current user: public




Query: [K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPFLast
1 -117.000[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali  100  1MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF 390
2 -77.600[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  34  2..........................MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGS---------NYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNE...... 398
3 -52.400[K] KOG1168 Transcription factor ACJ6/BRN-3, contains POU and HOX domains  ali follow..  14  151..LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL----KPILQAWLEEAEAQAKNKREKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFG.............................................................................................................................................................. 388
4 -50.800[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  14  31ACTICKRPFPPGDAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFI--TGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYL-QGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIP--------KVKAIYDIERPDLITYEPFYTSGYDDERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSLPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHRALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSF.. 423
5 -36.000[TZR] KOG1704 FOG: LIM domain  ali follow..  23  178.............................NIFDFQVIFGDECLEAEGRSWHFHHFQCAQCNDVLADQKYMRANKPVCLKCFHSSSSTSCTTCRLSFSSDTPHMSQGDLHWHAECFCCCVCSKNL--LGVKYSRVGESLFCGYQTCGGEDEELLDEDR......................................................................................................................................................................................................................................... 307
6 -33.300[TZ] KOG2272 Focal adhesion protein PINCH-1, contains LIM domains  ali follow..  26  199...........................PICGACRRPIEER-VVTALGKHWHVEHFVCAKCEKPFGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI--GGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY-EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKN................................................................................................................................................................................................................................ 334
7 -33.100[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  29  471........................NTLEQCNVCSKPIMER-ILRATGKAYHPHCFTCVMCHRSLDGIPFTAGGLIHCIEDFHKKFAPRCSVCKEPIMPETVRIVALDRDFHVHCYRCEDCGGLLSEGDN-CYPLDGHILCKTCNSARIRVLTAKAST......................................................................................................................................................................................................................................... 610
8 -19.000[K] KOG2252 CCAAT displacement protein and related homeoproteins  ali follow..  10  260..LSSVISTPTISSSNIPTPPSAHIAQPRRIYSTQDSNDPLNAEIGDDIYIDTKDLCKRIAFELKNHSIPQ--AIFAERILCRSQGTLSDLLRN--KPWNKLKSGRETFRRMYNWVAQPLATRLAILDMKTEDVNRA---NVRTHRRSTSDHDGPVSKRPRLVFTDIQKRTLQAIFKETQRPSREMQQTIAEHLRLDLSTVANFFMNARRRSRLGGNIDEPTPFQQVKNISPPPVGDTSDALLNGDDHVPLLNTVMAEMYKEGAIATSNHSAEQREMIERGFGVSIPGPSHSGELLNGDSHEDDEELDELNDSELAYEEDVEIGDEEEEDEEQANGDILPTPKVEELEEKTVIKEEAPDDGEYGATKLA..................... 630
9 -18.900[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  16  727..KNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGER--ESFTEEGLDLHYWKHCTRCDHCKQVVEISSLTEHLLTECKDGF-----GKCYRCSEAVFKEELPR-------HIDC-RCPLCHENFSPGEE-LMGPAG---CTMN----------------LRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKI.................................................................................................................................................................................................... 907
10 -15.700[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  17  288......................QPEELVSCSDCGRQFTPVMMAAVKTYRW--QCIECKCCNI--------------CGTSENDDQLLFCDDC--------------DRGYHMYCWSCHLCLDLLKEKAS..................................................................................................................................................................................................................................................................... 383
11 -15.400[K] KOG2251 Homeobox transcription factor  ali follow..  17  43.........................................................................................................................................................PRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKF 294
12 -15.300[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  12  21..GVANTTTDNAAVKPEALESYTGNDDNACVVCFKNVE----IFSIGDCDHPVC-ECPICRHVLSKVLFTLDKL-LYSKKYRIGFCTPCPKCDAPPYRTFEGLRNHVRSEH--CVECEYCNKRYVDRDELFLRRE---FCDADGCNEFYNDYADLAEHFRAEHFLCEEGKCATEQFVGAFRNEIEYKAHVANVHGKSLNKQQA--QTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARAAQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKPQVDFPALPGK.......... 479
13 -14.300[R] COG5048 FOG: Zn-finger  ali follow..  545......................MPDKTFECLGCTKTFKRRYNIRSHIQT-HLE-YSCDGCDKAFVRN-LIRHKKSHQEKAY------ACP-CGKKFNREDALVVHRSRMICSG-YENVVIKRSPRKRGR..................................................................................................................................................................................................................................................................... 652
14 -14.300[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  37..KQKKNNLSAEPNLTTSSADDTDEENELCVICARKLT----YVSLTPCHHKTCHICGICRTENEEVMFTDRID-LSKDEQVCDFGSICLICKHAFPCELEIFTQNQLRNHQTCEKCHICDKMNPASPQYF--KHSHYVCELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPP.......... 579
