current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

KOG2893
Query: [R] KOG2893 Zn finger protein, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .
# Score Template Links and tools%idFirst MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRYLast
1 -99.600[R] KOG2893 Zn finger protein  ali  100  1MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY 478
2 -26.600[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  10  198.PDNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADFRNEIEYKAHVANVHGKSLNKQQAKQTRTLQVEITLGDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARAAQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKKAATPQVDFPALPGKGNKKNLRNLEEDMLPSGSPVPMANISAKHRSLADDYVSVASPSTFQKLQMVQKEEDEAKARQEALKKSAPKLTAAEFPSLGPSASASSSRTTAPKPSSGSPSLNWSKPANEKKQRELENRKAKVAPAPVLPSPTSKPAPKASNNNVQEQQANKKDKKQKDKKSNQENQPKTAKPKERNNNNEQKTNGAPSTPIRAPPGLKPGGPLKPPPGFVSNVTVNSVAKLPNNLTFTNSLGESPSPYTYTDPPDTEVRNQ. 736
3 -20.600[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  11  212KGNSEGFKGHPMCAFCSKRFYSDDELYIHMRNQHEKCHICDKMFKDELELQAHILQEHGNILKGKPKFFQSELSTFIS--ERDDYDLPSISSLPGSSSGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTSGGNKKKGKQKQL................................................................................................... 633
4 -16.500[KD] COG5189 Putative transcriptional repressor regulating G2/M transition  ali follow..  25  589..VMDHEEQKPFC--CEKTYKNQNGLKYHRLHGHYRCEVCGKRYKNLNGLKYH--RGH.................................................................................................................................................................................................................................................................................................................................................................................................................................... 680
5 -15.700[S] KOG4623 Uncharacterized conserved protein  ali follow..  34...RSRYDARVNCWFCNGN-----VRVPYQDRNSWTCPSCEQ--FTKDGLCDQCNEAQRLKVEKLSQFEPKNES-ELKVYRLEKQ-NKVLHEKKKMVLSSKFLNYIIKGASLLKQPHFNRLAAAQKQFKLQRYR--AMGIEFLDPYISGISFILVGSFVTLVLLATNRTNLLSQVNRDESACESFHRLCADECDDETLSMLSQQLSGYSDISNSNLSMRTASVCHSPAPTISQRTIQAPASLLSLDSLHLSKQRMEQQAWSSNYGDASTVVAPRVQPAMMFQQKPMRPLESQWYRHGQSNLAQGNTFTRSTQNLLMPSRLPSIN-RNVGGADVSAWVAANQSVNQDLCTANLMRHYEEKQQNQLSRTSSQSSGFESQPRPEAQCGTGAATVRDYGWSEARESQRNFAVFPPMPSPTPTITPSEYQYSRTALPQQQPTMQPGDL--EINSKSSQP........................ 678
6 -15.600[O] KOG0802 E3 ubiquitin ligase  ali follow..  10  349ATSEELRAYDDECAICREPMAKAKRLCNHGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVPDEIIFQV............................................................................................................................................................................................................................................................... 585
7 -14.800[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  13  292............CLFCEKQAETIEKLYVHMEDAHCRCYGCHVKFKSKADLRTHMEETKHTSLLPDRKTFPTYEN-DTLLCTLSDSESDLTAQEQNENVPIISEDTSKLYALKQSSILNQ....................................................................................................................................................................................................................................................................................................................................................................... 435
8 -14.800[U] KOG4173 Alpha-SNAP protein  ali follow..  14  98..EHHYHTLHGNCSFCKRAFPSGHLLDAHILEWHYQCLVCTEKFKTSRDRKDHMVRMHL----------PADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRSVSELFLKPV....................................................................................................................................................................................................................................................................................................................................................... 237
9 -14.100[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  3............CESCGVEFT----VFRRKRARYY-CANC-SRR--------RCSVFAQRPLSR--TDLLKLKPKDLIFY-SKHISTEGCLEKEELVGLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGAIGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILE................................................................................................ 366
