current user: public




Query: [R] KOG4680 Uncharacterized conserved protein, contains ML domain, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPATFTISANTGREISFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHSQVLPGYTPPGSYLLKMKMLDAKKKELTCIKFSFDIGLRASVADILast
1 -70.200[R] KOG4680 Uncharacterized conserved protein, contains ML domain  ali  100  1MSRIFAILPLAAVFLLLLVSPIVAIDVHYCEENAEYEVKVKEVDISPNPIAPGEPATFTISANTGREISFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHSQVLPGYTPPGSYLLKMKMLDAKKKELTCIKFSFDIGLRASVADI 153
2 -9.720[KB] COG5137 Histone chaperone involved in gene silencing  ali follow..  14  2...................................SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADLPQLSDVLGVTVILLSCAYEDNEFVRVGYYVNN......... 116
3 -9.540[R] COG2372 Uncharacterized protein, homolog of Cu resistance protein CopC  ali follow..  11  3IRKVRSSCRMLSALIVLFVGLSSQQALAHAHLKAETPAADTTINAAP------EALTLGFS------------GIELNFSGVKVTGPDNNVVKTGDLKLDPAN-NTQLILPIGHALAAGKYHVSWHVVSVDGHKT.................. 119
4 -8.780[KB] KOG3265 Histone chaperone involved in gene silencing  ali follow..  12  3...................................SRVNIVQVQILDNPAMFVDKFKMEITFEVFEHLPHDLEWELVYVGSGTSRDFDQVLDSALVGPIPEGRHKFVFDAEHPSKIPVVGVSVLLLRCKYNDQEFINMGWFVAN......... 116
5 -8.690[T] KOG3205 Rho GDP-dissociation inhibitor  ali follow..  18  93......................................DLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK....... 200
6 -7.520[S] COG1470 Predicted membrane protein  ali follow..  12  607................................................TITAGEEKTAMMDIFNFGNAPLTNLKITVKG--------DVKVDPSQIPSLSPKG-RVTITVKVPEGTPAGDYRVQITVKADQAEWQDTLRVVVRQRSTSTYIGV 708
7 -7.510[S] COG4704 Uncharacterized protein conserved in bacteria  ali follow..  11  1MRKKWAVSLILLTTLGNLAWSWSARA------------------------NFNGKLTVEIDGLKN---KQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTF-----NNLKAGTYAVAAIQDLNGDGTL.................. 103
8 -7.080[Q] KOG1263 Multicopper oxidases  ali follow..  13  1MKGGVKLLAVCLCVATATVMMVQAED-PLGVPQQVILIN-------PGPSTSNNNVIVNVFNNLDEP-------FLITWAGIQHRKNCQDGTAGTMCPIPPGQ-NFTYHFQPKDQIGSYFYYPTTAMHRAAG..................... 138
9 -7.000[R] COG4574 Serine protease inhibitor ecotin  ali follow..  13  1MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKL--YVFDKVSSPVSTMMACPDGKKELRYNSKLPIVVYTPDN-VDVKYRVWKAEEK.................... 155
10 -6.820[S] COG4929 Uncharacterized membrane-anchored protein  ali follow..  13  1MLKRKWLSIAVIIVALIMVNISIYQKQHLLAKGDIIILELAPVD--PRSLMQGDYMALSYA............................................................................................ 59

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.