METAHIT MH0014 GL0067771 [Complete] locus=scaffold23946_7:6116:7951:+  ali  21  32.NTLKKLIGYIGRNRYLFFALIGVMLIITLLNLAAPSIQQIAIDCILTKKKTSVDFSALGKTLIGLGAVYLLSSVFTYMQGIFSAKLSQYTVKTMRKDLFSSLVRLPIKYLDTHSHGDIMSRMTNDVENISTTISQSIGSLISGVLTIVGTVVIMLLYSPLLTLISLSTVFLTIF-VSGVLTKYMKKYFIKQQVLLGEINGEVEEMVVGYRTVVSYGKEQDAVDKFEKMSNNLKKCGIKAQIFGGVMGPCMNLISNFGFILIAAFGGWFAIKGFITVGTIQAFILYSKQFSRPINEIANQFANIQTAIAGAERIFEVMDADKETDEKADFEVENVKGDIDFKHIDFSYV-PEKQVLKDLDLEVKAGQKIAIVGATGSGKTTIVNLLTRFYPVDSGEITIDGQSIYDIPKDKLRRSIAIVLQDTVLFKDTIEENIRYGRENATLDEIKAAAKFANADEFILSEGYDTVLAEGGSNLSQGQRQLLSIARAVLADPKILILDEATSSVDTRTEMHIQSAMVALMKNRTSLIIAHRLSTIRDADKIVVIDGGRVAEQGSHEELITAKGCYYRLYQT. 604
203 0.000e+00gi|327438315|dbj|BAK14680.1| ABC-type multidrug transport system, ATPase and permease component [Solibacillus silvestris StLB046]  clstr ali  24  32..TLLRIWSYLRVQKVELISVVIFVIISTLLSLVGPFLIGKTIDDYIVK----LDVPGAIRMALILAGVYIASSVLTWLQTFVMIRVSQKTIRRLRQHLFEQYQSLPLAFYDKKQQGDLMSRMTNDIENLNAALSQSVIQIVSSFLTIVGTAFALFYLDWRLALVTLIIIPLIVYATKQII-KRSSVNYKARQRDLGNLNGYIEETISNADIITLFGQEKSTLAEFKEANERLRGSAMRADIISGFMGPINNFMNNLGLSLVIGAGAIMAVTSGLTIGVIASFVTYTRQFFRPINQLSNLLNTFQSAIAGSERVFEVLDETKEVADENAKEKEQFSGDVKFENVQFAYET-GKPVLHGINFEAKAGETVAIVGPTGSGKTTIIQLLTRFYDATGGRILLDGEPIEHYKMTNVRDHVGVVLQDTYLFSGTVRENIRFGKLHATDDEVEQAAKIAYAHNFILPEQYDTVLTSGGLNLSQGQRQLIAIARAILEDPDILILDEATSSVDTMTEVHIQKGLNNLMEGRTSFVIAHRLKTIENADQILVIKDGQILEQGNHDSLMKEQGFYATLQRQL 599
204 0.000e+00gi|84495064|ref|ZP_00994183.1| putative ABC transporter [Janibacter sp. HTCC2649]  clstr ali  22  48....KRLLGLLKPERLALYGVLAFALASVILNAIGPKILGKATDLIFAGPGAGIDFGAVGRVLLFVLAIYVVASLLQWASSFILTGAVNRTIFNLRRDVEDKLNRLPLPYFDNQPRGELLSRVTNDIDNVAQSLQQTLSQLLTSLLTVIAMVVMMLYISPLLALIALVTIPITMLVTAAI-GKRSQKHFVQQWKSTGELNGIVEETFTGHQLVKVFGRQDEVRASFKAKNDDLFDAGFGAQFISGIIMPTMMFIGNLNYVIIAVVGGLRVASGSMSLGDVQAFIQYSRQFTQPLTQVASMANLMQSGVASAERVFDVLDAPEQQAESATPVLDDPHGSVAFEDVSFSYV-PETPLIEHLDLTVEPGQMVAIVGPTGAGKTTLVNLIMRFYELDSGRITLDGVDITDLSRHNLRGEIGMVLQDTWLFGGTIRENIAYGRPDATEAEVIAAAQATYVDRFVLPDGYDTVLDAEGGNISAGEKQLITIARAFLSDPALLILDEATSSVDTRTELLVQQAMAALRQDRTSFVIAHRLSTIRDADLILVMENGRIVEQGSHADLLASGGAFAELYAA. 654
205 0.000e+00gi|126653025|ref|ZP_01725165.1| ABC transporter, ATP-binding/permease protein [Bacillus sp. B14905]  clstr ali  25  30..TLTRVWHYVKQQKIGLYFSIILVIASTFLSLAGPYMIGHIIDDYIMK----KDIDGTIRLGILLAVIFTVASILTWLQTYVMIHVAMKTIRTLRLELFQKLQTLTLRFFDQRALGDLMSRVTNDIDNLNTALAQSVTQIVSSILTVVGVSIAMFTLSWPLAIVTLIIIPLIVFTTKQIIKRSSKNYAARQRD-LGKLNGYIEEMITGAEVLTLFGKEQQSIDTFHQQNENLRNSAQRAEITSGLLGPINNFMNNLGLAIVIGTGALLAVKGLVTVGIIAAFVTYTRQFFRPLNQLSNLLNTFQSAIAGAERVFEIIDEPSEVADPQAIEAPSLKGDVVFKQVSFSY-EQGKPVLQNINFQAKAGETIALVGPTGSGKTTIINLLTRFYDVDQGEILIDGHHIEQYKMSTIRQRVGVVLQDTYLFSGTIRENIRFGKLDATDEEVVEAAKIANAHHFILPAQYDTPVQAGGANLSQGQRQLIAIARAILENADILILDEATSSVDTQTEVDIQKGLQHLMQGRTSFVIAHRLKTIENADQILVIQQGEIIEQGNHQELMEQQGMYR...... 591
206 0.000e+00gi|163848424|ref|YP_001636468.1| ABC transporter-like protein [Chloroflexus aurantiacus J-10-fl]  clstr ali  23  38.....RLLSYLRPYRGWIVVALIAMVISAGLGLVIPLAIGQVVN--LITGDQALPVVQIAQLLGIVMIGQLLTGV---IQTYCLSFVGERVVSDLRIAAYEHLQKLDLAFFEQRRTGEITSRITNDVTLIQTTVTNSLPTLLGGVIQLVGAVALMLVVSWQLSGLALILVP-TLVLIGVFFGRWLRQISTAVQDRLADATSILEETVAGVRVVRSFRREDYEITRFRAAVEATFATALKLARIRAIFQPAMSLAVWMALIGILAIGGYLVSTGVLTTGSLISFLFYAVMAAGSMGVFASLFAQLQEALGATTRVFELLDQQPLVADPDAIPLPPVEGRIEFREVSFAYGSPAPVVLRDFSLTIEAGEMVALVGPSGAGKSTIASLIPRFYDVSAGSVLIDGYDVRRVQIQSLRDQIGIVLQETQLFSGSVRDNIRYGRLEATDEEIEAAARMANAHEFILPDGYDTPVGERGVRLSGGQRQRIAIARAILKNPRILILDEATSSLDSESERLVQEALERLMAGRTSIVIAHRLSTVQRADRIAVIVAGELVEIGTHHELLARDGVYARLYER. 607
207 0.000e+00gi|313892395|ref|ZP_07825987.1| ABC transporter, ATP-binding protein [Dialister microaerophilus UPII 345-E]  clstr ali  21  7INSYKRLLTYLYPYKSKLLLSILCMLVVASSNLVVPWIIKDVIDKVLEK----RDVYMLSLVIIGVLVVFLFRGITTFGHRYLMGFIGQSVIMDLRNVLYKHLQKLSVSYYDKRRIGDIMSNLTNDIAALQTAIVDNFVVFVQESAIFIGSFAAMLYLNWKLTVLCMIMVPMVYFAIKL-FGNKLNLSGKNVQEKLADVTSILQETIQAVRIIRSFNRDKYEIERFEKVNGASFSAAIKAICQQSQLTPVVEFVAALGVVAIIWYGGISVIDGTMTTGALIAFLVYAINLANPTKRLAECYGNIQKSLAAADRVFAILDEESEVKEREAKELIITKGEVSFVHTAFSYDLKN-YVLKDLNFTVKAGETVAIVGPSGAGKTTIANLLPRFYDVTSGEILIDGIDIRDVTIDSLRNNVGLVPQDTILFNSTVKENVLYGKLDATEEEVWKAIKLANAETFVLPEGIYTKVGDRGMVLSGGQRQRIAIARAILKNPKILILDEATSALDTESEKIVQEALDNLMIGRTSFVIAHRLSTVRNADKIIVLNGGVVEEFGTHDELMQRKGLYHELY... 573
208 0.000e+00gi|81428757|ref|YP_395757.1| unnamed protein product [Lactobacillus sakei subsp. sakei 23K]  clstr ali  21  36.....RLLKYMSSRLIALVFVIVLAIVSVIFQIRTPKVLGEATTEIFKGVMKGIDFDKIQHIIMTVILMYLASAVFSFLQQFIMTRISQQTVYELRKELKDKMQRVPINYYDTHSNGDIMSRAINDMDNIASTLQQSLTQMVTSTVTFIGVLWMMLTISWQLTLIALVTIPLSLIVVGIVAPK-SQKFFAAQQKSLGLLNNQIEENFSGQVVLKTFNREQVTIDTFEEQNEKLYKAAWKAQFISGVIMPLMTFVNNLGYVFVAIIGGIRVSHGQVTLGDMQAFMQYTQQFSQPISQLANLANTIQSTIASAERVFAVLDEEDMSEEPSTPVVQDDANQLEMEHVEFGYQGKD-LLLTDYNLQVKPGQMIAIVGPTGAGKTTIINLLERFYDVSGGSIKLKGVDTRDMSREELRSHFAMVLQDTWLFTGTIWDNLKYGNESASDEAILAAAKAAHVDGFVLPEGYNTVLNEEASNISQGQRQLLTIARAFVADPDILILDEATSSVDTRTEIHIQHAMERLLQNRTSFVVAHRLSTIRDADNIIVMNHGSIMETGTHDELMVQDGFYADLYN.. 616
209 0.000e+00gi|339445271|ref|YP_004711275.1| hypothetical protein EGYY_17340 [Eggerthella sp. YY7918]  clstr ali  21  24...LARFASYYKPYTFLFVFDLVCATVLAAVDLAFPQFLNFFTKEFFLQ-SPEAILSALGWITLLFVVLYGIRTGCQYFITSWGHIMGARMEADMRADLFHQYQRLSFSYYDRNNTGEMMSKLVTDLFDISELAHHGPENLFICILKIAGSFALLFMINVPLTAIMLVAT-VIMAAYSFWRNYKKRLIFTENRRKMADINARLQDSLGGIRVVKSFGNEAVEIKKFGRTNDRFVATKESSYRFMGAFHAANSIFTGVLYTVTIVGGGYFVAQGTLAVTDLAIYALYIGIFLSPVEQLINFVETFQKGYAGFRRFMEVLAVRPDIADPDALDLGAVKGAVRYRDVHFSYDG-EHEVLRGLDLAIPAGATVALVGPSGGGKTTTCSLLPRFYDPSAGAVEIDGIDIRTLTVKSLRDAIGIVQQDVYLFGGTIRENIAYGRPDATTAEIMEAARRAHIHEFILPDGYDTFVGERGARLSGGQKQRIAIARVFLRNPCILILDEATSALDNESERAIQTSLEELSAGRTTLVIAHRLSTIRGADLIAVVEDGQVKEQGTHDELLALDGTYARYYE.. 613
210 0.000e+00gi|310829508|ref|YP_003961865.1| unnamed protein product [Eubacterium limosum KIST612]  clstr ali  21  26.KTAKRLFSKLLEQKGKLIIVLISVVFSCTFTLAAPMVIGQAINQIFDSVRHAINLGAMGQILGLLLGLYVLSAAFNYLQQYLMASVSQRLTLTLRESLSAKLARMPLKYFDNHKKGDILSRTTNDLEKVADTLQEGLMQFIITVVTIIGAVILMLSISPLLTLIAFVMI-IIGMVITALVARRSQHCFARNQKTLGELNGHIEEFFTGQVVIKAFNREDASTQTVEEVNERLYTASRNAQFITFAVNPLIRLMNQIGYVLIAVLGAFFVIQGRLSLGVIQAFFQYVNQASEPITEAAYIFNSMQAAIASAERVFEVLDEEDEVPDSPAKSLTDPKGDVRFEHVRFGY-SSNRLLMKDISIDVKAGEKIAIVGPTGAGKTTLINLLMRFYELDGGRILIDGIDIRDLRRGDLRSQFGMVLQDTWLFGGTLEDNIAYGRGAATKEEIVSAAKAARADHFILPNGYQTILNDEASNISQGQKQLLTIARAILADPAILILDEATSSVDTRTELEIQKAMDHLMKGRTSFVIAHRLSTIIDADHILVMKNGTIVEQGTHQGLLTQNGFYADLYN.. 604
