current user: public




Query: [R] KOG2893 Zn finger protein, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .
# Score Template Links and tools%idFirst MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRYLast
1 -113.000[R] KOG2893 Zn finger protein  ali  100  1MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY 478
2 -25.800[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  10  198.PDNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADFRNEIEYKAHVANVHGKSLNKQQAKQTRTLQVEITL---RNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARAAQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKKAATPQVDFPALPGKGNKKNLRNLEEDMLPSGSPVPMANISAKHRSLADDYVSVASPSTFQKLQMVQKEEDEAKARQEALKKSAPKLTAAEFPSLGPSASASSSRTTAPKPSSGSPSLNWSKPANEKKQRELENRKAKVAPAPVLPSPTSKPAPKASNNNVQEQQANKKDKKQKDKKSNQENQPKTAKPKERNNNNEQKTNGAPSTPIRAPPGLKPGGPLKPPPGFVSNVTVNSVAKLPNNLTFTNSLGESYDIVPSPYTY 725
3 -21.100[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  11  213.GNSEGFKGHPMCAFCSGKFYSDDELYIHMRNQHEKCHICDKMFKDELELQAHILQEHGNILKGKPKFFQSELSTFISA-ERDDYDLPSISSLPGSSSGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTSGGNKKKGKQKQL................................................................................................... 633
4 -19.800[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  11  570VNEGEKELMKLWNLHVMRHFLDAK-IVRKNLYRNFILHMC--SLFDYG--------IAAETVYKTVQKLQGLLS------------KYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPRRADRREEELVASA----------------------------------PGYRCRPSMRGADAGAAAAAAAAPTHPHPHRPPPPPPPQ..................................................... 955
5 -18.100[KD] COG5189 Putative transcriptional repressor regulating G2/M transition  ali follow..  24  589..VMDHEEQKPFC--CEKTYKNQNGLKYHRLHGHYRCEVCGKRYKNLNGLKYH--RGHS................................................................................................................................................................................................................................................................................................................................................................................................................................... 681
6 -17.300[S] KOG4623 Uncharacterized conserved protein  ali follow..  34...RSRYDARVNCWFCNGN-----VRVPYQDRNSWTCPSCEQ---TKDGLCDQCNEAQRLKVEKLSQFEPKNES-ELKVY-LE---ERHVNKVLHEKKKMVLSSKFLNYIIKGASLLKQPHFNRLAAAQKQFK---AMGIEFLDPYISGISFILVGSFVTLVLLATNRTNLLSQVNRDESACESFHRLCADECDDETLSMLSQQLSGYSDISNSNLSMRTASVCHSPAPTISQRTIQAPASLLSLDSLHLSKQRMEQQAWSSNYGDASTVVAPRVQPAMMFQQKPMRPLESQWYRHGQSNLAQGNTFTRSTQNLLMPSRLPSINRNVGGADVSAWVAANQSVNQDLCTANLMRHYEEKQQNQLSRTSSQSSGFESQPR-PEAQCGTGAATVRDYGWSEARESQRNFAVFPPMPSPTPTITPSEYQYSRTALPQQQPTMQPGDL--------KWIEINSKSSQP............... 678
7 -15.000[R] COG5048 FOG: Zn-finger  ali follow..  16  541..YVKEMPDKTFCLFCTKTFKRRYNIRSHIQT-HYSCD-CDKAFVRNHDLIRH-KKSHQEKAYACPDAL-GGKKYENVVIKRSPRKRGRPRKDGTSSVSSSPIKENINKDHNGQLM.......................................................................................................................................................................................................................................................................................................................................................................... 679
8 -14.400[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  11  310VATARGAGNDSHCYCTIEPYIDAKFSVHIQKGNNYKAFM---KTNQGSAMQITLTEKYKSWVDEISELFGGMEVCGLSVVAKDGLIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPTPPLPAGPRPAPMGGPPPIPERTSPAVGSIGRLSSRSSISEVPEEPSSSGPSTVGGEIANKKRGRTASETSSGSGPGSVPSSAGPGSGFSSSFLGKQFSFAGKGEGVISTQPTQRPSEEPPAIPTTASSAVRPESSVSVSDSRNTDTLTERAGAGYQPVTNYEQQERVNPFDKEPSKSGSAASIHTSSSSSISSSSISSRINRNGNAIQSPPPPAGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAAVT. 823
9 -14.300[R] KOG3612 PHD Zn-finger protein  ali follow..  14  832..KKKQ-----WCANCKKE------------A--FYC--C----NTS---DYPCQQAH--------------------------------PEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKES........................................................................................................................................................................................................................................................................ 988
