current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

KOG3413
Query: [P] KOG3413 Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MQSLRAAFRRRTPIFLKPYEFSTNVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEEVGKKDYDIQYANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSKWFSRPIEFKKSEDFLast
1 -73.300[P] KOG3413 Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis  ali  100  1MQSLRAAFRRRTPIFLKPYEFSTNVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEEVGKKDYDIQYANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSKWFSRPIEFKKSEDF 158
2 -48.800[P] COG1965 Protein implicated in iron transport, frataxin homolog  ali follow..  27  1.........................................MNDSEFHRLADALWLTIEERLDSWDGD---SDIDCEINGGVLTLSFENGSKIIINRQEPLHQVWLATKQGG---YHFDLKGDEWVCDRSGETFWDLLEQAATQQAGEKVSFR..... 106
3 -7.670[S] COG3455 Uncharacterized protein conserved in bacteria  ali follow..  75......................................LAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGVWAGKSLGGIKLFQIIGREGRYSVQPDGRKQLDNIRQQLLTQLSQ.......... 216
4 -7.110[LR] COG4119 Predicted NTP pyrophosphohydrolase  ali follow..  10  1....................................................................................MPKLSAGVLLYRARAGVVDVLLAHPGGPFWA---GKDDGAWSIPKGGEDPWLAARREFSEEIGLCVPD...... 69
5 -6.970[Q] KOG0142 Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase  ali follow..  15  1.........................................MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNKGLLVVLFNTKNRILIQQRSDTKVYFTDSCSSHP------LYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDI 128
6 -6.970[H] COG0314 Molybdopterin converting factor, large subunit  ali follow..  12  38.............................VRNHNLGDSVKALTLEHYPGMTEKALAEI---VDEARNRWPLGLVTVIHRIGELWPG--EAGQFIMDYLKTRAPFW---------KREATPEGDRWVEARESDQ......................... 144
7 -6.940[R] COG3318 Predicted metal-binding protein related to the C-terminal domain of SecA  ali follow..  15  6.................................................LNESELEWLDDILTKYNTDHA---LDVAELDGLLT-------AVLSSPQEIEPAQWLVAVWGG------ADYVPRWASEKEMTRFMNLAFQHMADTAER.......... 89
8 -6.450[S] COG5402 Uncharacterized conserved protein  ali follow..  16  87......................................................................................LKRECSYRIEGGFPTARFWVLRRADNSVTISVGHHPGNWLLTDGSGRMYFVLT................... 167
9 -6.240[P] COG1218 3`-Phosphoadenosine 5`-phosphosulfate (PAPS) 3`-phosphatase  ali follow..  12  17..............................RRESHAFGVTMSTPQDLSHLLPDVINIARAAGQLILDIYQNKSYEAFTKSDSTPVTSADLAA-ILSEEEANQRYWLVDPLDGTQEF.......................................... 126
10 -5.910[E] COG5630 Acetylglutamate synthase  ali follow..  11  401.......................................PKLDINKFKSIIDQSFKRLHDYIKRINGKIATIIVIGDYEGIAILTYEGSEENSFMFKKFPNEILWRSRKDNVVNKWYFQRSVAVYYGNPQYAKRALRDKKRLREFMRSVRDIKPS... 566

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 5 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.