211 0.000e+00gi|253578179|ref|ZP_04855451.1| ABC transporter [Ruminococcus sp. 5_1_39B_FAA]  clstr ali  22  17..TFFKVLRFIGRYRFLLIFSIILAAVSVILQLYVPILFGNAIDQVIAQHQ--VNFEMMWYYLSRILVMVILSSAATWLMNVINNRMTYQTVKDIRAKAIRHIQVLPLSYLDGHSTGDIISRIIADTDILSDGMLLGFTQLFSGIVTIIGTLIFMFSKNFWITLMVIVLTPVSFLVAKFISSHTFQ-MFRKQSDTRGRQTALIEEMIGNQKVVQAFGYEEKSSERFAKVNKELQECSLKAVFYSSLTNPSTRFVNNVIYACVALVGAFIIPGGRLTVGGLSVLLSYANQYMKPFNDISSVVTELQNALACAGRIFNLLEEEPEVAEV-SETLKDVKGEVDIKNVCFHY-DESKKLIEDFNLHVKPGMRVAIVGPTGCGKSTFINLLMRFYDVNSGSISVDGKPIRDITRHSLRSSYGMVLQETWIKNGTVRDNISIGKPEATDTEIIEAAKLTHSWEFILPKGLDTMLNED--SLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTELQIQEAFERMMEGRTSFIVAHRLSTIRNADLILVMKDGSIIEQGTHDELIAKGGFYHTLYN.. 580
212 0.000e+00gi|333377141|ref|ZP_08468877.1| hypothetical protein HMPREF9456_00472 [Dysgonomonas mossii DSM 22836]  clstr ali  22  18.KTFFRLMAYLAKDKNLLIVIGSLIIISIGCNLVGSYMIRPIINNYIIPG----NYEGLLHILIILGVIYLIGVAAIYIQYRLLNRIGQRAVTRMRTDLFKKMEKLPIKYFDTHQHGDIMSRYTNDIDQVSNALTDSLSDMLTSALMLIGIFSLMIYISPILTLATLITIPLMFLSAKTIV-KRSKKYFKAQQDTLGDANGYIEEMISGQKVIKVFGYEKKVEQDFKQLNQKLNEKSKKAQFYSGMMMPVMQNLNTLNFVVVTIVGGLLAIFRGFDVGGLAAFLQYSRQFGRPINELASLYNSIQAAMAGAERIFQVIDEAPEQEDPNAISLNDVKGDLEMKDVYFGY-KQDKLILKGVSLHATPGTKIALVGETGAGKTTILNMLPRFFDIKSGEITIDGISIHDIKRESLRQSMAIVLQDTHLFTGTVCENIRFGHPEATDEDVIQAAKLTAAHSFILPKGYHTMLENDGANLSQGQRQLLNIARAAIADPPILLLDEATSNIDTRSELLIQKGLDKLMEGRTSIIIAHRLSTVRNADKILVLDDGQIIEQGTHTELLNLKGKYYSLYQ.. 584
213 0.000e+00METAHIT unmapped GL0271689 unmapped_[Complete]_[mRNA]_locus=scaffold264394_1:8729:10531:-  ali  20  13......FFSYFKPHRTLFAIDMFCAIAVAAIDLIFPFVSKKSMELYLPNH----LFKTFFIVMGIIIAAYVLRSVFYYIITVFGHKMGVLVEADMREEVFSHMQELSFSFYDNNRTGVLMSRITTDLFDITELAHHGPENVVISVLTLAGSLSVLMTVNWKLALVLAIVIPIFIF-FTQRQRTNMLKANLEVKKKTAEINASIESSISGIRTAKAFVNESTEESKFKKSNDMFKTAKADYYKAMGVFHGGMEFTMGIMQVIVITFGGYLIMRGEMNYIDLLTFTLYVSTFLSAVRTLATFMEMFMQGSAGFSRFLEIMRTEPDIKDPDAVDAGVLRGDIVYNNVSFNY-DDGTCVLKNINLSIKAGESFALVGPSGGGKTTMCHLLPRFYDVTAGAITIDGTDIRKYTQDSLRRNIGIIQQDVFIFAGTIRENIRYGRPDATDEEVARAAVLAEIHKEIMPDGYDTYVGERGIMLSGGQKQRLSIARVFLKNPPILILDEATSALDSVTEQKIQSSLEALSEGRTSIIIAHRLSTIRNADRIAVIDDERIVESGSHEELMAKGGRYADL.... 572
214 0.000e+00METAHIT MH0039 GL0050282 [Complete] locus=scaffold4078_7:118:1854:+  ali  22  6..TIIKVLKHIKGYRKFLTASIILALVTVALTLYIPILVGGAIDCIADEGR--VDFQKILPVLIEIGIAAGITALSQWIMNMCNNKMTYHIARDIRNEAIEKIEKLPLNYLDTHSSGDTVSRVIADVDQFTDGLLMSFTQLFTGVITILGTLGFMFSVNCIIALVVVVVTPLSLFVAKFIATK-TYKLFKNQSEIRGEQTAFIEEMIENQKVVQAYTHEDENEEVFDEVNQRLCESSVKAIFFSSISNPTTRFVNNLVYAGVALTGALMAITGNITVGSLTCFLSYATQYTKPFNEISEVVTELQNALACADRVFELIEEPEEVHEKNAVVLKDVKGNIQLDNVCFSYI-PEKKLIENLCLNVKSGQRIAIVGPTGCGKTTLINLLMRFYDTVSGEIYVDGNEIKDVTRKSLRQGYGMVLQETWLKAGTIKENINIGKPDATDEEIIEAAKKTHAHSFILPQGYNTVIGEDGAGLSQGQKQLLCITRIMLCLPPMLILDEATSSIDTRTELKIQEAFNKLMEGRTSFIVAHRLSTVRNADILLVMKDGHIIEQGTHNELVKKGGFYSKLYYA. 574
215 0.000e+00gi|225376516|ref|ZP_03753737.1| hypothetical protein ROSEINA2194_02158 [Roseburia inulinivorans DSM 16841]  clstr ali  23  11.STIKKVMNYIRRYWGYLGMSIVLAAVTVALTLYLPVLTGRAVDLILEKGV--VDFAGILAILKKMAVIILLTAAAQWIMNACNNKITYNIIRDIRKEAFEKIERLPLKYIDGHSCGEIVSRVIADVDQFADGLLMGFTQFFTGIVTILGTLIFMLTISVKITVAVVVITPVSLLVASFI-AKKTFSMFKLQSETRGEQTAFIEEMIGNQKVVQAFSHEDEALEKFDEINGRLQKCSLRAIFFSSITNPATRFVNSLVYAVVGVVGAFTAIAGGISVGQLSALLSYANQYTKPFNEISGVVTELQNALACAARVFELMEEPSEVPDPDAVNLEEADGHVALEHVSFSYV-PEQKLIEDFNLSVKPGQRVAIVGPTGCGKTTLINLLMRFYDTNSGTIRVSGVPVNDMTRKSLRNNYGMVLQETWLRSGTIRDNIVMGKPDATDEEVIAAAKASHAHSFILPHGYDTVMAEDGGNLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEIKIQEAFAKMMKGRTSFIVAHRLSTIQEADIILVMKDGHIIEQGRHEELLAKKGFYANLYE.. 579
216 0.000e+00gi|359411217|ref|ZP_09203682.1| Xenobiotic-transporting ATPase [Clostridium sp. DL-VIII]  clstr ali  19  22...IRKFISFYKPYKKLFIMDLIVAFIAALCDLVYPMMTRDLVNNSI----PSRDFRIIIIFGITLIVIFLIKAACGYFMQYWGHVVGVRMQGDMRKNIFTHLQRLPNSFFDNNKTGDIMSRIINDLMDISELAHHGPEDLFISIVMLIGSFVILCTINISLTVLIFVFVPVIVW-FTLYERNKMNKAFFDTKVKTGAVNANLENSISGIKISKAFVSHKAEEEKFEKGNSKFIKAREKSYKVMAEYSSGAGFGMDFLNYIGLIGGGIFTFIGLISIGDYMAYMLFINSFITPIKKLIDFMEQFQNGITGFQRYMEIMNAKQEKDKKDAVQLKNVNGEIEFKNVVFSY--EGKKVLDDISIKIKKGQMLALVGASGGGKTTFCNLIPRFYEVEKGDILIDNKSIYDIKLDSLRESIGIVQQEVFLFTGTIRDNILFGKTDATEEEVIRAAKMANIHEFILPEGYDTYIGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNATERIIQESLEKLCAGRTTIVVAHRLSTIKNADEIIVLGNTGIVEKGTHEELMEKQGEYSKLHK.. 584
217 0.000e+00gi|225571071|ref|ZP_03780088.1| hypothetical protein CLOHYLEM_07170 [Clostridium hylemonae DSM 15053]  clstr ali  22  20.....RILTCIRPHTALVALSLLLSVITVVLTLYIPILTGHGVDQII--GKENVDFKELSAVIITILACIAVTSVCQWFMNHINNKITYRVVKDLRICAFNRLQVLPLSYVDSHSSGDLISRVITDIDQFSDGLLLGFTQLFTGVITIVGTILFMLSINPYITLVVVVLSPLS-FLIANFISKRTFAMFKKQSEARGELTGFTNEMLGGIKVVQAFGHQDEAQEQFEEINRRLSGYSMRATFFSSITNPATRFMYSVIYAGVAIAGCFAVVRGMLTVGQLSSFLSYTSQYTKPFNDITGVITEFQNSLASAARVFELIDQPSIAEDKGAVRLQNPEGHVTMEHVSFSYV-PEVPLIENLNLEAGCGQRIAIVGPTGCGKTTLINLLMRFYDVNSGIITVDGQNITDITRHSLRAAYGMVLQETWLKAASIRDNIAYGRPNASEDDIIRAAKEAHAHSFIMPDGYDTVIAEGGSNLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTMTEIRIQKAFEKMMEGRTSFVVAHRLSTIKSADMILVMDKGHIIEQGVHEELLKKGGFYARLYN.. 584
218 0.000e+00gi|16077935|ref|NP_388749.1| ABC transporter ATP-binding protein [Bacillus subtilis subsp. subtilis str. 168]  clstr ali  24  13...MKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDTTSLFTIMAIMFALFLIRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGR-LRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHL.... 582
219 0.000e+00gi|261405195|ref|YP_003241436.1| ABC transporter-like protein [Paenibacillus sp. Y412MC10]  clstr ali  21  41..TLSRIWTYLARRKGKLALVLLMVMFSSGLALLGPYLLGVGVDKFLDNPDSSIDSAWL-YFLVGLAVVYVLQALTTWLHNVWMIGIAQETVYRMRMDLFTHLHRLPIPFYGKRQQGEIMSRLTNDIENVSSTLNSSAIQIFSSVLTLIGTLTVMLWLSPLLTLLTFLVVPLMMMGMRWIT-RRTGPLFKERQRNLGDLNGYIEETLSGQRIIKAFSQEERVVREFDDRNQRIRLSGFWAQSISGFIPKLMNGLNNLSFAIVAGIGGILAIQGHITIGVIIIFESYARQFTRPLNDLANQWNTLLSAIAGAERVFEVLDEEVEAKDEGAAVLKSVEGAVKFDNVSFSYDKDGDT-LEGISFEAKPGEMIALVGPTGAGKTTLIQLLSRFYDPDSGSITLDGRDISSIRRESLRSQMAFVLQDSFLFQGTIRENIRFGRLDATDEEVEEAAKLANAHSFIMKDGYDKMLKPDGSGISQGQKQLLAIARAILANPSMLVLDEATSSIDTVTEIKIQEGLQRLMKGRTSFVIAHRLNTIRSADRILVLKDGRLLEQGSHDELLKQGGFYSDLYH.. 612
