current user: public




Query: [DL] KOG3999 Checkpoint 9-1-1 complex, HUS1 component, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MRFKTRISNLYTLTRLVQALDKIGRFCWLRLMPETVNFVIVPDFRMTQVWSVLEVETIFEDYVVQSNADNVINLEVPIDNFYKALRSAANASDSTVRLSKKNNQPLLSLSTTWSGRAFGSNIVTHNIPVRVLSQSYVSVIKEPTAPEPDCHIFLPQLNFLRHVVDKYKSLSDRIIMSANMSGELQLSVNIPSARVSTKWKGLENPELDPSQVEDISRHPSQTRAPEEFVHMRLDSKDLVNMLKISSVAKRVIACFCEGHALVLYVYITDPEDEHTAVLTYYISTYVDLast
1 -106.000[DL] KOG3999 Checkpoint 9-1-1 complex, HUS1 component  ali  100  1MRFKTRISNLYTLTRLVQALDKIGRFCWLRLMPETVNFVIVPDFRMTQVWSVLEVETIFEDYVVQSNADNVINLEVPIDNFYKALRSAANASDSTVRLSKKNNQPLLSLSTTWSGRAFGSNIVTHNIPVRVLSQSYVSVIKEPTAPEPDCHIFLPQLNFLRHVVDKYKSLSDRIIMSANMSGELQLSVNIPSARVSTKWKGLENPELDPSQVEDISRHPSQTRAPEEFVHMRLDSKDLVNMLKISSVAKRVIACFCEGHALVLYVYITDPEDEHTAVLTYYISTYVD 287
2 -36.800[L] KOG1636 DNA polymerase delta processivity factor (proliferating cell nuclear antigen)  ali follow..  12  2..LELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEG-FEHYRC----DRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDI--------DSEHLGIPDA-EYHSIVRMPS-NEFSRICKDLSSIGDTVVISVTKEG-VKFSTAGDIGTANIVLR---------QNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKV-----AEMGYIRYYLAPKIE 256
3 -24.400[DL] KOG3194 Checkpoint 9-1-1 complex, RAD1 component  ali follow..  2..FQAETVCLKQIQSTLRCID-FSKECTIEITSRGLRFAV-EESQSLQAHAFLDKS-LFQTFNFQGDSDDTYMFQTMISPLLQSLSIYTDGKERISTSAWDQPTVNIMHKRGVICKVQEMAGYATACELLTMECEDDVDINRLA-STLCTKIIMKS-NWLYDALVELDNNMENLIIHTSSQKTFLLRCVGALSTTEIEYPN--------------EKSVLESFETDSENTYSYRFSLIRHALKALQVGSKVNLRIDENGTLSIQIML-VGQEGLCTFVDFCIVPLDL 282
4 -21.300[DL] KOG2810 Checkpoint 9-1-1 complex, RAD9 component  ali follow..  11  1MKYTLEGSNARVIAKAVQSLSKVGKEMFIEIDQQSLQMRAINATQSAVGSISFKRS-MFEVYDMPP--HSDFYCKISMKGCLAVFRNMNEVEYCELNLLDNQTNLQVNLRCK------LETTKEATISI-----IDDQNINTNINTDQMPNIIRGDHKLLTDISNNFNSSEE----------ELTLEANSGSVVAKNYIEGARVNDKFMRTQLKLKPSEFEQYQVTKETVITFCIKEFRAFLLFAECLNASLTLEFDEAGMPFLL---KIKKHGEIECLLIMSTLSP 260
5 -5.910[K] KOG3793 Transcription factor NFAT, subunit NF45  ali follow..  63.DLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHN-LPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTDLLGHYAVMNNP-----TRQPLALNVAYRRCLQILAAGDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILS............................................ 322
6 -5.700[S] KOG4027 Uncharacterized conserved protein  ali follow..  11  49...............................TASYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYHLPVF-------SRRPADQTEQLQAPILMPKCPNMMADITSWLDNLKCKGLSMESYGSLQFQLS.................................................................................................. 226
7 -5.380[M] COG5581 Predicted glycosyltransferase  ali follow..  9.....LKKNPLAILGVLRDLNKNQVPLRISWAHGQFI-------------------------KILAVDPEKLIVDYGSQE--YENSAVLRAGQVAIIAETQGAKVEFTLPQLVTGEYQRLPAFITPLPLWFVQRREYFRIGAPLYPPYYGVTTLPDTRTLRFRLFDLSLGGMGALLESAIPDGLIEGARFSQVELNM.......................................................................................... 176
8 -4.910[FE] COG0462 Phosphoribosylpyrophosphate synthetase  ali follow..  13  7MKLFALNSNQEIAQKIAQAVGPLGKLSSRQFSDGEIQVNIEESVRGYDVYIIQSTSFPVNNHLMERASAHSINVVLPYFGYARQDRIACPREPLTAKLVANMLVKAGVDRILTLDLHAVQVQGFFDIPVDNLFTVPLKHYCDKGLLGSDVVVVSPKNSGVKRARSLAEYLDAPIAI............................................................................................................... 194
9 -4.690[S] COG1710 Uncharacterized protein conserved in archaea  ali follow..  14  43VRILDNAPNVKVIGCPPSLYPKVSKKVLRALEQMGIKVIPVEKGRGRPRKYSYKTLMMIEELLKKGKTPREISLGIPIRTLYYLLKKREVSE................................................................................................................................................................................................... 136
10 -4.670[S] COG3554 Uncharacterized protein conserved in bacteria  ali follow..  1............................MTVMTASILWRRLDVEGHDACLLSQADGGHSLRGQAIFVQDGEVICDTGWRTRSARVDGFLGLRELHYAIERRADGEWMLNGEPQRGVAGGFTPASNLLAIRRFDLGIGETTLAPA-----AYLSFPTL-EMVLLEQSYRRLDETRYAYSAPVFGYDEILGVSPHGFVVDYPGL..................................................................................... 181

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.