current user: public




Query: [R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPLast
1 -105.000[R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins  ali  100  1MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP 224
2 -9.290[S] COG3863 Uncharacterized distant relative of cell wall-associated hydrolases  ali follow..  1MKLKKRVSMFLVALTMCGGLFVTPAKAVKTTNYAEEIAALQPGTTPEEIMKSASQIAKQQHVKQDVILKQFYKEITADKAEGDRLAKESGMSIMGGSSGTKKLPTSAKGN--IYYTNSYTAYYNHGHVGMYSAADKIVESVPSDGVRQIAYNARDVEDNSIVQTVSVSSSQKTAAADWAVSKVGDPYSFNFVNNRNTGHDGAKNCSWSA----FLLKAIDIDSP 229
3 -9.190[S] COG3521 Uncharacterized protein conserved in bacteria  ali follow..  20  1MNEWRNPTRWLCAVAMPFALLLLS----GCGSSDALPDLESQRLDLSVKA---SDKVNPDNQKKAAPIEIRVYELKNDAAFTTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKS................................................................................................... 133
4 -8.520[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  16  1MRKGCFGLVSLALLLLV-----------GCRSHPEIPVND--EQSLVMESSLLAAGISAEKPVLSTSDIQPSASSTLYNERQEPVTVHYRFYWYDARGERPRSVTIPAHSAVTLYGSANFLGAHKVRLYL.............................................................................................. 123
5 -8.360[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  1MKPWQPKALWQIVGGAALAVSLT-----GCAHQSAEAPVA--VAQSTVHGTVNIRERVALPPDA-------VVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLQPNARVIVSAAITRNGQL.................................................................................................. 130
6 -8.350[R] KOG4377 Zn-finger protein  ali follow..  15  302........................RFNEDCGCGYRNHQSHFCHYSFCDKTRFVQHTARHERMD--------TLMGDDFRQFRANMQCGVASCGYATASGAATETNHLSRIDPTEAVTASSRKTSHFHCRKCDYVTDSNKVVAHRRLHLRQDYVRNAGFR---------KVGGNEQC------SPGCSYAQRHTHYHC-----VTCDGSRAQLAAHKHRTGFPKQ 487
7 -8.200[S] COG4461 Uncharacterized protein conserved in bacteria, putative lipoprotein  ali follow..  11  1MRWIGVLVTALVLSACAANPPANTGQSLDCTKPATIVQQLVCHDRQL-----------------------TSLDHRLSTAYQQALAHRRSAALEAAQSSDACAQDTDPRT--------------------C-----VQEAYQTRLVQLAIADP....................................................................... 115
8 -8.110[R] COG3895 Predicted periplasmic protein  ali follow..  17  1MKNSYSALWGRPAKVVLVALILG-----GLGLAIPSYAQETCSP-----TETLTIKMVEGSAIQVTLPDGRTVVLPQAESASGNKYSNGFITVWSKGNTAL-------------------EEGGNVKWQDCVKI.......................................................................................... 110
9 -7.920[C] COG0348 Polyferredoxin  ali follow..  12  82......TMTALLGALIVVVLYAILGSRVFCACPLNIVTD--------ASAWLRRKLEIRQSAKLPRSLRYAILVMILLSALSGLLLWEWLNPVAALGRALIYGFGATVWLVLAVFLFDLFIVEHGWCGHLCPIGAAYGVIGAKGLFRIKVEHRQQCNCMD-------CYNVCPEPQVLRDPLHAKKSESPLVLSKDCIS---GRC................... 267
10 -7.780[M] COG3133 Outer membrane lipoprotein  ali follow..  10  1MIKRVLAVSLMGLSLA------------GCVNNDSLSGDVYTASEAVTYGTIVNVRPVQ---------------------IQGGDDSNVIGAIGGAVLGGFLGNTIGGGTGRSLATAAGAVAGGVAGQGV-------SAMNKTQGVELEIRKDDGNTIMVVQ.............................................................. 128

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.