220 0.000e+00METAHIT MH0016 GL0047047 [Complete] locus=scaffold22536_1:17032:18759:+  ali  22  1MKNTKRLIKYISPFKSNLFGAIFSAFVGIALSLMVPILIGKGVDCITAKGD--VDFARLFKVGAVLAICIVVSALFQWIMTYNSNKLSFKTVQKMRTEVFEKLTKVPLSYIDSTAHGDIINTVVTDIDIVSTGLLQGFTQIFSGIVTILGTLIFMFTINWYITLAVVVLTPLSFFVASFI-AKHAHKNYVKQAKYRGEITGFAAEMIEGADIVTAFNGEEDAYRHFHEINEKLKKVGTTAHFYAALTNPCTRFVNAMIYAVVAVLGSILTVKGGISVGKLSSFLTYCTQYTKPFNEISSVVAEFQNALASAERVFKLLDCNDEPSDEGAKELKAKNGTVEFNNVSFSY-SKNKPFIEGLNIRADSGKTIAIVGPTGCGKTTLINLLMRFYDVTGGEIDIDNVNIASVTRDSLRSGFGMVLQDTWLFSGTIFDNIAYGKPDATREEVIEAAKAAHAHSFILENGYDTFISESGDNLSEGQKQLLCIARVMLTKPPMLILDEATSSIDTRTEVRIQKAFALLMEGRTTFIVAHRLSTIKNADAILVMRDGKIIERGRHDELIEQNGFYKKLYN.. 569
221 0.000e+00gi|338729829|ref|YP_004659221.1| ABC transporter [Thermotoga thermarum DSM 5069]  clstr ali  19  41..TTKRLIKYLKPHLLWILIALAATIAATILTIIAPKILGRATTEIFRGPNARINFEYISKILVKVSIFYLLSALLHFVQQFLMADVSQKIVKKMRSEISQKLTKLPLKFYDSKTHGEIISRATNDVDLISNTLQQNLVQFISAVVSIVGVIIMMLTISPLLTLVTVLTLPAS-ILVTFFITKYSQKFFSQQQKLLGKLTGHVEETYGGHIVVKAYCKEKDAIEKFDKINTELFRASQRAQSLSGMIMPLMNFIGNVGYVIVSVFGGILVTKRVITIGDVQAFIQYSRQFTQPIVQISNIANLIQSTIAAAERVFEILDEQEEQPDPNAIRLEKVKGDVKFERVYFSYL-PEKPLIENLNIEVKSGQKIAIVGPTGAGKTTLVNLLMRFYEIQSGRITIDGIDIRDIVKSNLRRIFGMVLQDTWLFNGTIKENIAYGKPNATDEEIIQAAKAAQAHHFIMPDGYDTVINEEASNISQGEKQLITIARAFLVNPDILILDEATSNVDTLTEIYIQKAMQQLMKGKTSFIIAHRLSTIKNADLILVMNEGKIIETGTHKELMEKGGFYAELYK.. 618
222 0.000e+00gi|322833141|ref|YP_004213168.1| ABC transporter [Rahnella sp. Y9602]  clstr ali  24  2...LRRFFSYYAPYKKLFFLDFGCAILAGLLELGFPMAIKTFIDKLLPAH----DWVLIIGATVGLLLIYLFNTALMAIVNYWGHALGVGIETDMRREAFSHLQKLSFRYYDNTKTGHIITHVTKDLEEVGEVAHHGPEDVFIAVMTFIGAFILMATVHVQLALMTIIIVPAMTWMVSRY-GAQMTETWRRLFGQVGNFNARIEESIGGIRVVKAFANEAHEQKLFASDNDNYRTTKLKAYQIMTASLTLSYLSTRLVQLIVMVAGTWYVINGQLTYGGFVGFLLLVEVFFRPVAKISSVLESYPKGIAGFKRFTQLIDTAPDITDPGAQVVSHLRGDIHYDNVVFGYTSVSK-ILNGITLSINAGETLAFVGPSGAGKTTLCSLLPRFYELDSGSITIDGIDIRDMTQTSLRHNIGIVQQDVFLFGGTIRENIAYGKLGASEAEIRLAASRARLDDVILPLGMDTVIGERGVKLSGGQKQRLSIARIFLKNPPILILDEATSALDTATEQAIQQSLAELSEGRTTLVIAHRLATIQNADRIIVVDKEGIVEQGTHESLLAHQGRYAQLHAA. 567
223 0.000e+00gi|153954408|ref|YP_001395173.1| transport protein, ATPase and permease [Clostridium kluyveri DSM 555]  clstr ali  20  30..TMKNLIRYMNEYKASVIVVVIFAAVSASFSIIGPKMLGNATTKLFSGSGTGVDFNYIGKIIVILGALYLISSLFAYMQGWIMSGVSMKVSYKMRKEISQKINRLPLKYFDGTNQGEVLSRVTNDVDTLSQTLNQSLTQIITSVTTVIGIFIMMLSISVLMTVVALCIIPLSMIIMMFII-KYSQKYFKEQQDYLGHVNGHVEEMYGGHIVMKAFNGEKDSIEKFDKLNNTLYKSAWKSQFLTSIVMPVMNFVSNLGYVGVCVLGGWLAIKKTIEVGDIQAFIQYVRSFTQPITQIANISNILQQTAASAXXXXXXXXXXXXXXXXQNPVIENAVGSVEFKNVQFAYNS-DKIVINDFSAKINPGQRVAIVGPTGAGKTTIVKLLMRFYDVNKGVILVDGYDIRNYTRGDLRSMFGMVLQDTWLYNGSIMENIRYGKLNALDEEVKAAAKAAYVDGFVLPGGYDMILNEEASNISQGQKQLLTIARAILSDPKVLILDEATSSVDTRTEVRIKKAMNNLMKNRTSFIIAHRLSTIRDADLILVMDNGDIVEQGNHHELLKKEGAYSKLYN.. 606
224 0.000e+00gi|333999572|ref|YP_004532184.1| lipid A export ATP-binding/permease MsbA [Treponema primitia ZAS-2]  clstr ali  22  18.SPLRIFASYYRPHWKLFVADMFAATLIAAVDLAFPMMTKYTIERFLPNGM----YQFFFIMIAAMGIMYLLRMAFTYFITYWGHTVGVYLEADMRRDLFSHLQQLPFSFYDNHRTGQIMSRVTTDLFDVTELSHHGPEDLFISLITLIGSVILVFTIRWEMALVLLIIVPFMLFHI-LRSRSLMLKTARKVKERTAEINAALESSISGVRIAKAFTNESYETDKFHGGNENYKTARKAYYRSMAYFQSRLEFILHMLNVVVIAVGGFLIMKNRMTLAELITCNLFVAAFLQPIRRLQNFVELFTTGMAGFGRFVEIMRLKSDIVDKDAVALDKVRGDIRFRDVSFSYNN-DVTVLEHINLEVPAGNTVALVGPSGGGKTTLCHLLPRFYEIREGSITVDGKDIRDVTLESLRRNIGIVQQDVFLFAGTIRDNIKYGRIDTSDEEMIEAAKRAEIHDDIMPEAYDSLVGERGVKLSGGQKQRVSIARIFLKNPPILILDEATSALDTATEVKIQRALEELSRGRTTMVIAHRLSTIRGADSIVVISDDGIQQQGTHETLLEKGGLYAELYAA. 585
225 0.000e+00gi|51891771|ref|YP_074462.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863]  clstr ali  24  43...LKRLGAFLVPYLRYVILAGIAMLGVTVTRLAVPWLMAQAIDTALESEEPYARTDRLFILAGAMLAVYLVNWLANYAQIRLTSWVGQRALYDLRTKIFAHVQSLSMRFFDTRPAGSILVRVTNDVNSLQDLFTNGIISALQDVLTLVGIILIMMSMHLKLSVVIFAFLPLMM-VTTVRLRTRVRHGWQRVRIQRSRLTAHLAEAIQGVRVTQAFSQQEPNKDFFADMNVEVRKTWMDTIRLNAWFNPIVEIMGALGTAVVYWYGTRILQGGGITVGVLVAFVTYVGQFWEPILRLTQLYGNVLVAMASSERIFEYLDTKPTVPEPDAQPLPPIRGEVELDNVTFAY-EEGRTALRGVSLKVNPGETVALVGHTGAGKTSIINLLSRFYDVNEGAVRIDGVDVRDVTLESLRRQIAVVLQDTFIFSGTIMDNIRYGRLDATDEEVIEAAEAVRAHDFIMPHGYQTEVRERGSRLSMGERQLISFARALLADPRILVLDEATASIDTQTELLIQEALARLLQGRTSFVIAHRLATIRNADKIVVLDHGQIVEMGTHESLMARRGAYYNLIQA. 622
226 0.000e+00gi|291547866|emb|CBL20974.1| ABC-type multidrug transport system, ATPase and permease components [Ruminococcus sp. SR1/5]  clstr ali  23  14MATFFKVLRFIGKYRFLLVLSVILAAVTVILQLYVPVLFGYAIDEVVAAHE--VDFTRMGFYLSRILVMIVFSGIATWIMSVINNRMTYRTVQDIRARSIRHIQKLPLSYLDGHSTGDIISRVIADTDILSDGMLLGFTQLFSGVITIIGTLLFMFSKNVWITLMIIVLTPVSFFVAKFISSHSFQ-MFRAQSDARGRQTALIEEMIGNQKVVQAFGYENRSSERFAAINEELRDASQKAVFYSSLTNPSTRCINNIIYAGVALAGAFLIPGGHLTVGGLSVLLAYANQYMKPFNDISSVITELQNALACATRIFDLLEEEPESPDPSG-TLVDVKGAVDIRNVSFRY-EADKPLIKNFNLHTEPGRRIAIVGPTGCGKTTFINLLMRFYDVTGGSISVDGTPITDVSRHALRRSYGMVLQDTWIKHGTVRDNICIGKPDASDEEVIQAAKMSHSWEFILPNGLDTILYED--SLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTRTEMLIQEAFDRMMQGRTSFIVAHRLSTIRNADQILVMKDGSIIEQGNHEELMAKGGFYQKLYN.. 579
227 0.000e+00gi|50954085|ref|YP_061373.1| ABC transporter NBP/MSD fusion protein (pimaricin) [Leifsonia xyli subsp. xyli str. CTCB07]  clstr ali  20  16..SFNRLIGLLRTERLAMVWVTLLVVVSVALTVIAPKILGNATDVIVPAPGPGVDFTDLGRLLMIVLAMYIAASLLQWWQGYILNALVMRVVYRLRAEIEDKLNRLPLSYFDTRQRGDLMSRVTNDVDNIQTALQQAFSQLIQSVLMVIGIGVMMFIVSWQLALIALISIPLSGIIAGVI-GTRSQKLFKQQWNSTGALNGHIEESYSGLDLVRAFGRDEVMLERFDERNGKLWSSMVGAQFVSGMIMPAMNFVSYLSYVLIAVVGALRVTAGQLSIGDVTAFIQYSREFSQPIGQIAGMANMLQSGVASAERTFEFLDSDEQTPEHETEHLPRANGRVELDSVDFSY-DPETELIRDLSLSVEPGHTVAIVGPTGAGKTTLVNLIMRFYELNGGAIRLDGIDTTDLSRSELRGQVGMVLQDAWLFSGTIRENIRYGRLEASDEEVVAAAKATMVDRFVLPDGYDTVIEADGGNVSAGERQLLTIARAFIANPSLLILDEATSSVDTRTELLVQHAMAALRSDRTSFVIAHRLSTIRDAHTILVMEKGRIVEQGDHKTLLAKKGAYYDLYMT. 598
228 0.000e+00gi|323483823|ref|ZP_08089201.1| hypothetical protein HMPREF9474_00950 [Clostridium symbiosum WAL-14163]  clstr ali  21  4MKTMKRFAPYYFKYWKALLFDLFCAALTTLCEIVLPLILRYITNEGMYN-LANLTVKTIVTIGLLYFGLRIIDGLANFYMAYTGHIMGARIETDMRTDAFCHLQKLSDSFYSNTKVGQIMARITSDLFDVTEFAHHCPEEFFIAFLKIVISFFILARINLLLTVVIFIFIPVMAVSCT-YFNLKVRSAFKMQRNHVGELNARIEDSLLGNRVVRAFGNEKLEIEKFQQDNLKFLDIKKHTYFYMAAFQDTVRMFDGIMYVVVIIAGGTFLVKGIINPGDLVAYTMYVTTLLSTIRRIIEFAEQFQRGMTGIERFCEIMXXXXXXXXXXXXELKDSRGEITFENVTFEYPDDHNQVLSDINLTIRPGERIALVGPSGGGKTTLCNLIPRFYDPTEGRILVDGKDLRKLTLESLRSQVGMVQQDVYLFSGTIYDNIVYGKPGACREEVMEAAKMAGADEFIMAMGYDTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSALDNESEKMVSRSLDKLAVGRTTLTIAHRLSTIRGADRILVLSGNRIEEEGSHGELMAKEGIYYHLY... 577