10 -13.600[S] KOG4696 Uncharacterized conserved protein  ali follow..  13  144.GSVYETTYSPPCPFCGKIEEHSEDMETHVKTKHYDCPMCGLICTNYHILQEHV-DLHLEENSFQQGMDRVQCSGDLQLAHQLQQEEDRKRRSEESRQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIE............................................................................................................................................................................................................................................................................................................................................................. 286
11 -13.600[R] COG5048 FOG: Zn-finger  ali follow..  21  541..YVKEMPDKTFCLFCTKTFKRRYNIRSHIQT-HYSCD-CDKAFVRNHDLIRH-KKSHQEKAYACP--------------GKKFNREDALVVHRSR.............................................................................................................................................................................................................................................................................................................................................................................................. 629
12 -13.400[K] KOG2169 Zn-finger transcription factor  ali follow..  427LCKTRTTPSR--CTHC---FDLLSYLMMNEKKPTWQCPVCSSNCP---RLIVYFLDM-------LAKVDKNTTEVELKEDGS-----DVIKEEAFCISDDDDDDVVPATVNGTASCSSTNGNGLANEAAKKKPADDDIITLSDDDDEELNRGIMNSLNDSFSPGRHTASAELAAQKTPPQQKKKTKDDDIEIITLDDTPPRPVAASANLPMRQMSQQNQMPVGSSPSGMASTQMGMNEGASKTIRDALNKIGEPMINQAPHFQMQNGLIGRNNQMVHMQQHHLQQQQQQQQSPQIMSPSFYAQQQMSNGDTNNIQPPRILSMAEIQANASRLLVNGHLMIDHSGVTMRNPRGSRN........................................................................................................................... 772
13 -13.100[R] KOG2785 C2H2-type Zn-finger protein  ali follow..  15  1........MATYCITCRVAFRDADMQRAHYKTDHTYCTVCSKKFASFNAYENHLKRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPP............................................................................................................................................................................................................................................................................................................................................. 178
14 -12.800[R] KOG3612 PHD Zn-finger protein  ali follow..  14  832..KKKQ-----WCANCKKE------------A--FYC--C----NTS---DYPCQQAHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKES........................................................................................................................................................................................................................................................................................................... 988
15 -11.900[K] KOG2150 CCR4-NOT transcriptional regulation complex, NOT5 subunit  ali follow..  56..QRLREQIKSW----EIAMEKYKAVEKASKEKAYS----RERRDISEYLSQMIDELERQEIDKLLLLNKKKKT-DINYFVESNQDPDFVEDETIYDGLNLQSNEAIAHEVAQYFASQNAEDNNTSDANESLQDISKLSKKEQRKLEREAKKAAKLAAKNATGAAIPVAGPSSTPSPVIPVADASKETERSPSSSPIHNATKPEEAVKTSIKSPRSSADNLLPSLQKSPSSATPETPTNVHTHIHQTPNGITGATTLKPATLPAKPAGELKWAVAASQAVEKDRKVTSASSTISNTSTKTPTTAAATTTSSNANSRIGSALNTPKLSTSSLSLQPDNTGASSSAATAAAVLAAGAAAVHQNNQAFYRNMSSSHHPLVSLATNPKSEHEVATTVNQNGPENTTKKVMEQKEEESPEERNKLQVPTFGVFDDDFESDRDSETEPEEEEQPSTPKYLSLEQREAKTNEIKKEFVSDFE... 606
16 -11.900[R] KOG3608 Zn finger proteins  ali follow..  19  250LKSHVVRHVNCYCTMCDMTCSSASSLTTHIRYRHLKCSECDTRCVRESDLAKH-VQIVHSK................................................................................................................................................................................................................................................................................................................................................................................................................................. 315
17 -11.700[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  11  340...QNSANDDNICIICMDELKKPKRLILHLSCRSQTCPICRLPVFDEKG--------NVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKKIVIPDK........................................................................................................................................................................................................................................................................................... 546