10 -14.200[U] KOG4173 Alpha-SNAP protein  ali follow..  14  109............CSFCKRAFPSGHLLDAHILEWHYQCLVCTEKFKTSRDRKDHMVRMHL----------PADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRSVSELFLKPVLN..................................................................................................................................................................................................................................................................................................................................................... 239
11 -14.100[R] KOG3608 Zn finger proteins  ali follow..  19  224LRRQPENNTNSFCAQCFKFFATKKLLKSHVVR-HYKCTMCDMTCSSASSLTTHIRYRHL-----------KDKPLKCSECDTRCVRESDLAKHVQIVHSKTV........................................................................................................................................................................................................................................................................................................................................................................................ 317
12 -13.600[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  14  281..SDWEEHPAS-CLFCEKQAETIEKLYVHMEDAHCRCYGCHVKFKSKADLRTHMEETKHTSL------LPDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQEQNENVPIISEDTSKLYALKQSS............................................................................................................................................................................................................................................................................................................................................................... 431
13 -13.500[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  3............CESCGVEFT----VFRRKRARYY-CANCIASRRCKRCSVFAQRPLSRTDLLKLK---------DLIFY-SKHISTEGCLEKEELVGAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGAIGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVP............................................................. 407
14 -13.300[R] KOG0562 Predicted hydrolase (HIT family)  ali follow..  10  332IG-----KVNT-LHVISNDFYSMAM----KRISHWRCNQCEFVTNMLLDLKAHLYQHWQRK--------EDERDQKKKVDKIIQMISETKLDEAEAKPKLLNEEEPIQAQPVAAIAQYPNEHLGKPLTPQQQPGKQQAQNVYDKNINGPSVNMMNQNNPNNPFRNTPHLNRQSQKPPHPRSGPRGPMAPWTGPRFPCHQQQNRFRPPGFNACRQPYPPYHSGHQQFPNASSVGGGQTGLPGQGQGPRPKWNSNKIFNQQNRQNTVQAQPQAQNQQTNQQQIQNSNKNQTPKKKPWKNRLQPVGKVQNQGGANRDPAPPSNSKPS.......................................................................................................................................................... 685
15 -13.300[R] KOG4377 Zn-finger protein  ali follow..  21  398..SRKTSHFH--CRKCDYVCTDSNKVVAHRRHTHYHCVTCDGGVLSRAQLAAH-KHRTKQEADTTP............................................................................................................................................................................................................................................................................................................................................................................................................................ 493
16 -13.300[O] KOG0802 E3 ubiquitin ligase  ali follow..  10  351..SEELRAYDDECAICREPMAKAKRLLFHGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVPD..................................................................................................................................................................................................................................................................... 579
17 -12.900[K] KOG2169 Zn-finger transcription factor  ali follow..  427LCKTRTTPSR--CTHC---FDLLSYLMMNEKKPTWQCPVCSSNCP---RLIVYFLDM----LAKVDKNT---TEVELKEDG------DVIKEEAFCISDDDDDDVVPATVNGTASCSSTNGNGLANEAAKKKPADDDIITLSDDDDEELNRGIMNSLNDSFSPGRHTASAELAAQKTPPQQKKKTKDDDIEIITLDDTPPRPVAASANLPMRQMSQQNQMPVGSSPSGMASTQMGMNEGASKTIRDALNKIGEPMINQAPHFQMQNGLIGRNNQMVHMQQHHLQQQQQQQQSPQIMSPSFYAQQQMSNGDTNNIQPPRILSMAEIQANASRLLVNGHLMIDHSGVTMRNPRGS............................................................................................................................. 770
