current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

KOG4680
Query: [R] KOG4680 Uncharacterized conserved protein, contains ML domain, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPATFTISANTGREISFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHSQVLPGYTPPGSYLLKMKMLDAKKKELTCIKFSFDIGLRASVADILast
1 -68.700[R] KOG4680 Uncharacterized conserved protein, contains ML domain  ali  100  1MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPATFTISANTGREISFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHSQVLPGYTPPGSYLLKMKMLDAKKKELTCIKFSFDIGLRASVADI 153
2 -8.720[Q] KOG1263 Multicopper oxidases  ali follow..  12  1MKGGVKLLAVCLCVATATVMMVQAE-----DPYFHHVWNVTYGTASPLNSTSNNNVIVNV-------FNNLDEPFLITWAGIQHRKNCQDGTAGTMCPIPPGQ-NFTYHFQPKDQIGSYFYYPTTAMHRAAG..................... 138
3 -8.440[T] KOG3205 Rho GDP-dissociation inhibitor  ali follow..  16  89..................................DLTGDLESFKKQSFVLKEGVEYRIKISFRVNREVSGMKYIQHTYRKGVKIDKTDYMV--GSYGPRAE-EFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKD...... 201
4 -8.000[S] COG3397 Uncharacterized protein conserved in bacteria  ali follow..  10  109.............................CSAGDKAKAGLNHWQKTGITLDANGQIEVVFHAATPHNPSYWQFYLSKATYD-PLTWDDLELVGSSDDVAAGSDKKYRFKVTLPQDRSGDAILYTWQRVDAGGEGFNCSDITFGGTTTPPDPT. 239
5 -7.830[S] COG1470 Predicted membrane protein  ali follow..  12  607................................................TITAGEEKTAMMDIFNFGNAPLTNLKITVKG--------DVKVDPSQIPSLSPKG-RVTITVKVPEGTPAGDYRVQITVKADQAEWQDTLRVVVRQRSTSTYIGV 708
6 -7.700[R] COG2372 Uncharacterized protein, homolog of Cu resistance protein CopC  ali follow..  11  3IRKVRSSCRMLSALIVLFVGLSSQQALAHAHLKAETPAADTTINAAPE--------ALTLGFSEG---------IELNFSGVKVTGPDNNVVKTGDLKLDPANNT-QLILPIGHALAAGKYHVSWHVVSVDGHKTK-YSFTVK.......... 128
7 -7.480[S] COG4929 Uncharacterized membrane-anchored protein  ali follow..  13  1MLKRKWLSIAVIIVALIMVNISIYQKQHLLAKGDIIILELAPVD--PRSLMQGDYMALSYALV.......................................................................................... 61
8 -7.380[KB] COG5137 Histone chaperone involved in gene silencing  ali follow..  18  4.....................................VNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPDLLPQLSDVLGVTVI......................... 96
9 -7.360[S] COG4704 Uncharacterized protein conserved in bacteria  ali follow..  12  1MRKKWAVSLILLTTLGNLAWSWSARA----NFNGKLTVEIDGL-----------------------KNKQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFN-----NLKAGTYAVAA-IQDLNGD.................... 100
10 -7.100[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  1MKPWQPKALWQIVGGAALAVSLTG-----CAHQSAEAPVAAPISTATVAASVASTVHGTVNIRERVALPP-DAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPS-PNARVIVSAAITRNGQ..................... 129

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.