18 -11.400[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  17  19.....NVLDRAWCVYCKNDFFSDLVRKARSKVFHFTCMVCNKQLSTGEELTIKAKQLETLKAAFAATPKPTRHIRE-QLAQETGLNMRVIQRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAA......................................................................................................................................................................................................................... 400
19 -11.300[R] KOG4433 Tweety transmembrane/cell surface protein  ali follow..  347............RRTIDMHYEEAL-------------GLCGGGLLGLSLMMVAGLLT-----------------ADSHAWIYLTKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSGTLPGSGGGAGAGGGVGANGHNGVGPYRNGSAGLRQGLASPSSQSSHTSSTATYNNGTTSYHNSHQQHNNHLYSNHYSHSNNHYNNTQHRTNPAAGAVAAAVGVVSSGQRSPSPPPVYDLDAFHRTTSNRRRICQDPTMESSSSNTAQQQQQNLQLQQHQQQSNLINQNQSQSTLKNIFASATLPRSTGSSIRSVLSVQTSNAGICRSTGNGLDGDMVDDRDPRDVTNNSFNRFDPKYISIGPKAVRGQNNNLNIMSVAGGANKCAT--------------------VGRYGGSLKGVSAVNATPSPAAAPAVHS--------PNLRSAKTPSIATVSKDY 767
20 -11.200[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  11  344..............YIDAKFSNYKAFMRKSITGNWKTNQGSAMLE------ITLTEKYKSWVDEISSVVVAKDGISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPTPPLPAGPRPAPMGGPPPIPERTSPAVGSIGRLSSRSSISEVPEEPSSSGPSTVGGEIANKKRGRTASETSSGSGPGSVPSSAGPGSGFSSSFLGKQFSFAGKGEGVISTQPTQRPSEEPPAIPTTASSAVR--PESSVSVSDSRNTDTLTERAGAGYQPVTNYEQQERVNPFDKEPSKSGSAASIHTSSSSSISSSSISSRINRNGNAIQSPPPPAGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAA.. 821
21 -11.100[R] KOG1819 FYVE finger-containing proteins  ali follow..  15  552.TLPLPAFMGVWCTACSMPFN------RH----H--CRNCGR---------IFCHKCSCNTI-SIPE------------HGYDRKPVVSSPQSNLSLLTRQDQFSCNLLHQSHHIHHLFNRSLVPHTYP............................................................................................................................................................................................................................................................................................................................................................. 658
22 -10.800[R] KOG3138 Predicted N-acetyltransferase  ali follow..  11  1MNRPSNDDPQGPCRYCESPVEDDNYL--HIKC--FTCVKCVLDSDLEPILTLYNLSIKRTHIGSVSGALSHNSP---EYFGLD-TPRSVLKEYEKKQQLRLQMRIEKRLPAADETSCSSEISVADHAQDNPPLIKAEAEKPSSTEGCARTIPYMGRLPKIQTQPSPLSQETLPGPPILQENIAPPSQKEEEPQNQPMSMVQAGLMDFLAESLESDDFTMFGNLPGIMPPPLIGAGKNDFFMTEPLLHAPLNNEGLFDMDTNFAIPNTADETKPISTEEPAAESSEEQKEGEVEDEKPEEDESPDYQPRIVQVTNYQAQEANESIKEEPLEEIMQDDDVTTNSKSSILEPCKPSGFVRQPRRNWPWLQEAQDPDDMAIPSENLKLIN............................................................................................ 481
23 -10.600[V] COG3183 Predicted restriction endonuclease  ali follow..  15  191..QNRRNAIA--CQGCGFDFEGRDYIEVH----HVKCANCHRMI--------HRRKDSVLSLKELQELLLANKS.................................................................................................................................................................................................................................................................................................................................................................................................................... 279
24 -10.500[R] KOG0041 Predicted Ca2+-binding protein, EF-Hand protein superfamily  ali follow..  13  6LAEKLKKRLNPYIPSVDTSIDD-KALEKKEENNNNNNNNNSNSTTTTP-IKTERNQQHEHTT---PRSPPPKRSI-LELLEQERLENELQQQSA--RSASPRRQQFVRENEDGNELEKRLAAQRMKKYTEEMESLVQKQVDVLDQIMSSPPPPPTSPPQLPPTPPARITSVRSDESIEEEERRRKESEETASFEELEAEIMRISRSPVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGPSEDVNMDELIESFSDSVIFNNSMSPPPPLPPLRESSLETLEVTPEDPVTESKVEASPTPLPKATESLNESSIKALEGLEAQEASDDRPSAPTPIRDSSLPPPPPPKPETPLAIRRAGPIPTPQLLEMIHQEDCSIRPSSPTSVSHGSRPQSPAVPKKPSVTVSPLGLLCDPNLSIEKPEEMKTEDTKP...................................... 492
25 -10.500[R] KOG4377 Zn-finger protein  ali follow..  20  395..TASSRKTSHFCRKCDYVCTDSNKVVAHRRLTHYHCVTCDGGVLSRAQLAAH-KHRTKQEADTTP............................................................................................................................................................................................................................................................................................................................................................................................................................ 493