18 -12.800[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  13  44.....KVLDRHWCLYCKEDFPTQVVRKAQDFVYHFACIICNRQLATGDEFYLTAKQLETLKNAYKNSPKPARHVRE-QLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEM............................................................................................................................................................................................................ 385
19 -12.700[R] KOG3138 Predicted N-acetyltransferase  ali follow..  10  1MNRPSNDDPQGPCRYCESPVEDDNYL--HIKCLPFTCVKCVLDSDLEPILTLYNLSIKQKGLGHVSGALSHNSP---EYF-QSGLDVFQENGWWKLAKPFQTPRSVLKEYEKKQQLRLQMRIEKRLPAADETSCSSEISVADHAQDNPPLIKAEAEKPSSTEGCARTIPYMGRLPKIQTQPSPLSQETLPGPPILQENIAPPSQKEEEPQNQPMSMVQAGLMDFLAESLESDDFTMFGNLPGIMPPPLIGAGKNDFFMTEPLLHAPLNNEGLFDMDTNFAIPNTADETKPISTEEPAAESSEEQKEGEVEDEKPEEDESPDYQPRIVQVTNYQAQEANESIKEEPLEEIMQDDDVTTNSKSSILEPCKPSGFVRQPRRNWPWLQEAQDPDDMAIPSENLKLIN........................................................................... 481
20 -12.400[TZ] KOG4035 Coeffector of mDia Rho GTPase, regulates actin polymerization and cell adhesion turnover  ali follow..  6..............Y---DFQAVY----------------PKTISFDEGEYFILYQTSARQRNQVVSM------------GNIGVPSNYVMKIKVEHDFLISFLNSSIESLEKCTDHEINGIMSKDELLDRLREKKHTMERLYAESSERDGDSSLSYSHSYSDKGSHRHSHPHPTQSQTQLHSQHRQHSPPPSGGSVGSQRLDMSKKSMSSPAVGSSCGLPQNQGMIESPSMGSMQFQGSSCTIQTPQQQQPLPAPPAPAPSPSAASATPTAASTSKAATGGDVAQDNSITSEPSETTTTTTTTSEDVVTTYKETSQMSTSQQHKPQNGSTASASISASASASALRSNGGNGKANGSATALHQELQQEEADSAPDKSDDASAVQSDDGCPANGDSADNSQALDSIDSPSHRQRGLSLGRIEEGATGGGQLKVESSDVY........................................ 402
21 -11.900[V] COG3183 Predicted restriction endonuclease  ali follow..  16  187...ERNAQNRRNCQGCGFDFEKRDYIEVH----HVKCANCHRMI--------HRRKDSVLSLKELQELLLANKS.................................................................................................................................................................................................................................................................................................................................................................................................................... 279
22 -11.800[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  13  223YTKNNANNKYDTCVICLEDFDKLRVLCSHP---HTHCPICKRKVFTKGEARASRSR--QPSLDNVTDTDDDTTPL--------------LQQQQSNGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLASTVRPATSSGAHERINPFDRAPNLPAHLAEQLTESRRSVWSRINFASFFRRQPAVISVAAPPYLERVESGTSAMGLPVTGTIAVASPASNNILNPNLSGSFKDEDDMPPHRSIYEPIAISTPAADSATVDDSAFLQTPTQGGIGVAALPHSAS........................................................................................................................................................................ 530
23 -11.700[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  15  182.GKRTHTGEKPFCGVCEKAFADKSNLRAHIQTKPHTCARCGKAFALKSYLYKH-EESS--------MKNRGGVPGSGAASGNRPPSSPKRQQAEVTSGTISALAPGSPA................................................................................................................................................................................................................................................................................................................................................................................. 298
24 -11.600[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  18  497YVQQQENGKTRYCKDCNKTFGQLSNLKVHVRTRPFKCEICTKEFTQLAHLQKH-HLVHTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERP........................................................................................................................................................................................................................................................................................................................................................................................ 619
25 -11.500[S] KOG4511 Uncharacterized conserved protein  ali follow..  10  1MLRRKKNKNPSW--FIESQFDRQQ----HKE---YS-QLIDTLIEC--GTTPTVSQQYKVALEPL--PMMMRKNIELQLQALQMIEELEMMAQNSRIQREALEQEIRKEEILLQQALDEGARAQNQNQNQGTSSTQTDGVNAPLRSVAAMMAATFAIDTATSTDDVTYKFLDQSTGTMTSSTGVSVGTLTNTGVSSGTMTSGVDTGTDADGTVGRPKSAKRVGSAVGKRSVSKGTPSEDAKKSSGSSSPDEAEKSKRERPGTSVKKAIGIVAANSEMSSNGTQMDVPVDEEGTKKRPGTTSKKSIATVTASPEMSSKTTQMEPEQDGEGKKRPETSKGANERKYSNAGLEDIVGPKSSPHEEKKSSHPSSRKGSKATDENAPATRPPSRKAAGGSHEPRAKTPNQKNKDERPTTRRSSVDKNAPKRNDSVPRERKSSVSHDESKPPKPIGPLRGNKYDGDVVLGRAESPG........ 582