229 0.000e+00gi|184154233|ref|YP_001842574.1| multidrug ABC transporter ATP-binding and permease components [Lactobacillus reuteri JCM 1112]  clstr ali  20  20..TTKRLIAYLRPWRVGVIVSILLAVISVILSILAPKILGEATTIIYDGMLKGINFTRIWQIGITVILLYLFSGLFSFLQLQIMTRVSQRVVYNLRQDFEGKMRRVPIKYYDTHNNGDIMSRMVNDMDNIAGTLQQSLIQIITSLLTLVGVFILMLTISWKLTIIALVTIPLSVLVVAFVAP-TSQRLFGRQQAALGKINDQVEETYAAHTIVRTFNKEQDEEEKFNKENHQYYQAAWKAQFFSSLMMPMMVFIRNLGYLVVVVVGAIQVIHGQITLGNVQAFLQYTNQFSQPIAQIANLSNTIQQTIASAERIFAVLDEPEMSDKVEDIPSLTGKDKVEFKDIKFSY--TDEPLIQDFNLKAPRDKMVAIVGTTGAGKTTIINLLERFYDPQGGHIYLDGKDTRSMTRDTLRKHIAIVLQDTWLFTGTIFENIKYGNENASDEEVYHAAKMARADAFILPDGYQMVLDESASNISQGQRQLLTIARAFLADPEILILDEATSSVDTRTEVLIQEAMNALQQERTSFVVAHRLSTIRKADQIVVVNHGKIIETGNHESLMNKKGFYANLYN.. 603
230 0.000e+00METAHIT unmapped GL0631224 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold141811_5:212:2005:+  ali  18  35.NSFGKLLRYMGKFKVLLILVVIFAVCSTIFTIVGPKILGMATTKLVSGTGTGIDFGYIGTIAIILICLYLVSLLFGYLQGHLMSKVTMKVTYNLRKDISNKMHRLPFKYYDGTSNGEILSYITNDIDTISQSMNQSATQIITSVTTIIGILIMMLTISWEMTLVALAIVPISMGIISLIM-KKSQKHFMAQQAYLGHVNGHVEEMYSSHVVIKAFNKEKESAKTFDKYNNTLYKSAWKSQFMSGLLMPIILFVGNLGYVAICILGGYLSVTTGLPVGNIQAFMQYVRQFTQPISQIANISNILQQTAAAAERVFNFLEQEEEVPETKNPTCIKPKGKVVFDHVHFGY-TPERTIINDFSTVVEPGQKVAIVGPTGAGKTTIVKLLMRFYDVNSGAILVDGHDLREYARKDLRSMFGMVVQDTWLYNASIEDNIRYGKQTATTEEVIEAAKAAQVDHFVFPDGYKTMLNEETNNVSQGQKQLLTIARAILADPEILILDEATSSVDTRTEILIQKAMDHLMEGRTSFVIAHRLSTIKNADTILVM............................ 598
231 0.000e+00gi|266625414|ref|ZP_06118349.1| ABC transporter, permease/ATP-binding protein [Clostridium hathewayi DSM 13479]  clstr ali  21  48..TIRRLLSYLNGYRLHMGLAFFCVIVNTVATLAGSYMLRPIINKYIAPMDGSRSISGLAGSLVFMAAIYLIGVAANYAQSRVMLTVAQNALQKIRDELFTKMQKLPVRFYDTNNNGDLMSRFTNDVDTVGQMLSSTLVQLFSGALSIIGTLALMIYTNIWLTLVTVFMIPLMMKAGGYVAGK-SQKYFSAQQTSLGAVNGYIEETISGQKVVKVFCHEDIAEEEFEILNEDLRDNMIKAQFFGGMMGPVMSNLSQLNYTLTAAIGGLLCVLRGFDVGGLTVFLNFSRQFSRPINEISMQISNVFSALAGAERVFAVMDEEPEVDDGDAAVLDPMKGYVELKNVTFGY-NPDKTILKDISLYAKPGQKIAFVGSTGAGKTTITNLLNRFYDIQSGSITIDGINIRHISRDNLRHNIAMVLQDTHLFTGTVMENIRYGRLDATDEEVIQAAKTASAYSFIMPHGFDTVLEGDGANLSQGQRQLLNIARAAISKAPILILDEATSSVDTRTEKHIEHGMDRLMADRTTFVIAHRLSTVRNANAIMVLENGEIIERGDHEDLLAQKGRYYELYTGL 620
232 0.000e+00gi|302392919|ref|YP_003828739.1| unnamed protein product [Acetohalobium arabaticum DSM 5501]  clstr ali  23  1MELVKRILAYVKPYRRRLAAAVVSMVLHSLMTLLFIKGFQDLIDTMINNSNSGEGFVKLSWVAVGIVVVYFFKGVAYYGQKYLTSYVAQRAIMDIRNDLYCHLQNLSLGFYDEMKTGQIMSRVTNDVGKLQSAIVSGAVSLFYKSVTLIAGLGYLFYLSWQLSLAVLIIFPIVTYVFIKY-NRRIREVSRRVQARIADVTDILQETITGVRIVKSFTQEDYEYDRFSEQNHANFRANMKNTQLSASLTPIVEILASFIFTFVLWYGGYQVMKGLLTPGELLAFFTLLITISGPIKSLSKLSSTIQKALAAADRIFEIIDLEIDIEEKDAIELESAEGKVEFKDVWFSY-DEDEMVLKGINLTANPGEVVALVGPSGAGKSTLVDLIPRFYEPQSGEVLLDGYDIKDLTIKSLRSKIGIVPQENILFGGSIGDNIAYGGIDKEQEEIIKAAKAANAHEFIMPDGYDTQIGERGTGLSGGQRQRVSIARAILNDPKILILDEATSDLDTESEALVQEALDRLMEERTTFVIAHRLSTVLNADKIVVLDEGEIAEQGTHEELLAQKGLYSHLYK.. 573
233 0.000e+00METAHIT MH0063 GL0066856 [Complete] locus=scaffold5673_2:596:2251:-  ali  19  1..........................MVAICDLFYPMIAKNITNVYV----PNKELRLLLVWAGVLLGIYLIKAALNYIIQYWGHIVGVRIQGDMRRDMFRHLQKLPFSFFDENKTGAIMSRLVNDLFEVSELAHHGPEDAFISGITLIGSFIMLANINLYLALIVFAVIPLMIF-FAVKTRREMNAAFKASRVQVGEVNANVETAIAGMRVSRSYTADEHENAKFGVANESFKKARSRAYRAMATFGSGMNFFNDMLYLLVLTAGGLFFYYGKIDSGDFVAFLLYVSIFMKPINRLVSLFEQLQEGMTGFQRFVEIMDEPEEADD-GKLNPDKLEGNIVFDDVSFRYSNSDSKVISHLSMRIDKGKTVALVGPSGGGKTTLCNLIPRFYEIDSGAITIDGMDIRDMSRYSLRRNIGIVQQDVFLFNGTIRENIAYGDLDATDEQIIEAAKKANIHDYVMEEGYDTNVGERGVKLSGGQKQRISIARVFLKNPSILILDEATSALDNATEMLIQQSLSELAKGRTCIIVAHRLSTIKNADEIIVLTKDGIEERGTHEELMKLNKMYAGLY... 545
234 0.000e+00gi|302343531|ref|YP_003808060.1| lipid A ABC exporter, fused ATPase and inner membrane subunits MsbA [Desulfarculus baarsii DSM 2075]  clstr ali  23  12.KLYSRLLARVKPYKYRLVFSMFLMAVAAGTQGALAWLVKDLSDGIFME----KNQWMLYMVPVVVIVLYAVKGLSSYGQTYMMSYVGNRIVTEFRVELYTHLQRMPLGYFDRVATGELMSRITNDVNLIQGAVSNVVTGVFKDLFTAVALIAVVIYRDPMLSIVALGVFPVCVIPL-VKLGRRLRSISTSSQETMADVNVLLHETIGGARIVKGFCREDHEARRFTREAYRLFDLRMKDVSTRAISSPLMEFLGGLAIAGIIFYGGWQVISGQSTPGTFFSFLTALIMLYEPVKRMSNLNNEIQNGLAAAERVYQVLDTEPEIVDPDAIQLPPMSRAVELKDVHFAYSAEKGEVLKGVSLLVPKGQAVALVGTSGGGKTTLVNLLPRFYEVTSGAVLIDDLDIRRVTMRSLRRQISIVTQQTILFNDTVRENIAYGRPEASDEEIVEAARAAYALDFIMPQKFDTRIGEAGVMLSGGERQRLSIARAILADRPILILDEATSSLDTESELYVQKALENLMRGRTTFVIAHRLSTVQRADRIVVVSGGKIVEEGRHEELLANGGLYCKLHR.. 579
235 0.000e+00METAHIT MH0086 GL0105447 [Complete] locus=scaffold5105_5:6636:8408:+  ali  23  17.QTLKRILKCIKKYSVLVVFSLICAAVSVVLTLYAPILMGNGVDKIV--GAGNVDFDGXXXXXXXXXXXXXITAIAQWLMNIINNRITYKVVNDVRTMAFDKLSRLPLSYVDSHTHGDIVSRIIADVDQFSDGLLMGFTQLFTGVMTIVGTLVFMLSINRXXXXXXXXXXXXSLFAASFI-AKKTYNMFKKQSEIKGELTSIVNEMVENQKVVTAFSMEDRVNDRFNEVNDRLNVAGLKATFFSSTTNPVTRFVNSLVYTGVGIIGAVMAIKGRITVGQLSSFLSYANQYTKPFNEISGVVTELQNAMASAARVFELIDEEAEIADKDAVVLKDVSGSVKLTDVDFSY-DKSKELIKDLNLDVKPGARIAIVGPTGCGKSTVINLLMRFYDVDSGSIAVSGHDIKDVTRHSLRENYGMVLQETWLKSGTIKENIAYGRPDATDEEIIEAAKQSHAHSFILPKGYDTMITEDGGNLSQGQKQLLCITRVMLDLPPMLILDEATSSIDTRTEIRIQRAFNKMMKGRTSFVVAHRLSTIKESDVILVMKDGHIIEQGNHETLLAMNGFYTNLYN.. 585
236 0.000e+00gi|259417501|ref|ZP_05741420.1| lipid A export ATP-binding/permease protein MsbA [Silicibacter sp. TrichCH4B]  clstr ali  25  2...IRQFFDYYRPWKTLFFLDFGCAVASGLLELAFPVAIKGFIDVLLPRG----DLWLTVLAAIGLLAIYLVNSGLMAIVIYWGHKLGINIETEMRRKAFDQLQRLSFSYFDKVRTGKLVARVTRDLEEIGEVAHHGPEDLFVALMTFIGAFLMMLMIDMRLALITATIFPLCVIIVMVFGGRMTR-TWQAIYSRVADFNIRLEENVGGIRVVQAFANEEHEKRLFADDNARYRDTKLAAYKVMAASSTINYMGMRFVQVLVMVAGAIFVLRGELTTGGFVAFLLLVGLFFRPLEKIAAVIELYPRGIAGFKRYLELLAIEPEVEDPDARPAPDLRGAVRFENVTFGY-DQERPVLDGISLDVAAGETVAFVGPSGAGKTSLLALVPRFYEPQSGRVLIDGHDIRTLTLRSLRTQIGIVSQDVFLFGGTLRENIAYGRLDATEEEIRLAAEKARLSDMILPNGLDTIVGERGVTLSGGQKQRVAIARIFLRNPPILILDEATSALDTETERQIQRALEDLSVGRTTFVIAHRLSTIRDADHIAVMEAGRIVEVGTHAELLARNGSYSRL.... 564
