current user: public




Query: [P] KOG3413 Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MQSLRAAFRRRTPIFLKPYEFSTNVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEEVGKKDYDIQYANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSKWFSRPIEFKKSEDFLast
1 -76.900[P] KOG3413 Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis  ali  100  1MQSLRAAFRRRTPIFLKPYEFSTNVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEEVGKKDYDIQYANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSKWFSRPIEFKKSEDF 158
2 -51.400[P] COG1965 Protein implicated in iron transport, frataxin homolog  ali follow..  27  1.........................................MNDSEFHRLADALWLTIEERLDSWDGD---SDIDCEINGGVLTLSFENGSKIIINRQEPLHQVWLATKQGG---YHFDLKGDEWVCDRSGETFWDLLEQAATQQAGEKVSFR..... 106
3 -7.150[R] COG3318 Predicted metal-binding protein related to the C-terminal domain of SecA  ali follow..  13  1.........................................MKTGP---LNESELEWLDDILTKYNTDHAI--LDVAELDGLLT-------AVLSSPQEIEPAQWL------VAVWGGADYVPRWASEKEMTRFMNLAFQHMADTAER.......... 89
4 -6.840[R] KOG2981 Protein involved in autophagocytosis during starvation  ali follow..  17  2....................................................VLSQKLHEAFKGTVERITGPRTISAFEKGVLS-EFVLAGDNLVSKCP----TWSWESGDASKRKPYLPSDKQFLITRNVPCLRRAASVAEDYEAAGGEVLVDDED. 104
5 -6.440[E] COG5630 Acetylglutamate synthase  ali follow..  12  401.......................................PKLDINKFKSIIDQSFKDLHDYIKRINGKIATIIVIGDYEGAILTYEGSEENSFLMFKKFPNEILWRSRKDNVVNKWYFQRSVAVL................................. 514
6 -6.290[R] KOG2238 Uncharacterized conserved protein TEX2, contains PH domain  ali follow..  735.....................NSEGTTKEKTGKKILSIVERAAQSSLFQKAAKL-QAVARLIEDVSTTPLMLNVEVEEVEGPMTCNI---------PPPPSDRLWYAVPQVGDRSVDL-------------STVSEWIETKLRQVLEKNLVCPNMDDI 859
7 -5.950[S] KOG2107 Uncharacterized conserved protein, contains double-stranded beta-helix domain  ali follow..  11  52.................................SKIREDRGYDYMDLLDLCPEKVSNYEEKLKNFFTEHIHKDEEIRYGSGYFDVRDKDDRWIRIWMQPGD----IVLPAGIYHRFTLDASNPVWTPYNRPQEEHPVRKKYIHGLTY........... 176
8 -5.840[P] COG1218 3`-Phosphoadenosine 5`-phosphosulfate (PAPS) 3`-phosphatase  ali follow..  11  26.......................................TMSTPQDLSHLLPDVINIARAAGQLILDIYQNKSYEAFTKSDSTPVTSADLAAHILSEEEANQRYWLVDPLDGTQEF.......................................... 126
9 -5.760[I] COG1443 Isopentenyldiphosphate isomerase  ali follow..  11  1.................................................MQTEHVILLNAQGVPTG---TLEKYAAHTADTRLHLAFSAKGQLLVTRRALSKKVWTNSVCGHP---------------QLGESNEDAVIRRCRYELGVEIT....... 93
10 -5.700[S] COG3824 Uncharacterized protein conserved in bacteria  ali follow..  13  76........................................APSMEEMEFLALEAYAHLPEDFRKLTGEIVIQIAEFPTDEIMDDLSLETPFDLLLFEGRGIAERWNPQTGEGPNRITLYRRAMLDYWAENEETLGDIVTHVLIHEIGHHFGLSDDD.. 192

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.