26 -11.300[R] KOG1280 Uncharacterized conserved protein containing ZZ-type Zn-finger  ali follow..  21  543............GSVCGQCFDEGRN--TH-KDDRYNCVFCKKRFSAEE-LQLHLSEMHSNPADAMLERMRQED..................................................................................................................................................................................................................................................................................................................................................................................................................... 639
27 -11.200[R] KOG3253 Predicted alpha/beta hydrolase  ali follow..  12  317IGQNSL--------QCHPEMEDEKILVVVGGADD--------RISKAKKKSEGLTQVDRCIQDEIAEGHMGSEPRDQD--------PRDVARRDLAFEVPERGSRPASPAAKLPASPSGSEDLSSVSSSPTSSPKTKVTTVTSAQKSSQIGSSQLLKRHVQRTEAVLTHKQAQVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASPVPSVVSSSTAPSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPANPSPGPAPQATSVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGGLAKLASSLPGLAQISNQASGLKVPTTITLTLRGQPSRITTLSPMGSGAAPSEESSSQVLPSSSQRLPPP........ 791
28 -11.200[K] KOG4304 Transcriptional repressors of the hairy/E(spl) family (contains HLH)  ali follow..  11  51..KRKRRRAR------NQSLAILKALIKTQNAKNGEGQAKHTKLEKA--LTVHFQRHRNLDDPTVNKYRAGYTDCAREV--PEPPPMGTMPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVLEQYKQQLKAHVQQQPPPHYVQLAAALGLSAQPLVDPIATRTDFERLIELQRVQPHLAGKLSPSFPGGLEAAHVAAAAAAYANSMAVAASAGASVAAMATSGAGTPTVHQERPASVAASVSSGVSMSELKSMPATQQSSPRSESGIGSNENEAPATSPRPQTSNAARQALRQRQEEEYHYMAQAAAAAAAAGQDESMWRP............................................... 506
29 -11.200[A] KOG2837 Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing  ali follow..  22  1MGKKSKGLQK-FCQMCQKQCRDAN----------FKCHL-HQRLRTSYGTKVRANEVYNAFIKD--NST-GSSGIDEGDKGIAYIDQEALIRKEEDQRKQQQEKDDEERHMQ.............................................................................................................................................................................................................................................................................................................................................................................. 169
30 -11.000[A] KOG0150 Spliceosomal protein FBP21  ali follow..  15  1MTEYWKSNERKFCDFCKCWLSDNKASVAHESGRH-------------MNVAKRITDISRNSEKSERE----RQKMDAEIRKMEEAAMKSYAQDVHSRGDMTARSINTVMRATATAAASGGAHSFAGR............................................................................................................................................................................................................................................................................................................................................................... 113
31 -11.000[S] KOG4696 Uncharacterized conserved protein  ali follow..  13  4............CNICGETVTSEPDMKAHLIV-HIICPFCKLSGVNYDEMCFHIETAHFETVQYGTSDNKKDNTLQCGMEVNSSILSGCASNHPKNSAQNLTKDSTLKHEGFYSENLTESRKFLKSREKQSSLTEIKGSVYETTYSPPECP....................................................................................................................................................................................................................................................................................................................................... 157
32 -11.000[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  15  783............CDHCKQVVE--SSLTEHKKDGFGKCYRCSEAVFKE--LPRHIKHKPEKLANRCPNFSPGEEAWKAHLMGPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPKGGLSKSSSRTYAK.................................................................................................................................................................................................................................................................................................................................................. 924
33 -10.900[T] KOG0706 Predicted GTPase-activating protein  ali follow..  12  1MGDPSKQDIL--CFDCG--------------AKNFLCIDCHRSL----G--VHLSFIRSTELDQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSS..................................................................................................................................................................................................................................................................................... 212