237 0.000e+00gi|241203719|ref|YP_002974815.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]  clstr ali  24  2...LLRFFRYYSPYKQLFFLDFGCAVVAGLLELGFPIAVKLFVDTLLPQ----RDWWLIAATAGLLLVIYLFNTALMAVVNYWGHALGIGIETDMRRQAFDHIQKLSFRYFDNNKTGHLITHVTKDLEEVGEVAHHGPEDLFIAIMTFIGAFILMFTVHWKLALLTTAIVPFMTWLVSRYGAK-MTLSWRDLFRQVGEFNTRVHESVGGIRVVKAFANEDHERDLFARNNEGYRATKLNAYAYMTASITLSYFSTRFVQLVVMISGTWFVISGELSYGGFVGFLLLVNVFFRPIDKITSVLESYPKGIAGFKRFTQLIDTAPDIADPNATSVDHLTGNIVYSNVSFGYTGDGK-VLDGLELSIAAGETIAFVGPSGAGKTTICSLLPRFYEVDSGSILIDGIDIRDMTQKSLRSQIGIVAQDVFLFGGTIRDNIAYGRLGADDAAIIDALRRAALDEYVLPNGLDTVVGERGVKLSGGQKQRLAIARIFLKNPPILILDEATSALDSATEYAIQQSLSALSKGRTTLVVAHRLATIRNADRIVVVGTSGIVEQGTHSQLLAREGGYARLHQA. 567
238 0.000e+00gi|378573584|gb|AFC33894.1| ABC transporter [Paenibacillus mucilaginosus 3016]  clstr ali  22  48..TLRRMWRYLSRQRTGLILVFLFTLLSAGLALLGPYLIGRAIDEYILP----RDYAGXXXXXXXXXXXXXISGAMNWIQTYIMSGVTQATVRELRTDVFARLQLLPLRFFDSKTHGELMSRTTNDIENVSTSFNQSVTQLITSVVTIIGSLAMMLALNVWLTLVSLVTIPLVMLVTGAI-SKRTRGHFKEQQQRLGELNGFIEETVSGQKVVTVYNREARAAEEFRGINNRLRDASIRAQLLSGMMGPVMNVINNFGFALVAAVGGWMVLGDFTTIGIVVAFLNYSKQFGRPVNELANQYNLIQAGVAGAERAFELLDAEDEYGSPSALQEQTLTGEVVFKDVSFGY-KEGEPILKHITFTAKPGETIALVGPTGAGKTTIVNLLTRFYEISGGSITIDGRPLQEFDKNILRSQLGIVLQDAYVFSDTIRENIRYGRLGATDAEVEEAAKLAGADSFILPQGYDSVLSAEGSNLSHGQRQLLTIARAILADPAILVLDEATSSIDTRTEMQIQEAMNVLMQGRTSFVIAHRLSTIRSADQILVLHGGEIIERGTHEQLLEARGFYHGLY... 615
239 0.000e+00METAHIT MH0079 GL0041717 [Complete] locus=scaffold55558_1:2771:4501:+  ali  19  2...IRRFAPYYKPHIKLFLLDITCAFLIAVCNLVYPFITKEIINIYVPQ----RELNMILIWGGVLLAIYIIKALLNYVLTYWGHMVGVKIQADMRRDLFQKLQRLPFTFFDKNRTGHITSRVINDLMDISEVAHHGPEDIFLSLITMIGSFIVLATINWKLSLIVFAVIPFIIIFTAK-TRVNQRKAFRLMRIKTGEINAEVESSIEGIRVAKAYVQEEHELEKFQASSIRFQEARAQAYKEMGIFHSGMQFFADILYLIVLVAGGYFFYKGYIDDGEFAAYIIYIMMLINPIRTLVNTYEQIQNGMSGFARFLEVMDEEPQPSKEQEKTLDGFHDCISFEDVSFTYETEKDYVLSHLSFDIEKGKVIALVGPSGGGKTTICHLIPRFYEIDDGKITIDGIDIRDITTQNLRKRIGIVAQDVFLFPGSILENIAYGNEKASKKEIMDAAKKANIHEFIMDKGYDTEVGERGVMLSGGQKQRISIARAFLKNPDILILDEATSALDNMTEMQIQNALYQLQKGRTTIVVAHRLSTVKNADEIIVLTENGIVEKGTHEELIAKNGIYAELYQ.. 571
240 0.000e+00gi|373495304|ref|ZP_09585890.1| hypothetical protein HMPREF0380_01528 [Eubacterium infirmum F0142]  clstr ali  20  28.KSLGKLFKYMGRYKYAIFAVMVMAAISTVFSVAGPKVMGKATTELANGGTGGIDFTLIGKILLFTLALYVTSVAFSFIQGWIMTGITQKLAYRMRREISEKIDRMPMKYFESRPYGDVLSRITNDVDTLGTGLNQSFTMIITSFATIIGTIIMMLTISPLMTLITFCILPISSILLGTII-KKSQKHFSTQQKYLGKINGMVEENYAGQLVIKAFNKEAETIEAFDETNEVLFKSAKKSQFLSGIMMPLMSFVGNLGYVGVAISGGFLAIKGRIGIGDIQAFIQYVRNLTEPMQQVAQVVNQVQSMTAAAERVFEFLEEDEEEPTRDAVIIDELTGAVDFEHVRFGY-KADMPVIKDFTVHVEPGQKIAIVGPTGAGKTTIVKLLMRFYDVDFGTIKLDGININQIDRRELRKNFGMVVQDTWLFKGSIMENIRYGRLDATDEEVIEAAKAAYADKFILPGGYGMELNEDASNVSQGQKQLLTIARTILANKKLMILDEATSSVDTRTEVMIQKAMDQLMQGRTSFIIAHRLSTIKNADIILVMKDGDIIEQGNHEELLESKGFYADLYN.. 604
241 0.000e+00gi|291542152|emb|CBL15262.1| ABC-type multidrug transport system, ATPase and permease components [Ruminococcus bromii L2-63]  clstr ali  23  18..........IKPYSFYLILALVSAIISVSLTLYIPVLTGNAIDNIIDKG--NVDFASVIQILVYIGAGIGGVALFQWIMTYFTNIVSYRTVRDLRREVFEKFNTVPLSYIDTTPHGDLISRVINDVDAVGDGLTQMFLQLFSGIVTIVGTLVFMLTINWKIALVVVVLTPLSLFVAAFI-GKMTHNRFTRQQALNGDISSYVEEHIGNQRIVKAFSYEDRAFEEFEKYNDELLEVGFKAQFAGALANPSTRFVNALVYAAVGIMGALFAVAGTLSVGQLSCFLTYANQYTKPFNEVTGVLTQLQTGIAAAGRVFEVLEADNEIPDNSTKELEHCEGNVKIENVNFSY-TKEKPLISNFSLDVKSGSHIAIVGPTGCGKTTFINLLMRFYDTDSGKISIDGVDIMDITRDNLRKCYGMVLQDSWLFNGTIMENLRYGNENATEEEVIAAAKAAYAHSFIMSDGYNTVISEDGGNLSQGQKQLLCIARAMLTNPSILILDEATSSIDTLTEIRVQKAFAKMMKGKTSFVVAHRLSTIKESDVILVMKDGNIIEQGTHEELLAKGGFYSKLYN.. 576
242 0.000e+00gi|317055337|ref|YP_004103804.1| ABC transporter-like protein [Ruminococcus albus 7]  clstr ali  20  33..TLAKLLRYIGKSRYLFFVLMAVMLVMTLLGLAAPYIQQIAIDCILDKKKLDVDTGRLVKILIVLGIVYLLNSVFSYLQGIFSARLSQRTVSTMRRDLFGDLVKLPIKYFDTHRHGDIMSRMTNDVENISNTVSQSIGSLISGVLTVIGSIIIMLTYSPLLTLISLSTVALTIFVSGR-MTKYMRRYFIKQQIILGKLNGHVEEMVTGYRTVVSYSKESAAVAEFNAMSDELRKTGIRAQICAGIMGPLMNCISNFGFVMIAAFGGWFSYKGWITVGTIQAFILYSKQFSRPINEIANQYANIQTAIAGAERIFEVMETPPEPDETATVTAEDIRGDIRFEDIHFSY-DPEKPVLKGLDLDIRQGSKIAIVGATGSGKTTVVNLLTRFYEADSGRMTVDGTDIRDIPKDELRKSIGIVLQDTVLFKGTVEENIRYGREDAPDEDVRRAAAHANADGFILPEGYKTQLAEGGSNLSQGQRQLLAIARAILADPKILILDEATSSVDTRTEMHIQSAMVALMKDRTSLIIAHRLSTIRDADMIVVIDGGKVAEKGRHEDLIAQKGCYYELYRT. 604
243 0.000e+00gi|222081968|ref|YP_002541333.1| multidrug resistance ABC transporter [Agrobacterium radiobacter K84]  clstr ali  24  2...LRRFFSYYARYKTLFFLDFGCAVVAGLLELGFPLAVKLFVDQLL----PGRDWGLIAATTAVLLMVYALSTGLSAIVNYWGHALGISIESDMRRQAFEHIQKLSFRYFDNNKTGHLITHVTKDLEEVGEIAHHGPEDLFIAIMTFIGAFLLMFSVHWKLALLTTTIVPFMTWLVSRYGAK-MTKNSRSLFGKVGDFNTRMQETVGGIRVVKAFANETYESQLFAGHNEDYKATKLDGYAYMTAGIALSYFSTRVVQLVVMMAGTWFVISGELSYGGFISFLLLINVFFRPIDKITSVIETYPKGIAGFKRFLSLIDTQPDLADPNAMEVKHLKGNITYKDVSFGYSEHG-TIFADLNLTIAAGETVAFVGASGTGKTTICSLLPRFYDVTGGSITIDGIDIRDMTQASLRSQIGIVQQDVFLFGSTIRENIAYGRLGANDEEIMEALRRASLDEFVLPDGLDTPTGERGVKLSGGQKQRLAIARIFLKNPPILILDEATSALDTATEYAIQQALADLSTGRTTLVVAHRLATIRNADRIIVMGPTGIVEQGTHAELLARDGAYARLHNA. 567
244 0.000e+00gi|327441585|dbj|BAK17950.1| ABC-type multidrug transport system, ATPase and permease component [Solibacillus silvestris StLB046]  clstr ali  21  2...LARFFTYYKPHKRLFIIDFSCAVFVAVLELLFPMAVQWFIDDLLPTNDWG----MITKISALLLLTYILSTGMNYVVNYLGHKLGVNIETDMRQQLFNHVQRQPYTFFDNMKTGHLMSRITNDLFDIGEFAHHGPEDLFIAMMTFIGAFTIMFNINATLATIILIFVPF-LIAVMYWSNRRMKKGWAVMYSEIANVNGRVEDSFSGIRVVKSFTNEEFETNRFKDQNALFRKAKIYAYKVMAGTHSSIYIXXXXXXXXXXXXGAWLSNNGDLSYGEFASFILFTNVLIKPIDKISALLEMYPKGMAGFKRFCDLLDQEPTIVDPNAIDVDQLNGDIEFKNVDFKYADS-KQVLNNLSFKVDAGKTVAFVGPSGSGKTTISALIPRFYDITDGAITIDGYDIRDLTQHSLRKQIGTVQQDVFLFTGTIRENIEYGKLGASFEDIKAAAEQANLLEFILPDGFETEIGERGLKLSGGQKQRLAIARMFLKNPPILILDEATSALDTATERIIQQSLNDLAKNRTTLIIAHRLATIRDADYIFVVTPNGIEEQGTYEELVAKGGIFAGLHHA. 567
245 0.000e+00gi|163841021|ref|YP_001625426.1| ABC transporter [Renibacterium salmoninarum ATCC 33209]  clstr ali  21  19..SLKRILGLMKPDRLRMTWLVFLAAVSVLLSVAAPKVLGHATDLIFQGIIGGIDFQALGWVMLSVLMLYAISFFFNWSQGYITTGIVQRAMYRLRQDIEAKLDRLPMSHFQEASRGDVLSRVTNDINNFSQTLNQTLTQLLMSVLTVIGVIAMMFSISWSLALIALCSVPLIA-GITVLVAKRSRVQFMAQWKTTGELNGHIEEMFTGHEIVKAFGQQKAAIAKFEVANQGLYKSSSKAQFISGVIMPSTGFVSNLSYVAIAVVGALQITAGQITLGSVQAFIQYSRQFSQPIAQIGGMINLLQSGVASAERVFTLLDEKEQSPDPAAKPGEPIQGRVVFDHVNFKYKD-DEPLITDLSLVAEPGQTVAIVGPTGAGKTTLVNLLMRFYDIDSGKISIDGVDAAQMSRDDVRQRFGMVLQDAWLFSGTIRENLVYGRLDASEADIVEAAEATYVDHFVLPDGYDTVLSDDGDSLSQGQRQLMTIARAWLANPSILILDEATSSVDTRTEVLIRNAMNRLREDRTSFVIAHRLSTIRDADLILVMDHGRIIEQGTHEQLLVAKGFYEKLYK.. 633