15 -14.300[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  12  208..................................HRLPKSMLKKLPVLRYTKN--TCVIC---LED--FIEDDKL------------RVLPC--------------SHPYHTHCIVCPICKRKVFTKGEARASRSR--------QPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLASTVRPATSSGAHERINPFDRAPNLPAHLAEQLTESRRSVWSRINFASFFRRQPAVISVAAPPYLERVESGTSAMGLPVTGTIAVASPASNNILNPNLSGSFKDEDDMPPHRSIYEPIAISTPAADSATVDDSAFLQTPTQGGIGVAALPHSASDR----QF 534
16 -14.000[K] KOG0486 Transcription factor PTX1, contains HOX domain  ali follow..  14  89.........................................................................................................................................................KKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYA........ 319
17 -13.700[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  12  3.............................CESCG-----EFTVFRRKR-------ACFDCK------------RYYCANCIASR---RCKRCQRPLSRTDLLLKPKDLIFYLQ-ISTEGCLEK----EELV-----GLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSS...................... 313
18 -13.400[K] KOG0484 Transcription factor PHOX2/ARIX, contains HOX domain  ali follow..  22  87.........................................................................................................................................................KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGL------------------------------------ASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTN----F 284
19 -12.800[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  20  56......................IKEAAPKCNNCSQR--------------HLDC-ICSYCGAHYSRHCPKAIQCSKCDE--HKWKKVQCTLCKSK---------------HSRC-YCYNC------GGKGHFGDD----CKE........................................................................................................................................................................................................................................................ 179
20 -12.800[R] KOG0494 Transcription factor CHX10 and related HOX domain proteins  ali follow..  34  124................................................................................................................................................SSGGGGKASKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTEKTWGKST....................................................................................................................................................................... 202
21 -12.800[R] KOG2893 Zn finger protein  ali follow..  13  6...........................................KKQLKPW---CW--------------------YCNRDF----------------DDEKILIQHQKAKH---FKCHICHKKLYTGPGLAI--------------------------------HCMQVHKETIDAVPNAIPGRTDIEEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSN..... 274
22 -12.700[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  15  5............................QCDDCGENLKKPRLPR------HMMCFSCIDCGNMFGQVSVHYHNQ--CITEAEK-YGPMVRSNGESSKQKHDFDINAELF-----WFCSLCNATMTCEQDYFAHVYGK--ANEVADMDYSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDINATSEQTLLAHA-----NGKKHRVKVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINV.............................................................................................................................................. 216
23 -12.400[R] KOG3138 Predicted N-acetyltransferase  ali follow..  2.................NRPSNWDDPQGPCRYCESPVEDDNYLECQERMVHIKCLPHACTPGDLLGDVF---------------FEFTCVKCVLD-PIKEVIVRQR-LVLTLTLYNLSIKQKGLGHHGFFHWRTHIISFVDKNWNYIFGPNVRRRKQGSVSGALSHNSPEYFQSGLDVFQENG-KLAKPFQTPRSVLKEYEKKQQLRLQMRIEKRLPAADETSCSSEISVADHAQDNPPLIKAEAEKPSSTEGCARTIPYMGRLPKIQTQPSPLSQETLPGPPILQENIAPPSQKEEEPQNQPMSMVQAGLMDFLAESLESDDFTMFGNLPGIMPPPLIGAGKNDFFMTEPLLHAPLNNEGLFDMDTNFAIPNTADETKP.......... 368
24 -12.200[R] KOG4299 PHD Zn-finger protein  ali follow..  239..EGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPCCET------PNSFHFTCIDCNECKHHCTYIDSHNPIQFHLPHSISSFF-LACDYC--------------NSYWHPDCL-----NPPLAT------SNLRKWKCPNHSDHVTPRYRLPEKAKVIRVGLPRGFKNKGNIVIDENEDEPSVQTIQLQGKI-VPSKPFKLNFLEQIRDNVINLRKMVEQDEQLCIETFSKFDFYATRDCELPLRILCDVANDNLENDDYVLA............................................................................................................................. 579
25 -12.000[R] KOG4377 Zn-finger protein  ali follow..  15  323.............................CNDCHYSFCDKTRF-VQHTARHERCFHCRKCDYVCTDS-VVAHRRLHLRQDYVRNAGGGNEQCDSPGCSYAQRHT------H---YHCVTCDGGVLSRAQL.................................................................................................................................................................................................................................................................... 475
26 -11.900[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  15  5....................................................KCPKCYEHRVNVCEFCLVDNHPNCVVQSYLT-YDPNCSLCKTTLAEGDTIRLNCLHLLHWKCFRCPCCSQEVFPPIN..................................................................................................................................................................................................................................................................... 109
27 -11.700[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  12  124.CGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRT-HNQGCECQFCGKRFSRPWLLQGHI---EKPF------KCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFAL--KSYLYKHEESSCMKN-RGGVPGSGAASGNRPPSSPKRQQAEVTSGTISALAPGS................................................................................................................................................................................................................ 296