34 -10.900[R] KOG4433 Tweety transmembrane/cell surface protein  ali follow..  347............RRTIDMHYEEAL-------------GLCGGGLL---GLSL---------VAGLLTSF-----LTILVYADSHAWIYLTKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSGTLPGSGGGAGAGGGVGANGHNGVGPYRNGSAGLRQGLASPSSQSSHTSSTATYNNGTTSYHNSHQQHNNHLYSNHYSHSNNHYNNTQHRTNPAAGAVAAAVGV-----VSSGQRSPSPPPVYDLDAFHRTTSNRRRICQDPTMESSSSNTAQQQQQNLQLQQHQQQSNLINQNQSQSTLKNIFASATLPRSTGSSIRSVLSVQTSNAGICRSTGNGLDGDMVDDRDPRDVTNNSFNRFDPKYISIG------PKAVRGQNNNLNIMSVAGGANKCATLRHVGRYGGSLKGVSA---NATPSPAAAPAVHSPN---------SAKTPSIATVSKY 767
35 -10.700[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  17  19.....NVLDRAWCVYCKNDFFSDLVRKARSKVFHFTCMVCNKQLSTGEELYVKQLETLKAAFA--ATPKPTRHIRE-QLAQETGLNMRVIQRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNP............................................................................................................................................................................................................................... 394
36 -10.300[T] KOG0703 Predicted GTPase-activating protein  ali follow..  11  1MNEKKELNAR--CADCKTRWASVNLGI-------FICMQCHRSL----G--VHISKVRSATLDQVANDKANRAKYEEKRWVSRGEKARSPPRVEQERRKSVERSGPGYEHGHSSSPVNLFEERKTIPASRTRNNVAATRINLPVPPQGPSQVIKPQQKMESAATPVEREKQAVNVAPASDPPKVDFATDLFNMLSMDDSTTNTSEATPGDTPADDNSWAGFQSAGSGQTAEKIVTAKPAESSSPPASSSDFEDLFKDTPNLTTQQAPKDVKGDIMSLFEKTNIVSPFAMHQQQVAMLAQQQALYMAAAKAAGGTPNGVNQQAIANALNVASANWSNPGGYQIPGMTNPVGGQADLQKLMQNMNMNANMNTRPAQPQENTLQYPSSSFYTMGQANQVNGMTPNSTGKPQSSSATQPTSTTPSSQSGKD................................................... 469
37 -10.100[K] KOG2150 CCR4-NOT transcriptional regulation complex, NOT5 subunit  ali follow..  53...KKREQIKSWQ---SPDIKDKDSLLDYRRSEKYK--AVEKASKEKASLK-HQQQM-ELALRLLANEELDPQDVDINYF-VESNQDPDFVEDETQSNEAIAHEVAQYFASQNAEDNNTSDANESLQDISKLSKKEQRKLEREAKKAAKLAAKNATGAAIPVAGPSSTPSPVIPVADASKETERSPSSSPIHNATKPEEAVKTSIKSPRSSADNLLPSLQKSPSSATPETPTNVHTHIHQTPNGITGATTLKPATLPAKPAGELKWAVAASQAVEKDRKVTSASSTISNTSTKTPTTAAATTTSSNANSRIGSALNTPKLSTSSLSLQPDNTGASSSAATAAAVLAAGAAAVHQNNQAFYRNMSSSHHPLVSLATNPKSEHEVATTVNQNGPENTTKKVMEQKEEESPEERNKLQVPTFGVFDDDFESDRDSETEPEEEEQPSTPKYLSLEQREAKTNEIKKEFVSDFETLLLPSG.. 613
38 -10.100[K] KOG2181 LIM domain binding protein LDB1/NLI/CLIM  ali follow..  116TGVSENDQQQWW-FFDDERYIELQYVLRGPSRECYENENVQFEVNTEGKLYVSNEFVYNQNTADYRVEAQNPEQENKPRMGFFKSTFNLMT---LKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQQLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQFPPNPMTSQFQQMSYPDVMVVGEPSMMGSEFGENDERTISRVENSQYDPNAMQMQSLGQGPNSSMNINGRNMMNQHHPGMQPPPGQQHMPPHSMGSQMPTSMHNPMHMPPGSMQGHGGMPPMPSTMAN--------------------------------------------QMPPPNLPPHTMSNQMPNSRMPPMQGQMPPSGMPGQMSNPNMMGSGMPPMSMSSQMPGSMSNPMPNQMPGGMQMNQMPPPNYSQYTGGPPPQWPPPNSTG... 629
39 -10.100[R] KOG2785 C2H2-type Zn-finger protein  ali follow..  14  6............CITCRVAFRDADMQRAHYKTDHTYCTVCSKKFASFNAYENHLKS-HVELEKKAVQAVNDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAK......................................................................................................................................................................................................................................................................................................................................................... 188
40 -9.950[D] KOG3056 Protein required for S-phase initiation or completion  ali follow..  16  454LERKEAMEEK-ICQVCKYTAFSAS---KHPEKRFFQCKDCGNRTTTVFKLKQSCKNCKGSRWQRTAMIREKKILTGRETLSVRGVPDEE..................................................................................................................................................................................................................................................................................................................................................................................................... 581