246 0.000e+00METAHIT MH0012 GL0042818 [Complete] locus=scaffold2141_1:957:2729:-  ali  20  20..TLRRIFPFYKPYKGLFALDLLSAFIMSIAGLVFPVLVRVLMYDVLGDDFK---WAFLFQIAGIMIAVKIVEVACRYYMTTVGHIMGARIEKDIRMSLFDKFMRLPTSFYDDNKVGELMSRSTTDLFDITECTHHCPEEIFIVIVKFVGTFAYLMTINVELTLIVFATIPVFA-VVTYFYNNRLNRIFRQNRKKIAELNTHLEDTLSGIRVVKSFATEDLETNRFEKDNEDFVKIKRQSYMNMGGFFSSITLFSSIVYILTAVTGAAFIQKGHINTADLITYLLFVNTLLGTVDILVQFTEQYQQGIAGFQRYCNLMDTPEDISDPDAIDIESFDGEIEFSDVSFRYND-GADVLNHLSVTVEKGESVAIVGPSGGGKTTMVSLIPRFYDVNSGAVRIDGKDVRDVTLRSLRKCIGIVQQDVYLFNGTVAENIAYGNPSATREDVVKAATAAGVNEFVMSDGYDTVVGERGVKLSGGQKQRISIARLFLKNPPILILDEATSALDNESERMVQKSLDRLAEGRTTLTIAHRLTTIKNAERILVLTENGIAEDGNHKELMERGGIYANLYRT. 587
247 0.000e+00gi|373857790|ref|ZP_09600530.1| ABC transporter related protein [Bacillus sp. 1NLA3E]  clstr ali  20  35FATIKRLWEYLSRKKGLFIAVMIMIVISTGLGLLGPVLVGKTIDHYIVTH----NTKGLLPLLIGLVFVYVFYAITSFLQNYWMIGIAQKTVYTLRSDLFKQLHRLPIYYFDKRQHGEIMSRVTNDIENVSSTLNSSVIQISTSILMLVGTISVMLWLSPLLTVITLLIVPLMFAGMKWITNR-TGKSFKEQQRNLGEINGFIEETISGQRIVKTFSQEKKVIAEFMIKNEQLKGSGFWAQTISGFIPKVMHVLNNLSFAIIAGVGGILALKGAITIGVIVVFTEYARQFTRPLNDLANQFNTLLSAVAGAERVFEILDEKLEAGDEENAILSSIKGDVEFKNVTFSYEKESDT-IKDVSFHAHIGETIALVGPTGAGKSTIINLIARFYETDSGGIFIDGQDIKNIKRESLRIHLGFVLQDSFLFEASIRENIRYGKLNATDDEVEQAAILANAHSFIMPKQYDTVLKQDGSGISQGQKQLLSIARAILTDPAILILDEATSNIDTITEIKIQEALQRLMKGRTSFVIAHRMNTVQQADQILVLDQGILIEKGTHHSLLAEKGFYYELY... 601
248 0.000e+00gi|336425526|ref|ZP_08605547.1| hypothetical protein HMPREF0994_01553 [Lachnospiraceae bacterium 3_1_57FAA_CT1]  clstr ali  20  29..TIKKLVKYMGSYWPAFVAVLFFAIGSTVFGIIGPKISGKATTELFNGGTGSINFEKIGQILLLLLGLYVLSAVLSFIQGLIMTGISQKLAYRFREEICSKINRMPMQYFESRTVGEVLSRITNDVDTLGQSLNQSVTQLITSLTTMVGVLIMMLSISPLMTLIAIVILPISAGLIGIVV-KKSQKFFVAQQKYLGEINGQVEEVYSGHNIVKAYNKEEDVEQTFHDTNNILYQSAWKSQFLSGLMQPVMTFVGNLGYVSVAVVGSMLAVRGTITVGDIQAFIQYVRNFTQPITQLAQVSNMLQSTAAAAXXXXXXXXXXXXXQNVENPVLEFPQGRVDFRNVVFGY-NPDKIIIHNFNCSVKPGQTVAIVGPTGAGKTTMVKLLMRFYDVNSGAILVDGSDVRDFNRSELREIFGMVLQDTWLFKGTIMENIRYGRLDATDEEVIQAAKAAHAHHFILPGGYQMELNEDASNVSQGQKQLLTIARAILADNKIMILDEATSSVDTRTEQQIQKAMNHLMEGRTSFVIAHRLSTIRDADLILVMKDGDIIEQGRHEELLAKNGFYAELYN.. 604
249 0.000e+00METAHIT MH0011 GL0062959 [Complete] locus=scaffold5061_1:7474:9240:+  ali  21  13.SALRPLLRYAKPHMWLFILSMVFAVIAVATTLYAPILVGNAVDLIIAKGL--VDFDGIINIIIKLGVTVTVTGIAQWLMSLCTNKITYCVVRDIRNDAFAKLQKLPLSYIDSHPHGDIISRIISDLEQVSDGLLMGFSQLFTGVCTIFGTLGFMLSINVKITLIVVILTPLSLFV-ARFIAKNTFKLFHQQSVARGDMTSLVEEMTGNQKVVTAFGYQEEAEEQFEEVNLKLQKVGLNATFFSSLTNPCTRFVNNLVYMAVGIVGALSVIKGGFTVGNLSCFLTYANQYTKPFNEISGVITELQSAFASAKRVFEVIDETEEIPDSNATVLTSVDGTLDVDNVSFSYV-PDVKLIENFNLHVKSGQRTAIVGPTGCGKTTMINLLMRFYDTDSGEIRISGEPIKDCTRDSMRSMYGMVLQETWLKTGTIRENLCYGKPDATEEEMIAAAKSAHCHGFILPKGYDTVISDSYSTISAGQKQLLCIARVMLSLPPMLILDEATSSIDTRTEILVQRAFEKMMQGRTSFIIAHRLSTIKNADTIIVMDSGHIVEQGSHDELMAKNGFYADLYN.. 582
250 0.000e+00gi|256831593|ref|YP_003160320.1| ABC transporter [Jonesia denitrificans DSM 20603]  clstr ali  21  40.KSFARLIGLLRPYAWAFIGVSLLGAIGVVLSVLTPRVLGNATNVVFEGPGQGIDFTRLGELIVLALGLYVVAALLMWIQGYVINVIMVRTMWRLRRDVENKIHRLPLSYFDQVQRGELISRVTNDIDNITQMMQQSLSTVVTSVLTVLGVVIMMLTISWQLTLVALVSLPLMAIIFGVI-GPRSQKAFSTQWRKVGRLNARVEESFSGHALMKVYGRERASVEAFRAENEELYEASFKAQFLANTMMPSMMFIGNLTYVGIAVMGGVAVASGQMRLGDVQAFIQYSQQFTQPLSELGGMAAVIQSGTASAERVFALLDVEEESEEPDAPAPAHGDGTIEFDHVAFSYR-PDQPLIEDLSFTVAPGQTVAIVGPTGAGKTTLVNLIMRFYELDGGRIVINGQDIAELTRHDVRATTGMVLQDPWLFAGTIRENIRYGKATASDEDIVAAAKATYVDRFVLPDGYDTELDEDASNLSAGERQLITIARAFVSQPSVLILDEATSSVDTRTELLLQHAMAALRQGRTSFVIAHRLSTIRDADMILVMEHGRIVEKGNHEELIAREGAYYRLYQ.. 647
251 0.000e+00gi|262204383|ref|YP_003275591.1| unnamed protein product [Gordonia bronchialis DSM 43247]  clstr ali  20  22..SVKRLVRLLASYRIAMMVVLASIVGSVILVAIGPRVLGHATDLVFDGPGVGVDFGDVGRVLLIVLALYVASSFLAWLAGYLLNIAVVGTIRGLRADVEAKIHRLPLRYYDSTPRGDLLSRVTNDLDNLSQSLQQTISQFLNSVLTVIALLVVMIWISPLLALIAVVTVPL-AFVATAFIAKRSKPHFMSQWASTGALNAQVEEAFTGHELVKAFGRQAEIEATFDERNEKLYQSSWRAQFISGAIMPTIMFLGNLNYVAVAVVGGLRVASGSLSLGEVQAFIQYSRQFTQPLTQIGSMINLMQSGVASAERIFDILDAPEQSPDPKPLTPQDDHGLIEFDDVSFRYVD-DKPLIDNLSLVARPGHMVAIVGPTGAGKTTLVNLLMRFYDVDSGVIRVDGIDSRRMTRDDLRERTGMVLQDSWLFGGTIYDNIAYGDPTASREEVIEAAQLSHVDHFVLPDGYDTILDDEGGGVSAGERQLITIARAFLAKPTILILDEATSSVDTRTELLIQQAMANLRTDRTSFVIAHRLSTIRDADVIVVMEDGHIVEQGNHDELLAAGGAYCRLYQ.. 628
252 0.000e+00METAHIT MH0060 GL0077821 [Complete] locus=scaffold27958_2:7989:9755:-  ali  22  17...LKRVLTHIKKYRILVILSFVCAMITVASTLYAPILTGDAIDLIVGKGL--VDFDGIKDIIYTFLMVTVVTVISQWFMNIINNHITYSVVRDIRIEVFNHMEELPLSYIDSHKHGDIVSRIVSDIDQFADGLLMGFTQLFTGIVTILATLGFMIAVNVPIALVVIVLTPLSLFVASFI-AKRTYHLFHQQSETRGEITALVDEMVGQQKIVQAFGYEDDALDRFEEINERLEKDSMSATFYSSIVNPCTRFVNNLVYAAVGIIGAVSVISTGFTVGQLTCFLSYANQYTKPFNEISNVITELQNAMACAGRVFELLDETPQVPEKEAYVLTDTKGAIEIKDVNFSYV-KDKTLITNLNLSVKPGMRVAIVGPTGCGKSTLINLLMRFYDVDTGAISVDGTDIRDMTRDSLRQNYGMVLQETWLKSGTIRENIAYGKPDATDEEIVQAAKLAHSDSFILPQGYDTVIAEDGGNLSQGQKQLLCITRVMLLLPPMLILDEATSSIDTRTEIRIQKAFNRMMQGRTSFIVAHRLSTIREADVILVMKDGNIIEKGNHEELMAQNGFYTNLYN.. 583
253 0.000e+00gi|53714432|ref|YP_100424.1| multidrug resistance ABC transporter [Bacteroides fragilis YCH46]  clstr ali  22  18.KTFLRLISYVACDRRLLIVIGVLIVISIAANLTGSYMLRPIINDYILPG----DFQGLVRILLFLAAIYLTGVAATYIEYILLNKIGQRTVTRMREELFGKMERLPVRYFDTHQHGDVMSRYTNDIDRISDALTDSLSDMLSSALTVIGIFCLMIFISPILTAVTLITVPLMFLSAKGIV-KRSRKYFKAQQEALGMMNGYAEEMISGQKVVKVFGHEQKVETDFGILNQSLKDKSLKAQFYSGLMMPVMQNLNTLNYVIITIVGALLAIFRGFDVGGLAAFLQYSRQFGRPINELASLYNSIQAAIAGAERIFEIIDEAPEKADPEAVTLKNIKGDVALKNVYFGYR-PEKTILKGVSLHAPAGKKIALVGATGAGKTTILNLLPRFFDIQSGEITIDNHPIDRIERNSLRRSMAIVLQDTHLFTGTVRENIRFGRLSATDDEVVAAARLTAAHSFILPQGYDTLLENDGANLSQGQRQLLNIARAAVADPAILLLDEATSNIDTRSEILIQRGLDQLMQGRTSLIIAHRLSTIRNADTILVLEHGEIIEQGSHQELLALKGKYYSL.... 582
254 0.000e+00gi|342216594|ref|ZP_08709241.1| ABC transporter transmembrane region [Peptoniphilus sp. oral taxon 375 str. F0436]  clstr ali  20  4FKLIKKVLPYFKRYQAILYLDLFCAGLTTLSEMVLPLILRFITNTGMTN-LESLSVGIIVKLALLYLVVKTVEVIAGFYMTSIGHIMGAKIETDMRHDVYAHLQGLSYRYYNETKVGQIMSRLTNDLFDITEFAHHCPEEYFIGGLKILISFIILAKINLPLTLILYSLIPLMIIGASSY-NHKMRQAQKDQRVHVGDLNSTIEDSLLGIRVVKSFGNEEEELEKFQGENVKFLGIKRQFYKSMAGFNTVTKIFDGLMYLVVILGGGIFMIKGRIQPGDLIAYVMYVTTLLTTVRRIVEFTEQFQKGMTGIERFSEIMSEVSEIKDPENPDFDQVRGDIVFDHVDFSYNDHER-VLKDFNLSIQAGENIAIVGPSGSGKTTLCSLIPRFYDVDRGSISIDGIDIRQVKLADLRSHIGIVQQDVYLFSGTVYENILYGKMDASREEVIQAAKLAGAHDFILPQGYDTYVGERGLMLSGGQKQRISIARVFLKNPSILILDEATSALDNKSEIIIQDSLEKLSQNRTTLTIAHRLTTIQNADRILVMTQEGIIEEGNHEDLMALGGEYYKLY... 573