26 -10.400[R] KOG0562 Predicted hydrolase (HIT family)  ali follow..  10  358...KRISHWNSF-LFMP--FQIAYMMLSVQEKTPLRCNQCEFVTNMLLDLKAHL----YQHWQRKEDERDQKKKVDKIIQMISETKLDEAEAKPKLLNEEEPIQAQPVAAIAQYPNEHLGKPLTPQQQPGKQQAQNVYDKNINGPSVNMMNQNNPNNPFRNTPHLNRQSQKPPHPRSGPRGPMAPWTGPRFPCHQQQNRFRPPGFNACRQPYPPYHSGHQQFPNASSVGGGQTGLPGQGQGPRPKWNSNKIFN----QQNRQNTVQAQPQAQNQQTNQQQIQNSNKNQTPKKKPWKNRLQPVGKVQNQGGANRDPAPPSNSKPS.......................................................................................................................................................... 685
27 -10.300[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  223YTKNNANNKYDTCVICLEDFIEDRVL-SHP---HTHCPICKRKVFTKGE--------ARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLASTVRPATSSGAHERINPFDRAPNLPAHLAEQLTESRRSVWSRINFASFFRRQPAVISVAAPPYLERVESGTSAMGLPVTGTIAVASPASNNILNPNLSGSFKDEDDMPPHRSIYEPIAISTPAADSATVDDSAFLQTPTQGGIGVAALPHSASDRQ............................................................................................................................................................................. 533
28 -10.200[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  15  182.GKRTHTGEKPFCGVCEKAFADKSNLRAHIQTKPHTCARCGKAFALKSYLYKHSPKRQQAEVTSGTISALAPGSPAAAVCAASDSAKSTLANKLLQKEKDRRQAAMA................................................................................................................................................................................................................................................................................................................................................................................... 329
29 -10.200[D] KOG3056 Protein required for S-phase initiation or completion  ali follow..  15  464MLTTYKMPCKAVCQVCKYTAFSASDRCKEQKKRFFQCKDCGNRTTTVFKLPKQCKNCKGSRWQRTAMIREKKILTGRETLSVRGDEETFMGCLAGSANLNLLVPDEE................................................................................................................................................................................................................................................................................................................................................................................... 581
30 -10.100[A] KOG2837 Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing  ali follow..  11  1MGKKSKGLQK-FCQMCQKQCRDAN----------FKCHL-HQRLRTSYG-RVRANEVYNAFIKDKGHGSSGKCKIDEGDKGIAYIDQEALIRKEEDQRKQQQEKDDEERHMQIMDGMVQRGKELAGDDEHEYEATELIRDTPDQKIQLDLNLGILDRKLDVKSGVASAKISIFDMPKVKKEDPDEPGPSQPSRKSGKKRSRSRSPAAKKFSKKSALDEIKEMEERKKERKNRKD.................................................................................................................................................................................................................................................... 291
31 -10.000[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  12  44.....KVLDRHWCLYCKEDFFTQVVRKAQDFVYHFACIICNRQLATGDRTTITAKQLETLKNAYKNSPKPARH-VREQLSSETGLDMRVVQQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMD.............................................................................................................................................................................................................. 386
32 -9.840[R] COG5112 U1-like Zn-finger-containing protein  ali follow..  19  1MGRRKRKHHS-YCIECARYFDSSQALLVHKKGK------------------------HKRRLKNLREEPYTQE--EAEAAVNIGQPKQSVASKLADNSNVVMAD...................................................................................................................................................................................................................................................................................................................................................................................... 124
33 -9.840[A] KOG3408 U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing  ali follow..  19  1MGRRKRKHHS-YCIECARYFDSSQALLVHKKGK------------------------HKRRLKNLREEPYTQE--EAEAAVNIGQPKQSVASKLADNSNVVMAD...................................................................................................................................................................................................................................................................................................................................................................................... 124