41 -9.900[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  340...QNSANDDNICIICMDELNQQTWKNKNKKPKRLPCG--------------HI--LHLSCLKN-SQTCP-RLPV--------------FDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKKIVIP........................................................................................................................................................................................................................................................ 544
42 -9.850[K] COG5118 Transcription initiation factor TFIIIB, Bdp1 subunit  ali follow..  15  412...GRGSYTDPW-FY---DFN----LISKQKAK-FV-----NE--------------EKKRPILIELALRSKLPPNFDEY-EIKKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTA........................................................................................................................................................................................................................................................................................................................................................................ 523
43 -9.820[K] KOG3815 Transcription factor Doublesex  ali follow..  20  17.QPPRAPLQRPKCARC-RNHGVLSWLKGHKRYCRFKCEKCRQRVMAA--VALRRQQANESL................................................................................................................................................................................................................................................................................................................................................................................................................................. 83
44 -9.740[R] KOG4314 Predicted carbohydrate/phosphate translocator  ali follow..  14  15VGKRRKDGKRRWI--ASKRFSNQPALL-HEKT-------CHQKYNSGAPLAVSLVALHK--VITGKNDY-----LTYKVWGSLKFVLFKTVIKMSVMDELLLDLFHKLTSGRQLAAGNGLCGISHKEQEVPPDHQSLDVNQEPTAPVHTVASVDNCPHCLSPKIPLLLFLNFKTKDPQEFVDTELRDRTDQQPRKQNQGSLPVLH................................................................................................................................................................................................................................................................................. 255
45 -9.720[N] COG3144 Flagellar hook-length control protein  ali follow..  534LNKEM------A----ADQLAE-RVMMMSKNLKNID------RLDPP-GMHIRMNTVNQHAREALEQTMP-REMLAQQ--GVQ-LGDTSVQQQSAGQQQRYTGQEQSGFGQSARNERLNSEENLDTDIKLDLN......................................................................................................................................................................................................................................................................................................................................................... 662
46 -9.220[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  11  1MG-PKRKVTNLFCSLCKTTLAEGRLNCLH----HYRCPCCSQEVFPPINEVSPLIEKLREQLKQSNWARAALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRSSTPATHLEMEDTASYSVSNNDVTFARKKNYGAESSSDTRP......................................................................................................................................................................................................................................................................................................................................... 209
47 -9.200[A] KOG4849 mRNA cleavage factor I subunit/CPSF subunit  ali follow..  12  102...........W-WTTDQDFFENRA---NGQSK---------------GFSV-----SESSLRAVLDQLPKKE--------MHGQAPVVTYPSKQALTQFESLQKTRPVPPPQQNGPPRGPAPPSMGGGPMPTGHPGGPQGGGPPGHPPRGMNSIMQPGQYRPQHMSQVPQVGGPNSGPPRMQPPMHPQGGLMGNQQPPPRYPSAQGQWPGQRPGGPRPGPPNGPPQRPMFQGGPMGMPVRGPAGPDWRRPPMHGGFPPQGPPRGLPPAPGPGGPHGAPAPHVNPAFFNQPGGPAQHPGMGGPPHGAPGPQPGMNMPPQQGMNMTPQHGPPPQFAQHGPRGPWPPPQGKPPGPFPDPQQMGP.................................................................................................................... 441
48 -9.140[T] KOG1451 Oligophrenin-1 and related Rho GTPase-activating proteins  ali follow..  13  478..KLENQESRP-----EKNRQMLQLLMNHLAANNHK-----QNLMTVANLGV-LLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSLARSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEP........................................................................................................................................................................ 792

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.