255 0.000e+00gi|373858185|ref|ZP_09600923.1| ABC transporter related protein [Bacillus sp. 1NLA3E]  clstr ali  21  36..TLGRLIVYFKPQKLQLLTVFVAAILSTIFMIASPKVLGKAITKLFEGPGAEVDFSYIGKILLILIGLYIISSLFTYIQQYIMAGVAQKVVYKLREEVNEKLAKLPLKYYDSRTHGETLSRITNDIDNISNTLQQSLTQMITSVITIIGVIVMMLTISXXXXXXXXXXXXXS-FVGTILIAKRSQKYFKAQQKTLGELNGHVEEMYTGHPIVKVFGREQQSIDTFTGINDHLYDSGWKSQFISGVIMPVMMFINNISFVLICVIGGILVTKRTIEIGDIQAFIQYARQFSQPISQTAQIANIVQSTIASAERVFEILDEENIVETGKSDMIENPKGTVTFEHVDFSY-KKDAPLIEDMNIAVKPGQTIAIVGPTGAGKTTLVNLLMRFYELDGGKISIDGVDITSMKHETLRSMFGMVLQDTWLFNGSIHDNIGYGRIGATDEDIYAAARAAHADQFILPEGYDTVLNEEASNISQGQKQLLTIARAILANPKILILDEATSSVDTRTEIQIQHAMDALMEGRTSFVIAHRLSTIREADLILVMNQGSVIEQGSHDELLEQNGFYADLYN.. 612
256 0.000e+00METAHIT MH0006 GL0178441 [Complete] locus=scaffold17156_2:1771:3510:-  ali  22  7..IIKKVLDYIGKYKIFLLLSIILAAISVALTLYIPILTGNAVDCILGPGQ--VDFAGILVILKKMTVIILLTAIVQWLMNACNNKITYQVIRDVRDEAFRKLEILPLKYIDSHAHGDIVSRIIADVDQFSDGLLMGFTQLFTGVITIIGTLLFMISINVTTTLIVVVLTPLSFF-IANFIAKRTFKMSKLQSETRGEQTALIDEMIGNEKVVKAFGREEKVIEQFDEVTKRLEKASVKAIFFSSLTNPCTRFVNSLVYAGVGIVGAFLAIKGRISVGQLSSFLSYANQYTKPFNEISGVVTELQNAIACAGRIFEFIEEEPQIPDADAIVLKQPKGEIDIQDVAFSY-TEDQKLITDLNLHVKPGQRVAIVGPTGCGKTTVINLLMRFYDVNKGSIQVDGVDIRKLTRDSLRKGYGMVLQETWLKSGTIKDNIIMGKPDATMEEVIAAAKASHAHSFILPNGYDTVISEDGGSLSQGQKQLLCITRVMLCLPPILILDEATSSIDTRTEIKIQKAFATLMEGRTSFIVAHRLSTIREADIILVMKDGNIIEQGNHETLLAKGGFYANLYQ.. 574
257 0.000e+00gi|119714984|ref|YP_921949.1| unnamed protein product [Nocardioides sp. JS614]  clstr ali  22  51....RRLIGRMRPDRAQAVVVVLLGVASVALMSSGPRILGHATDLVFDGPGQGIDFTAVGHVLLLVLAIYAGASLLGWLQGYVLNTVVQNTVRRMRQDVEDKINRLPLGYFDRSPRGELLSRVTNDIDNVSQTLQQTMSQLLTSLMTVVAVLGMMFWISPLLALIALVSVPLSLVATAQIM-RRSQGQFVAQWRRTGALNAQIEEAFSGHALVKVFGRREEIERTFAEENEKLYQVSFGAQFVSGLIMPSMMFIGNLNYVAIAVIGGLRVASGSLSLGDVQAFIQYTRQFTQPLTTVASMANLLQSGVASAERVFELLDADEEPLDPAALRTPAVRGEVAVERVSFRY-DEDRPLISDLSLVARPGQTVAIVGPTGAGKTTLVNLVMRFYDVDAGRITLDGVDIAGMPRSVLRGQIGMVLQDTWLFEGTIRDNIAYGRPDATDEQVLEAARATYVDRFVLPDGYDTVIDEEGSNLSAGERQLVTIARAFLTDPALLILDEATSSVDTRTELLLQHAMAALRTDRTSFVIAHRLSTIRDADLILVMEDGAIVEQGTHDQLLTAAGAYARLYNA. 644
258 0.000e+00gi|158423245|ref|YP_001524537.1| ABC transporter permease [Azorhizobium caulinodans ORS 571]  clstr ali  24  13MSLLRAFFAYYRPYKGLFLLDFTCAVVSGLLELGFPMAVKLFVDQLLPGQEWG----LIAAAAAALVGIYLLNAALMAIVTYWGHMLGINMETDMRRRAFDHLQKLSFHFFDNQKTGHLVARITKDLEEVGEVAHHGPEDVFIAIMTFIGAFALMMMVNVHLALITGAIVPVVAWLGAHY-GSRMTENFRALFGRVGDFNARIEENVGGIRVVQAFANEAHERALFAKDNERYRATKLAAYRIMAANMTLNYLGMRLTQVMVMIAGTWFVIRGELSNGGFISFLLLVGVFFRPIEKINAVLEIYPKGLAGFRRYLDLLDTAPDVADPGARPLTGLKDAIRYEHVSFGY-GEGKSVLNDLSLTIRAGETVAFVGPSGAGKTTICSLLPRFYEPTAGRITIDGTDIRDFTLASLRSHIGIVQQDVFLFAGTLRENIAYGRLGATEEDILNAARRARLDGLILPAGLDTIVGERGVKLSGGQKQRVAIARIFLKDPPILILDEATSALDTETELEIRQSLAALSEGRTTLTIAHRLSTIRNADHIIVVSPEGIAEQGRHGDLVARDGLYRRLHDT. 581
259 0.000e+00gi|323486656|ref|ZP_08091977.1| hypothetical protein HMPREF9474_03728 [Clostridium symbiosum WAL-14163]  clstr ali  23  16..TMKRVLQDIGHYRWMVLLSLLLAGITVALTLYIPILIGKAVDLVLAQGL--VNFTGLAVILKHMIITILLTALAQWLMNVINNHITYRVVKDMRIRAFEKIQKLPLKYVDSHQYGEVLSRVITDVDQFSDGLLMGFTQLFSGLLTIAGTLLFMFSINPVIAAIVVVLTPVSLFVAGFIAKKTFY-MFKAQSEARGDMTSLVNEILENEKVVQAFGYEEEASRRFGIINDKLADCSLKAIFFSSITNPATRFVNGIVYASVGVAGAYAAIRGVLTVGQLTSFLNYANQYTKPFNEISGVATEFQNALASAARVFELIDEEPTVTDAGAAAPGQVEGNVSMEHVYFSY-NPEVRLIEDLNLTVKPGERIAIVGPTGCGKSTVINLLMRFYDVDQGTIRVDGTDIRNMTRESLRAGYGMVLQETWLKSASIRENIAYGKPDAAEEEIIEAARKAHAHSFIMPEGYDTVISEDGGNLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEIMIQEAFARMMEGRTSFIVAHRLSTIREADTILVMKNGRIIEQGSHEELLAQKGFYSELYN.. 583
260 0.000e+00gi|223984784|ref|ZP_03634896.1| hypothetical protein HOLDEFILI_02192 [Holdemania filiformis DSM 12042]  clstr ali  20  8....KKFLSYYRPYLRLFIADMVCAFIVAAISLIFPLLTRYITNTVLVSSQ-SVQLDLIFKIGLVMVGLIIIELLCNFFITYKGHYMGAMMEHDMRNELFSHYQKLSFSFYDEQKTGQLMSRLTNDLFSLTELYHHGPEDVVISIIKFFGAFFILLSINVPLTLIIFSILPIML-VFALYFNKKMGKAFKQNKERVGDINARIEDNLSGIRVVKSFTSEGSELEKFGMENNRYVKSRKNSYRIMAYYHSGLNAFTTMITVVVILAGSTFISMKWILLGDLLTYLLYINNLTEPVKKLINFTEQFQEGITGFQRFMEIMEVEPDIQDPHAQILADVEGAVDFEDVGFKYASSPDYVLKHIDLHVEPGEYLALVGSSGAGKTTLCSLIPRFYEVSEGRILVDGQDIRNVTMKSLRSCIGIVQQDVYLFAGNVMDNIRYGRPEASEEEVIAAAKAANAHDFIMPNGYNTDIGQRGVKLSGGQKQRLSIARVFLKNPPILIFDEATSALDNESEKVVQDSLERLARNRTTFVIAHRLSTIRNAKRIVVLGEEGILEQGGHAELMAADGAYAHLYR.. 575
261 0.000e+00gi|374987809|ref|YP_004963304.1| unnamed protein product [Streptomyces bingchenggensis BCW-1]  clstr ali  22  17....RRLLAMLRPERGMALAVLALCAVSVGLSVLGPKILGHATDLIFAGPGQGIDFGAVGTVLMWVTAIYAFSSLLNLFQARIATVVVQRSVFRMREEVEHKLARLPLSYFDKQQRGEVLSRATNDIDNIQQTLQQTLSQLMTSLLTIVGVLAMMFWISPLLALVALVTVPISVVVATKV-GKRAQPQFVQQWKSTGKLNAHIEEMYTGHSLVKVFGRQHESAELFGVQNEKLYEAGFRAQFISGLIQPAMMFIGNLNYVLVAVVGGLRVASGALSIGDVQAFVQYSRQFSQPLTQVASMANLVQSGVASAERVFELLDAHEQEPDAEPARPEQVRGRVEFEDVSFRY-EPDKPLIEDLSLAVRPGQTVAIVGPTGAGKTTLVNLLMRFYEVSGGRITLDGVDIAAMSREELRSNIGMVLQDTWLFGGTIADNIAYGAEGASFDKIVEAARATHVDRFVLPDGYDTVIDDEGSNISVGEKQLITIARAFLAEPAILVLDEATSSVDTRTEVLIQHAMASLRTGRTSFVIAHRLSTIRDADVILVMESGRIVEQGTHESLREAGGAYARLYEA. 621
262 0.000e+00METAHIT MH0028 GL0116807 [Lack 3`-end] locus=scaffold6958_3:3:1745:-  ali  21  15......FLSFFKPHRGLFFLDMACALVVSMIDLAYPIISRYAMRTLLPQSA----YRTFFTIMLIVLAAYVLRSVLYFIITYWGHTFGIRVEADIRAALFGHMQELGFEFFDRNRTGQLMSRMTTDLFEITELAHHGPEDLFISLVTIVGALTVMATIEWRLALVVAVMIPVFIAII-VSRRKAMREASRRVKKKTGAINADIESALSGIRTAKAFANEHVEEEKFDRSNDIYKTSKKMFHREMGIFMAVMEFFTSSLSVAVVTVGGLLIMKGQMDTVDLLTFTLYIASFVNPIRKLANFTELFSNGTAGFERFLEIMRTAPELHDPDALELTHVRGEIGVENVSFSYEDDPE-VLHDVSLHVPAGKTVAIVGPSGGGKSTLCQLIPRFYDVTGGSITVDGHDVRSVTQESLRRSIGIVQQDVFLFADSILENIRYGKPGATMEEIVEAAKRAEIYDDIMPDGFDTYVGERGTLLSGGQKQRISIARIFLKNPPILILDEATSALDTLTEAKIQHAFDELAKNRTTLIIAHRLSTIRAAGEIVVIADGRIDERGTNEELLKKDGIYASLCRT. 577