34 -9.660[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  13  1MG-KKRKVTNLFCYYCKTTLAEGRLNCLH----HYRCPCCSQEVFPPINEVSPLIEKLREQLKQSNWARAALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRSSTPATHLEMEDTASYSVSNNDVTFARK...................................................................................................................................................................................................................................................................................................................................................... 196
35 -9.490[A] KOG2245 Poly(A) polymerase and related nucleotidyltransferases  ali follow..  497..........................................................................................................................................................................................................................................PAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERNSAEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKTVTPKRSHSPSIDGTPKRLKDVEKFIRLESTFKDPRTAEERKRKSVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANN.................. 722
36 -9.470[TZ] KOG4035 Coeffector of mDia Rho GTPase, regulates actin polymerization and cell adhesion turnover  ali follow..  10  6..............Y---DFKTEYFILYQTSARQWQ-----VSMKGNIGFSNYVMKIKVEHDFLISFLNSSIESLEKCTDHEINGIMSKDELLDRLREKKHTMERLYAESSERDGDSSLSYSHSYSDKGSHRHSHPHPTQSQTQLHSQHRQHSPPPSGGSVGSQRLDMSKKSMSSPAVGSSCGLPQNQGMIESPSMGSMQFQGSSCTIQTPQQQQPLPAPPAPAPSPSAASATPTAASTSKAATGGDVAQDNSITSEPSETTTTTTTTSEDVVTTYKETSQMSTSQQHKPQNGSTASASISASASASALRSNGGNGKANGSATALHQELQQEEADSAPDKSDDASAVQSDDGCPANGDSADNSQALDSIDSPSHRQRGLSLGRIEEGATGGGQLKVESSYQIVDALRRNTNLSFDLSCEALRVVLTSLEQLYNGAINPYLEAVAVHVTGKVATP........................ 456
37 -9.430[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  84.GQALLALDKQWCFYCEKDYQTGKVLEAGDKHYHARCSRCNQMFTEGEGSTVWHPDCKQSTKTEEKLRPTRTSSESI-------YSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSLPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHRALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFP................................. 565
38 -9.420[O] KOG1873 Ubiquitin-specific protease  ali follow..  19  1MGKKAKKKARA-CVHFDKALNLEKVLDKIKSSRQIKCAECNEGVYGKRGTKAKGSKGKKDF----SSSDPKSNNKAIWLVGLPNGPQSHVLRHSRVTR............................................................................................................................................................................................................................................................................................................................................................................................ 142
39 -9.300[BK] KOG2626 Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2  ali follow..  10  12..AAPKTAPTTVC-YCDGKRELGSVEVVCSTCLHFTCKQCRKAKKAD-TLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTLLKEKNIFVQHNDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEGPKTRGASKRRHAEAPVTGKKQKLAADYSSTAAP....................................................................................................................................................................................................................................................................................... 249
40 -9.260[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  19  560.GERLRLHNKPYCDVCDAKFTQYVHLRLHKRLRPYSCGTCGKKYISPSGLRTH-WKTT--TCKEEDMKDSMRDDLMDIKGEIDEGSMSGSGYGNLGIFENTLNSELK................................................................................................................................................................................................................................................................................................................................................................................... 689
41 -9.240[T] KOG0706 Predicted GTPase-activating protein  ali follow..  1MGDPSKQDIL--CFDCNPSWASITYGV-------FLCIDCHRSL----G--VHLSFIRSTELDS--NASAS------SFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEE--ASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSRYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKAISSDM........................................................... 431

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 2 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.