current user: public




KOG0775
Query: [K] KOG0775 Transcription factor SIX and related HOX domain proteins, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGSLast
1 -111.000[K] KOG0775 Transcription factor SIX and related HOX domain proteins  ali  100  1MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS 284
2 -39.800[K] KOG3802 Transcription factor OCT-1, contains POU and HOX domains  ali follow..  19  229...............................................................QTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSP-----------TSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCH............................................................................... 359
3 -38.700[K] KOG0774 Transcription factor PBX and related HOX domain proteins  ali follow..  21  229.....................................................................................................................RSRFLDARRKRRNFSKQATEILNEYFYSHPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLYAAKTA-----VTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLG 393
4 -37.600[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  14  17LLNVLDRAWHIKCVQCECKTLYCKNDFFRR--FGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVC---NKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHARSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFT 342
5 -37.400[K] KOG1168 Transcription factor ACJ6/BRN-3, contains POU and HOX domains  ali follow..  17  261...............................................................QSTICRFESLTLSHNNMIALKPI--------LQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAG....................................................................................... 386
6 -37.300[K] KOG2251 Homeobox transcription factor  ali follow..  17  18...............................................................................................TTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGG 206
7 -37.100[K] KOG2252 CCAAT displacement protein and related homeoproteins  ali follow..  11  387............................................................................................DVNRASGMSPPTPAQNVRTHRRSTSDHDGPVSKRPRLVFTDIQKRTLQAIFKETQRPSREMQQTIAEHLRLDLSTVANFFMNARRRSRLGGNIDEPTPFQQVKNISPPPVGDTSDALLNGDDHVPLLNTVMAEMYKEGAIATSNHSAEQREMIERGFGVSIPGPSHSGELLNGDSHEDDEELDELNDSELAY 578
8 -36.500[K] KOG0484 Transcription factor PHOX2/ARIX, contains HOX domain  ali follow..  14  65..................................................................................................HQPAPYSAVPYNFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGLASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAEL 250
9 -36.500[K] KOG0486 Transcription factor PTX1, contains HOX domain  ali follow..  15  61............................................................................................DTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNL 252
10 -36.200[R] KOG0494 Transcription factor CHX10 and related HOX domain proteins  ali follow..  12  107..............................................................................................SSSILSSATTSNSSGGGSSGGGGKASKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTEKTWGKSTIMAEYGLYGAMVRHSLPLPETITKSAE-AADPQQSAAPWLLGMHKKSMEAAAHLESVEKCDMSDSDDDDRPVTPPVQRQVKNEYKPRIIEHV.. 293
11 -36.100[R] KOG0489 Transcription factor zerknullt and related HOX domain proteins  ali follow..  12  317.........................................................................................................................SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPLS 479
12 -34.400[K] KOG0843 Transcription factor EMX1 and related HOX domain proteins  ali follow..  19  317......................................................................................................................DTERQQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAESG.................................................................... 414
13 -33.000[K] KOG0773 Transcription factor MEIS1 and related HOX domain proteins  ali follow..  25  339......................................................................................................................REEILRKRRAGKLPGDTTSVLKAWWQSHPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRKSNAGDNSGRER.............................................................................. 429
14 -32.300[K] KOG0847 Transcription factor, contains HOX domain  ali follow..  21  168..........................................................................................................................QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAADNALVKRGASGDKSPCSLSPFLSAG.......................................................................... 255
15 -32.200[K] KOG0850 Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains  ali follow..  16  124......................................................................................................................GKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNP...... 283
16 -32.100[K] KOG0842 Transcription factor tinman/NKX2-3, contains HOX domain  ali follow..  19  98.............................................................................................DSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPR....................................................................................... 201
17 -31.800[R] KOG0492 Transcription factor MSH, contains HOX domain  ali follow..  21  137......................................................................................................................RKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRSAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYAASYPFHRPV........................................................ 246
18 -31.700[K] KOG0483 Transcription factor HEX, contains HOX and HALZ domains  ali follow..  14  57...............................................................................................................EDLGGVGHASSTAAEKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEANQSVMANNEVLELSHRSPSPPPHIPTDAPTSELAFEMFS... 226