263 0.000e+00gi|331694196|ref|YP_004330435.1| xenobiotic-transporting ATPase [Pseudonocardia dioxanivorans CB1190]  clstr ali  24  54....RRLAGLLTPHKFGVAVVVALGVISVALNVIGPRILGHATDLIFAGPGAGIDFHALGLVLLGVVVIYLGASVFGYVQGYVLNGIVQRTVFVLRREVEDKLNRLPLSYFDRQQRGEVLSRVTNDIDNISQSLQQTMSQLMISLLSVVGVLIMMFLVSPLLSVIALITIPVSLWLTKTI-AKRSQKQFVAQWRHTGALNGQIEEAFTGQELVRVFGRRREVEASFAAKNEELYQASFRAQFMSGIIMPSMMFIGNLNYVLVAVIGGLRVASGAMTLGDVQAFIQYSRQFTQPLTQIASMANLLQSGVASAERVFELLDADEQSPDPVQPRRKERRGRVAFEDVSFRYVE-DSPLIEDLSLVAEPGQTVAIVGPTGAGKTTLVNLVLRFYELDSGRITLDGVDIAKMARADLRSGIGMVLQDTWLFNGTIRDNIAYGRPGATEEEILAAATATYVDRFVLPDGYDTVIDEEGSNISAGEKQLVTIARAFLADPSLLILDEATSSVDTRTEVLVQRAMAALRSDRTSFVIAHRLSTIRDADLILVMEAGRIVEQGTHDELLAAQGAYYRLYNA. 659
264 0.000e+00gi|153815001|ref|ZP_01967669.1| hypothetical protein RUMTOR_01216 [Ruminococcus torques ATCC 27756]  clstr ali  22  36..ILKKVFGHLGKYRIFVVFSVLLAAVSVALTLYIPKLIGYAVDEII--GKGAVNFAGIFRILFQIGICTGITALAQWLMNVCNNKMTYQVVQDVRNEAFRKIQILPLKYIDNHPSGEIVSRVIADVDQFADGLLMGFTQLFTGAATIIGTLGFMLSVDVNITFVVVLITPISFFVANFI-ARKTFAMFRLQSEIRGEQTGLIDEMIGNQKVVQAFGQEEKVTERFDKINEKLGSAYLRATFFSSVTNPATRFINSLVYTGVGIAGAFAVVNGTLTVGQLTSFLSYANQYTKPFNEISGVVTEFQNAVVCAGRIFELIEEIPQPEDKDAAVLTHVRGHVLAEHVDFSYM-PQQNLITDFNLKVMPGQKIAVVGPTGCGKTTLINLLMRFYDVDGGCISVDGKDVREVTRESLRCAYGMVLQETWLKTGTIRENILLGRSDASEEEMIEAAKASYIHNVILPNGYDTWVTEDGDGLSQGQKQLLCIARVMLCRPPMLILDEATSSIDTRTEVKIQAAFTKLMEGRTTFIVAHRLSTIREADVILVMKDGKVIEQGNHESLMAADGFYRHLYE.. 603
265 0.000e+00gi|160880561|ref|YP_001559529.1| ABC transporter [Clostridium phytofermentans ISDg]  clstr ali  21  46.QAIRKVLRYVKRYWIFLLISLILALITVALTLYVPIEIGKAIDEIVY---GSVNFPVIRDILLRVAIIVGVTAVAQWFMSILNNKVTYEVVRDIREEAFEKIEVLPLKYLDSHPSGEIVSRMIADVEQFADGLLMGFTQVFTGIMTIIGTLFFMLRLNIGITLFVVLLTPISLFVANFI-AKRTYAMFQAQSRTRGEQTTLIDEMLGNEKVVKAYNQEEEVIKRFDEVNERLEKYSLRAIFYSSITNPATRFINAVVYAGVGLTGAFAVIRGTMTVGALSSFLSYSNQYTKPFNEISGVITELQNAIACAARIFELLEEPVEIPDKNAVILTDVKGNVVCNEVNFSY-DKSKKLIENLNLKIHPGQKIAIVGPTGCGKTTIINLLMRFYEVDHGAILVEGEEIRNITRNSLRESYGMVLQDTWLKAGTILENIKMGKEDATREEVISAAKEAHAHSFILPKGYDTVIGEDGGMLSQGQKQLLCISRVMLSVPPILILDEATSSIDTRTEVKIQSAFQKLMQGRTTFIVAHRLSTIQNADVILVMKNGNIIEQGSHEELLAKKGFYKELYE.. 613
266 0.000e+00gi|358064539|ref|ZP_09151110.1| hypothetical protein HMPREF9473_03173 [Clostridium hathewayi WAL-18680]  clstr ali  23  7..TLKRILDYIGAYKWGVLLSLFLALITVVTTLYAPILIGQAVDLIVAPGR--VDFEGIMRILKRMALVICLTGVSQWLMNHLNNIITYRVVKDIRTKAFDHLEILPLRYIDGHPSGDVISRVIADIDQFSEGLLMGFTQLFTGVLTILGTLGFMFFINPVIAVVVVCVTPVSLFVASFI-AKKTYSMFKLQSETRGELTSLVDEMLGNQKVVQAFGHEEEAQVEFEEINERLRGFSLRAIFFSSITNPATRFVNGLVYASVGIVGALAAIRGLLSVGQLTSFLSYANQYTKPFNEISGVVTELQNALASAARVFALIDEEPILPDPDAVKLEKADGTVKMEDVFFSY-NPDVKLIENFNLDVKPGQRIAIVGPTGCGKSTVINLLMRFYDVDSGSIRVTGHDIRKVTRDSLRANYGMVLQETWLKSGTIRDNIAYGRPEASLDEVIQAAKEAHAHSFIMPNGYDTVISEDGGNLSQGQKQLLCIARVMLCLPPMLILDEATSSIDTRTEIRIQKAFLKMMEGRTSFIVAHRLSTIREADVILVMRDGHIVEQGDHESLLRQGGFYAELYN.. 574
267 0.000e+00Gut.JP.Meta  ali  21  16...FRRLLRFMGPYRKGLTISVICIILSSLFNSFGPFVLGRATDALAGLVTGGEEIRRFITILILLASIYILYAFFKYISTVILVRVSQKTIRDLRNDIDRKFQKLPLNYFDTNSYGDVLSRITNDVDTISNSLQQSLEQIVTAVTSVIFILAMMLYISPMLTLIGIVTVPLALVFSMKIAG-ASQKYFKTQQETLGEMNGYVEEMYTGHTIVSAYGTEEETIDEFSETNRTLYDSGWKSQFMSSTMMPVTQGMANLGYVFVVIVGGSFVIDNRMTIGMIQSFIQYLRQFSQPINQTVQIANILQSTAAAAARVFEFIDEREESPDPEHPVPEPVDGSVEFIHVKFGYL-PYHTLMHDVSLEVKPGSKVAIVGPTGAGKTTLINLLLRFYDVNDGEIRVSGINIREMTRKDLRAVFGLVLQDTWLFTGSIMENIRYGRLGAGDEEVMEAARAARADSFILPGGYHFRLQEGATNLAQGERQLLTIARAILSDSPIMILDEATSSVDTRTEVLIQEAMAVLMRGRTSFVIAHRLSTIKDADMILYMEGGDIREVGNHRELMVRDGLYAKLYN.. 588
268 0.000e+00gi|154484348|ref|ZP_02026796.1| hypothetical protein EUBVEN_02061 [Eubacterium ventriosum ATCC 27560]  clstr ali  20  18..TLKKLIKYAGRYRIGIIAVMICAIASATFSIVSPKILGKATTKLAISGTGSIDFGYIGRIIIIVLVLYGISSLFNLVQGFTMSTITQKLCYRLRREIVEKINRMPMKYFESRTYGEVLSRITNDVDTLGNGLNQSVTQLITSSTTMIGVVIMMLTISPLMTLITLLILPVSMIFISFIM-KHSQKYFKTQQEYLGHINGQVEENYGGHLVVKAFGKEQDVIDEFKKTNNVLYNSAWKSQFLSGMMQPIMTFVGNLGYVGVAISGAFLAINGTITIGDIQAFITYVKNFTQPIAQIAQVTNMMQSMMAAAERVXXXXXXXXXDQITENPVPENVKGVVDFEHVHFGY-NPDNIIVNDFNAHVKAGQQVAIVGPTGAGKTTMVKLLMRFYDVNSGEIKLDGHNLKDYNRNELRNAFGMVLQDTWLFKGSIMENIRYGRLDATDEEVIAAAKSAHAHHFILPGGYDFELNEEASNVSAGQRQLLTIARAILADNPVMILDEATSSVDTRTEHRIQRAMDNLMKGRTSFVIAHRLSTIKNADIILVMKDGDIIEQGSHEELMAKKGFYADLYN.. 593
269 0.000e+00gi|194016747|ref|ZP_03055360.1| putative ABC transporter, ATP-binding protein/membrane protein [Bacillus pumilus ATCC 7061]  clstr ali  22  28.KTLLRLIGYLKPRKIQLIIVFIAAVGSTVFNVISPKLLGDATSSLFDSQGTAVQFDVISRIXXXXXXXXXXXXXFSFVQQYVMAGVSQQTIAELRQEANDKLTRLPLRYFDKTTHGDTLSRVMNDIDNINTSLQQALTQVITSVITVIGIVVMMLLISXXXXXXXXXXXXXSLFAIRGITS-FSQKHFKAQQKELGMINGHINEMFTGHQTVRAYGYEKKAIDTFDQLNEQLYESSRKAQFISGLMMPLMTFIGNLGYVAVSVAGGILVINGNIRVGDVQAFIQYTQQMSQPLVQASSVANLVQSAIASAERVFEILDEKEESPEEDAIDLESLSGDVSFEQVQFGY-EKDHPIIKDLTLDVKEGQTVAIVGPTGAGKTTIINLLMRFYELDQGSIRIGGVKTTDLSRQQVRDLFAMVLQDTWLFEGTIHDNIAYGRQNVSKEDVIKAAKHAYADDFILPDGYDTLLTEDAGNLSQGQRQLLTIARAILSDPKILILDEATSSVDTRTEMHIQKAMNELMKGRTSFVIAHRLSTIKDADVILVMKDGTIIEKGTHSELLKQNGFYADLY... 599
270 0.000e+00gi|256395072|ref|YP_003116636.1| ABC transporter [Catenulispora acidiphila DSM 44928]  clstr ali  22  145....RRLLAYLRPERPILIVSMVMAAIGVGMSVWGPKLLGKATDLIFAGPGHGIDFTKVGHVLMILAGLYVLVFVCMMIQSRLVIIVVNRAMARLRTDIEAKLSRLPLSYFDKQPRGEVLSRATNDVDNLAQSLQQSLAQVVMQVFTLLGVMVFMIWTSWLLALIAIAMVPLSVFVAGRI-GKRSKPQFVKQWAATGRLNAHIEEMYTGHQLVKAFGRQEEAAAEFKKQNDVLNDASFKAQFISGLIQPTMMFLGNVTYVLVAVVGGLRVSAGALSLGSVQASIQYTRQFSMPLSQVAAMANMMQSGVASAERIFQILDAEEMSPEPAQPELERVQGRVEFRDVNFSY-SADRPLIEDLSLAVQPGQTVAIVGPTGAGKTTLVNLLMRFYEVDSGAILLDGVDTAEMSREYLRTQTGMVLQDAWLFGGSIADNIAYGTQGASIERIKAAAAATHVDHFVLPDGYDTVLDEEGSNLSAGEKQLITIARAFLAEPAILILDEATSSVDTRTEVLIQRAMNKLREGRTSFVIAHRLSTIRDADMILVMENGRIVEKGSHVQLLDADGAYSRLYAA. 755
271 0.000e+00gi|224543727|ref|ZP_03684266.1| hypothetical protein CATMIT_02940 [Catenibacterium mitsuokai DSM 15897]  clstr ali  23  5.STLKRLMAFCRPYRIYLVGALLFSTINIIFTLLTPILIGKAIDQMICYHQ--VFFQGLSQKIFSIAFSVLMTALFNYFLVRASNKMTYEITRDLRTELFKQYQILPLSYIDSHTHGDMMSRMIADIDQISDGLLQGFTNLFGGIATILGTIGFMLYVNVKLALIVIVLTPLSLIVATLI-AKYTFKFFQEQLSIRGEMSGFVEEMVGNQKVVKAFQHESINEEKFDEINDRLFKSGVKSQFLGALANPSTRFVNAIVYDTVCIYGAFSVIGGGLTVGGLSSFLTYANQYTKPFNDISNVFTELETALACAERVFKIIDE-PAIKNPEHPEIDNPQGVIDLNNVNFSY-TPERPLITDFNLHVNAGETIAIVGPTGCGKTTLINLLMRFYDPQSGSISIDGINTQTMDRSYLRSLYGMVLQDTWLFKGTIRDNIAYGSNNATDEEIIEAAKKAHAHKFILKGGYDAMLAEEGSNLSQGQRQLLSIARIMLANPPMLILDEATSSIDTRTERQIQDAFDTMMIGRTTFIVAHRLSTIQKADQIIVMNDGHIIEQGKHEELLKKNGFYHNLY... 571
272 0.000e+00gi|323487039|ref|ZP_08092348.1| hypothetical protein HMPREF9474_04099 [Clostridium symbiosum WAL-14163]