current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

KOG4745
Query: [R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPLast
1 -109.000[R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins  ali  100  1MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP 224
2 -11.000[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  1MKPWQPKALWQIVGGAALAVSLT-----GCAHQSAEAPVA-SVAQSTVHGTVNIRERVALPPDA-------VVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLQPNARVIVSAAITRNGQL.................................................................................................. 130
3 -9.050[C] COG0348 Polyferredoxin  ali follow..  12  82......TMTALLGALIVVVLYAILGSRVFCACP-------------IVTDASAWLRRKLEIRQSAKLPRSLRYAILVMILLGSALSGLLLWEWLNPVAALGRALIYGFGATVWLVLAVFLFDLFIVEHGWCGHLCPIGAIGAKGLFRIKVEHRQQCNCMD-------CYNVCPEPQVLRDPLHAKKSESPLVLSKDCIS---GRC--------IDVCPEKVFI. 277
4 -8.010[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  232.............................CDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGRPGCGAGLLPEPDQRKVTCEGGNKEAYHEGECSAVFEASGTTTQAYRVDERAAEQKPCRCHV--------PVEKNGGC----------------MHMKCPQPQ---CRW................. 419
5 -7.790[R] KOG3813 Uncharacterized conserved protein (tumor-suppressor AXUD1 in humans)  ali follow..  10  71..................VTVYYFARRQGFTSVPSQAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGL-TLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREEGCDCR-LYCDPEAC------ACSQAGI-------KCQVDRMSCSRDG---CGNMAGRIEFNPIRVRT... 267
6 -7.640[S] COG3521 Uncharacterized protein conserved in bacteria  ali follow..  15  1MNEWRNPTRWLCAVAMPFALLLLS----GCGSSDALPDLESQRLDLSVKA---SDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRSFILRPGEEKKLRRPLNAQTTAI----GVLAGYRNLAKSVWRVT............................................................................ 138
7 -7.510[M] COG3040 Bacterial lipocalin  ali follow..  1.......MRLLPVVAAVTAAFLVVACSSPTPPKGVTVVNNFDAKRYL--GTWYEIARLDHRFERGLEQVTATYSLRDDGGINMWQKTEGKAYFTGSPNRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWPTLSEEIKQQMLAVATR--GS.................................................................. 177
8 -7.050[M] COG3065 Starvation-inducible outer membrane lipoprotein  ali follow..  1MTQSKKFRNHKWMYGWLGLGALLLS---GCVTIPPAIQKLFIGQEARFGGTVVNVKNEPNRTRLE------IASVPLDSGARPILGEPSQGRVIAYVDG----LEPVDFRGHLVTVVGPIVGVEAGKIGMTPYNFVWHIAQQ.................................................................................. 156
9 -6.960[S] COG4731 Uncharacterized protein conserved in bacteria  ali follow..  44ANREISMIRTAMIAATALAASLAASAPAFAA-PGNGGQVEISRCGNSLCGKLVTSDHIKTNPGLKDIKN------DESQRSRTLKNLQMLYDFSGGPTKWTGGKVYNPEDGGVYAGTIELVSTTELKLKGCCKTQKWTRIR................................................................................... 191
10 -6.700[C] KOG3458 NADH:ubiquinone oxidoreductase, NDUFA8/PGIV/19 kDa subunit  ali follow..  15  22...........................................................................................................................................LSSAALRAGAFHLGKQCECRQELDDPRACLAEGKTSCALD--FFRKVKKTCHEEYATCLDKSSGTC--RKTQGVFDKCIKDNFD. 119

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.