19 -31.500[K] KOG0485 Transcription factor NKX-5.1/HMX1, contains HOX domain  ali follow..  16  90..............................................................................................SSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQ....................................................................................... 192
20 -30.500[R] KOG0488 Transcription factor BarH and related HOX domain proteins  ali follow..  20  165..........................................................................................................................KRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTS..................................... 289
21 -29.700[K] KOG0848 Transcription factor Caudal, contains HOX domain  ali follow..  20  184.........................................................................................................................RTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ................................. 313
22 -29.200[K] KOG0844 Transcription factor EVX1, contains HOX domain  ali follow..  15  181.........................................................................................................................DQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAH...... 337
23 -29.100[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  12  42ILKVLDRHWHSSCLKCDCQMVYCKEDFFKR--FGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC---NRQLATGDEFYLMEDGRLVCKEDYETAKQND----------------DSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSI 317
24 -27.600[K] KOG0487 Transcription factor Abd-B, contains HOX domain  ali follow..  19  184..........................................................................................................................SSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE............................................................................................... 250
25 -18.400[R] KOG0493 Transcription factor Engrailed, contains HOX domain  ali follow..  17  453..........................................................................................................................DEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTTVPLTKEEEELEMRMNGQIP.............................................................. 552
26 -16.600[R] KOG0491 Transcription factor BSH, contains HOX domain  ali follow..  16  383..........................................................................................................................RRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPDGPESPEGSPRGSEAATAAEARLSLPAGPFVLTEPEDEVDIGDEGELGSGPHQLAPSSVLSSPRQVLARSWAVRLAAKGPELAVLHPGTLP 544
27 -15.700[K] KOG3862 Transcription factor PAX2/5/8, contains PAX domain  ali follow..  201.......................................................................................................SDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTA 381
28 -15.100[K] COG5576 Homeodomain-containing transcription factor  ali follow..  11  135............................................................................................NEVVEATSVEKAKENVAHESGTPESGGSTSAPKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKSKLISRRQEEERQR............................................................................................ 234
29 -14.000[R] COG3413 Predicted DNA binding protein  ali follow..  13  162.............................................................................................................................DTMEALTDLQVKTIKQAYVNGYYPRRCTLGDLAKINGISKNAMAKRLKSVEKKIFECLFGY.................................................................................................. 224
30 -12.800[TZR] KOG1704 FOG: LIM domain  ali follow..  11  190CLEAEGRSWHFHHFQCACNDPVCLKCFHSSSS-TFSCTTCRLSFSSDTPHMSQGDLHWHAECFCCCVC-LLGVKYSRVGESLF-----------------------GYQTCGGEDEELLDEDRLGSPHRKVTQKSTKVVRIPASPRVAPRHPHVIQQNLTTTMTIQKPSVVIQNQRPKPPQRAPPPPPSENIYETVLPCSSNNSPKTPNNLLTGYPEMDGYSTSSSSDSDDEQLYISNIMAAASLSRVPAKSSSRKSKKNEPMMMSGGGVRMAKKKKSSRCTVS 489
31 -11.500[K] KOG0849 Transcription factor PRD and related proteins, contain PAX and HOX domains  ali follow..  14  195.......................................................................................................NRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNP 375
32 -10.900[S] COG3226 Uncharacterized protein conserved in bacteria  ali follow..  2............................................................................................SRVAPRDSAAQAASAVAESVRYQGRKASRQGSEQRRQAILDAAMRLIVR--------RAVRHRAVAAEAQVPLSATTYYFKDIDD........................................................................................................... 81
33 -10.300[S] COG5484 Uncharacterized conserved protein  ali follow..  12  1..................................................................................................................................MVDKHIQAYKD------YAKGMKYKDLAEKYGVSVNTIKSW--KQRHGWQRKKGAPLKKGVHTKKVGAPLGNKN................................................................................ 66
34 -9.530[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  94........WHLGCFKCKCGKPYCEKDYQGL--FGVKCEACHQFITGKVL--EAGDKHYHPSCARCSRC---NQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSLPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHRALAA 384
35 -9.520[K] COG1309 Transcriptional regulator  ali follow..  15  2..................................................................................................................SKNKAHIESNNGDRLPSAEKVDAILKGAFLTHGY-AATTMDRVTAAAGVSKTTVYSYFQDKEG........................................................................................................... 66
36 -9.280[K] COG2771 DNA-binding HTH domain-containing proteins  ali follow..  15  173..........................................................................................................................MLMSNPVCLSHREREILQ---------DGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKTLA................................................................................................. 231

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.