28 -11.600[R] KOG1280 Uncharacterized conserved protein containing ZZ-type Zn-finger  ali follow..  13  529............................EDDGASDS--------------DFSDECGSEC-----GQCFDEGRNIYHRSFLDKFFS-NCVFCKKRFSAEELQLHLSEM--HSNP-LTVMLER-MRQED...................................................................................................................................................................................................................................................................... 639
29 -11.500[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  15  172...........ANLIPGKARAEYGEQRQYCPVCGSMPVSSMVQIGTTQ---LRYLHCNLCETE-----VVR---------------VKCSNCEQSGKLHYWSLDDEQAAIKAE--SCDDCGTYLKILYQ..................................................................................................................................................................................................................................................................... 267
30 -11.300[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  13  4......................................................IQCNHCGIKPNQTKLY------CGHVF-------CQNC---------TKAAFNS-------QCYLCKKPLKVDE---INKNLRPDLMELFKDPRQLASDLVNELKQVVAFQAKQREIYVKCKNAEAKKDTERFAEARSKHVEKTQEIEKRKKAFLEDNVKLKNAKEEKNQLMARLKELREQPSQNLSVNKRRSNTRTEPPFSKISRTGPPSVMRKASHEFSLNLRDQSTSKILTSTPLSNIDYSRRDHRNRLFGAGLEHPSPILR....................................................................... 239
31 -11.300[S] KOG4623 Uncharacterized conserved protein  ali follow..  15  43.............................CWFCNG---NVRVPYQDRNSW-----TCPSCEQ------FTKDG------DYNRDITSQCDQCAQRLKVEKLSRERLEKQFRL----CSSCERHVNK----VLHEKKKMVLSSKFLNYIIKGASLLKQPHFNRLAAAQK.............................................................................................................................................................................................................................. 214
32 -11.200[R] KOG3002 Zn finger protein  ali follow..  15  30..ANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYP--IHQCPN---H---TLCSSCKLRVQNTC-------TCREKVAESLEVPCRGCQDIFPYYSKLKHEQHCRFRSYSCPYSECS----TGDIPTLVDH............................................................................................................................................................................................................................................................... 164
33 -11.200[K] KOG0844 Transcription factor EVX1, contains HOX domain  ali follow..  14  180.........................................................................................................................................................SDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAA-----------SAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPL 405
34 -11.200[O] COG0068 Hydrogenase maturation factor  ali follow..  12  91.............SVSGVVRTEITPDAATCPECQREIFD------FSRFYRYPFTNCTHCGPRLS---------IIRAIPYDRCNTSMCPECEDSYH------DVENRRFHAQPVACHTCGTLLQKGEIVAIKGIGHLACDATQEAAVEKLRQRKRRYDKPFALMARDINVIEKYCFVNDRERELLVSPAAPIVLLEKR............................................................................................................................................................................................... 291
35 -11.200[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  19  249LLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCR----HL-CL-CTSCADTLRYQ------------------ANNCPICRLFPGPPADPGGAEEA.......................................................................................................................................................................................................................................................................................... 332
36 -11.200[R] KOG3608 Zn finger proteins  ali follow..  13  179.WAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFD-----HLR-FQCAQCFKFFATKKLLKSHVVRHVNCY------KCTMCDMTCSSAS--LTTHIRYRHLK-LKCSECDTRCVRESDLA-HSKTVHQCE......................................................................................................................................................................................................................................................... 321
37 -11.100[K] KOG0485 Transcription factor NKX-5.1/HMX1, contains HOX domain  ali follow..  27  116.........................................................................................................................................................DDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQ................................................................................................................................................................ 192
38 -11.100[K] KOG3815 Transcription factor Doublesex  ali follow..  26  1.MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNH---GVLSWLKG---HKR------CR---------KD----CT----------CEKC---IIERQRVMAAQ-----------VALRRQQANESL..................................................................................................................................................................................................................................................................... 83
39 -11.100[O] KOG0802 E3 ubiquitin ligase  ali follow..  14  340..................................GALHAAL-LRAYDD-------ECAICREPMAKA-----KRLHC-----------------------------NHLFHLGCLSCPTCRKPLFVGRT-------------ENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQT-----WSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVPDEIIFQVNFKCILDYL............................................................ 594
40 -11.000[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  18  13..SLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVS-----------YHYGLLTCESCKGFFKRT--VQNNKRYCIEN---------QNC--------QIDKTQRK----RCPYCQKC---LSVG....................................................................................................................................................................................................................................................................... 104
41 -11.000[T] KOG3575 FOG: Hormone receptors  ali follow..  14  9..NMLQSDHALIMSSFPEPSPSSKRPTENCKVCGDRPNND----------RYGASACLGCTVFFRRA-VVKNLKYKCMKE------QNCL----------------SCTYRNACRYCQKC---FAVG----MHSSA.............................................................................................................................................................................................................................................................. 105
42 -11.000[K] KOG0850 Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains  ali follow..  28  126.........................................................................................................................................................PKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMA............................................................................................................................................................ 206
43 -10.900[O] KOG0800 FOG: Predicted E3 ubiquitin ligase  ali follow..  18  74..............................LGLSKELREMLPIVVFKESFTVMDSQCSVC---LGD---------YQPNDKLQQI--VC-----------------KHTFHMDCITCPLCRLALIPSRS..................................................................................................................................................................................................................................................................... 150
44 -10.800[O] KOG3579 Predicted E3 ubiquitin ligase  ali follow..  17  452..AGNTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCS--RQSIKQQ----SGEVYCPS------GEKCPLVGSNVP----------------AFM----QGEIATAGDVKVKKE............................................................................................................................................................................................................................................................... 557
45 -10.800[O] KOG1815 Predicted E3 ubiquitin ligase  ali follow..  118..........TVGILESHVVPPSDDSELTCGICFDSYPPEKIASVS----HPFCTTCPSCLAAVGHDMYIEDNRLEIFAGMILANSKPCPRCKRPIEKNQ----------HMTCTPCWLC---LGAWMDHGERTGGFYACNRYEVAKQEGQSRQKAMADLQQAQMQNVRLVMFFRILLLSESLRLFISKLSDKQCTPESQLKFILEAWLQIIECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCVEKDLVQFLIAEGPSKDFNDFRTKLAGLTS-KALENGLADVDSHAACSSKSTSSKSTGCSSKTRELVDPRQGTKPELIVCNCTMHTLEEKPKLHAHSGILILLSCVYAIWIIGFVTSFLLMSVKEYEKPIKSHF 562
46 -10.700[K] KOG0483 Transcription factor HEX, contains HOX and HALZ domains  ali follow..  16  53............................................................................................................................................DGSLEDLGGVGHASSTAAEKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEANQSVMANNEVLELSHRSPSPPPHIPTDAPTSELAFEMFSIFPRTENFRDDPADSSDSS......................................................... 245
47 -10.400[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  11  12....................................................ACLSCSICD-------ILRDATTISE---------KC------------IYEKITE----EIETCPVCNIDLGSTPLEKLRPDHNL--KRRKVKAPGIVSLPGKRKERSISSLVVSTPMVSAQAGTTRRRTKAPTRKELRNGSLAERTVK---KEESSGDELLESTSSPDTLNKFTQNKRQSKKSCKESISNKENKDGDEPWDSKMDWKPLNFLVEVANGTKPLKSSASQGSGSKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDESSAKQERRNGPGGTSLPQIPANFLRIRD.... 332
48 -10.200[R] KOG1312 DHHC-type Zn-finger proteins  ali follow..  109..AEDSKDHKSGSTEEYPYDYLLYYPAIKCSTCR--------IVKPARSKH--CSICNRCVLVADHHCFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFLQLAIVKEMTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEIP................................................................................................................................................................................................. 320
49 -10.200[S] KOG4367 Predicted Zn-finger protein  ali follow..  11  2.....................EEMEEELKCPVCGSFYREPIILPCS----HNLCQACASPNGVRVFPPAMPPPATHLSAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLECEQCDVCTDHELENHSMYCVQCKMPVCYSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQ---RNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKEN................................................................................................................................ 377
50 -10.100[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  24  320.......................................................ECVIC---LES--FTKGDKV------------VALPC--------------KHEFHRPCIACPTCNTEVPPPKPF.................................................................................................................................................................................................................................................................... 372
51 -10.000[K] KOG0843 Transcription factor EMX1 and related HOX domain proteins  ali follow..  27  321...........................................................................................................................................................QQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAES.............................................................................................................................................. 413
52 -9.980[R] KOG0804 Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein)  ali follow..  10  241..........TTSNDLFSSDDTSLTELPTCAVCLERMDDSVLAILCNHSFHARCLECPVCR--------------YVQSPEVVA-EQRCNDCG-----------MSNDLW---CLICIGCGRYAEQHAQRHWELTSHTYSLKDYAQRESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVENLEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQ........................................................................................ 539
53 -9.950[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  10  510.CKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLV-HTG-HRCDICDKRFSSTSNLKGQKPYCDAKFTQY-NERCGTCGKKYISPSGLRT------HWKTTTCKEEDMRDDLMDIKGEIDE----GSMSGSGYGN................................................................................................................................................................................................................................................. 676
54 -9.780[K] KOG3802 Transcription factor OCT-1, contains POU and HOX domains  ali follow..  24  195..............................................................................EQFAKQFKQR--RIKLGFTQAD-VGLALGTLYGNVFSQTTICR------EALQLSFKN--MCKEEADSSTGSPTSQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHD....................................................................................................................................................... 360
55 -9.740[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  32  264......................................................YKCPICMDSVSKR------STKCGHVF-------CREC---IET----IRATHK--------CPICNKKLTARQRIYL.................................................................................................................................................................................................................................................................. 319
56 -9.720[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  10  2............................ECKKCSNEYTNKQLVMMINECGHPLCKNCV-------DNIFALNSG-------------NCHVCNRVLRKNNFLRRKLRKIYNLK-FPVKIKISNFRRFKNF----------KNFFYEFSIRYSNSPSFSWSNPEFSAQNSKIAPSNSKFQFFRFETVVYNLVFETNVNNAEIQAFEEKHKEQIDRNKRRLDDDQKWIEDQLREERAMKARMTDHMEMDAKEQEAASAVTDTRKIMDELRDSNVAAEVILDRERKKQIEKELEEKEEQEKRKRRNKEMLQTRKRAAENMSFNTV.................................................................... 305
57 -9.710[R] KOG1313 DHHC-type Zn-finger proteins  ali follow..  19  95AFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKP----------PRTHH--CRTCGMCVLDMDHHCFIGN----CNHKYFIAF................................................................................................................................................................................................................................................................................................................. 170
58 -9.690[K] KOG4215 Hepatocyte nuclear factor 4 and similar steroid hormone receptors  ali follow..  11  27.....MGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK----------HYGASSCDGCKGFFRRSV--KNHMYSCRFS------RQC---------------VVDKDKRNQCRYCKKC---FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKY....................................................................................................................................................................................... 195
59 -9.620[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  22  191......................................................TLCSVCQRGHSPL---SNRIVFC--D----------GC--------------NSPYHQLCWFCMKC.............................................................................................................................................................................................................................................................................. 243
60 -9.610[S] COG5254 Predicted membrane protein  ali follow..  16  2............................KCVECGAEV-DSLYTYYGRGTSNIRLAQCKNCKQFADK---------YIELDVVLIS--------------DVILMKPQVYRHL...................................................................................................................................................................................................................................................................................... 62
61 -9.610[S] KOG3134 Predicted membrane protein  ali follow..  16  2............................KCVECGAEV-DSLYTYYGRGTSNIRLAQCKNCKQFADK---------YIELDVVLIS--------------DVILMKPQVYRHL...................................................................................................................................................................................................................................................................................... 62
62 -9.560[U] KOG3799 Rab3 effector RIM1 and related proteins, contain Rab3a binding domain  ali follow..  22  81.......................................................ICQICQKTKGHKC-------YCQLRS-------CARCGGRAQSKNKAI-----------WACSLCQKRAKTGKWFQ................................................................................................................................................................................................................................................................... 141
63 -9.560[L] COG0551 Zn-finger domain associated with topoisomerase type I  ali follow..  12  7.............................CPTCGRNM----AIRTASTGVFLGC-RCTKCGTAMDSYVIDAHRKIHCKIKGYDGPVVECDKCGADM-----HLKLGRFGKYMGC-KCEKSDAYFVLRDG-FMSAHNFPKSR......................................................................................................................................................................................................................................................... 195
64 -9.540[S] COG1852 Uncharacterized conserved protein  ali follow..  17  72..................................EDTFYRVGIEFYNKYYEDRCLRDTKCPAKLTPKGVE------CI---------FCNRCRVGIVPGSTFLKRILKEEKPEAVFGVACNRDLFYG....................................................................................................................................................................................................................................................................... 176
65 -9.530[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  348.......................................................ICIICMDELIHS--KKPKRLPC-----------------------------GHILHLSCLTCPICRLPVFDEKGNVVQTTFT-------NSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAK............................................................................................................................ 539
66 -9.490[O] KOG0801 Predicted E3 ubiquitin ligase  ali follow..  15  173.............................................................................NDDVLTKDAGECVICLEELLQGDTIARL--CIYHKSCISCPEHP............................................................................................................................................................................................................................................................................. 225
67 -9.480[S] KOG4020 Protein DRE2, required for cell viability  ali follow..  15  268....................................IDSDELLDPEDLK------ACKNCTCGLAEELEKEKSREQMSSQ------SACGNCYLG-----------------DAFRCASC--AFKPGEKVLLSDS............................................................................................................................................................................................................................................................... 362
68 -9.430[S] KOG3990 Uncharacterized conserved protein  ali follow..  10  9.............................CSKCFSRHLYEELSSGQQL-----CKGCRKCT--------------YCRSEFQPA-QSACKKCEHYLGKYG---KIVAAFGGSKCMRCAQCDE-----------------CKLRSAFDRRDENKKVNGKLLCWLCACAYKRALLKAQQEGRIPMSKKRPHEKTSSSHRDSAAAKKPSRNELGKSGSGANNSGVNAVSGAGLDLPDKISRGNGGNGTIAAPAAITVDTNSSDHVVAIT............................................................................................................................ 232
69 -9.390[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  310............................HCPRCKAKV----------------C-ECPSCSLVLILS--------HLARSYHHLFSTHCFACQLPFPKPP--VSPFDESTSSMRYACPSCKNHFCLDCDVFAHEQ--YGCQC........................................................................................................................................................................................................................................................ 418
70 -9.390[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  310............................HCPRCKAKV----------------C-ECPSCSLVLILS--------HLARSYHHLFSTHCFACQLPFPKPP--VSPFDESTSSMRYACPSCKNHFCLDCDVFAHEQ--YGCQC........................................................................................................................................................................................................................................................ 418
71 -9.280[K] KOG0775 Transcription factor SIX and related HOX domain proteins  ali follow..  13  16.........................................................CVCE-VLQQG------------NLERLGRFLWS--CDHLHKNESVLKAKAVVFHRGNFLYKILESQFSPHNHPKLQQ------KYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS......................................................................... 284
72 -9.280[C] COG0348 Polyferredoxin  ali follow..  15  197.............................CG-C--GVIGAKGLFRIKVEHRQQCDNCMDCYNVCPEPQVLRDPLHAKKSESPLVLSKDCISCGR-------------------CIVCPEKVFIFTTRFNHSVNHSGE............................................................................................................................................................................................................................................................. 291
73 -9.280[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  10  574......................................EKELMKL----WNLHVMR--VGDCQLPIACFLDKGTEIVRKNLYRNFILHMCS-DYGLIAAETVYK---------------TVQKLQGLLSKYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPA---HLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPH.......... 898
74 -9.260[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  16  50SKRYDERQKKKRSEYRRLRRINQRNRDKFCFACRQQ--------------HIDC-ICFRCG---SKEHSLNA----CSKK--PLKFAKCFICHEN---------------HLQC-CCKFC------SSVHHLAKD----CDQ........................................................................................................................................................................................................................................................ 168
75 -9.230[R] KOG4399 C2HC-type Zn-finger protein  ali follow..  22  396.....................KNVAGYKFCEVCDRYVTER--------NVH--CDRCQACT--------SVEQGKW----------NHCEKCDKCVKPR-----------YVHCAQCARCHLY........................................................................................................................................................................................................................................................................... 458

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.