current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG5442
Query: [N] COG5442 Flagellar biosynthesis regulator FlaF, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MYQFSYAEIMEDGVANAKDRERQALTKSIDLLVEARDSSSQRHSIEALFYTRRVWIRFIEDLKQPDNQLAMELRANLISIAIWILKECELIRKRQSTNFQGIIDVTTIIRDGLKLast
1 -70.200[N] COG5442 Flagellar biosynthesis regulator FlaF  ali  100  1MYQFSYAEIMEDGVANAKDRERQALTKSIDLLVEARDSSSQRHSIEALFYTRRVWIRFIEDLKQPDNQLAMELRANLISIAIWILKECELIRKRQSTNFQGIIDVTTIIRDGLK 114
2 -7.990[NUO] COG1516 Flagellin-specific chaperone FliS  ali follow..  11  6.AYQAYQHN-RVSVESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGKVAVYLTGLYTHQIKVLTQAVENDASKIDLVLNVARGLLEA.. 116
3 -5.210[P] COG0605 Superoxide dismutase  ali follow..  31.HHQTYVNNANAALENLPEFASLPVEELITKLDQVPADKKTVLRNNA-HANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAATRFGSGWAWLVLKGDKLA.... 140
4 -4.960[R] COG1708 Predicted nucleotidyltransferases  ali follow..  16  1MRNAGIPIPFAQIRAGCRKIECASSRKTDIRLVATKN----RSFKGLWNGPYRTPSISGADMKTSLEHLPERKQRELARVVGIIQEEFADLVERSKSDAKKDGRIFKIILFG.. 108
5 -4.830[J] KOG3321 Mitochondrial ribosomal protein S10  ali follow..  12  48.................RSYDNENLDFYSDFIRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERH---------THKRLIRAWDTNPEVLQMLIAITKHSMAGVG 137
6 -4.630[S] COG5458 Uncharacterized conserved protein  ali follow..  21  109......................................................WRYLKPSDAPPDVEMPPKLRRELADLGL................................ 144
7 -4.610[P] KOG0876 Manganese superoxide dismutase  ali follow..  11  54.HHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSI-----FWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLG........... 150
8 -4.550[S] KOG4803 Uncharacterized conserved protein  ali follow..  10  319........IFPMAPPANFDDLVQEMDALVEASSREDNVFVSNENFRGGDITDKVWNIVRKCNDVKQKIKSHAQERNKSHLASLIRISKSSEFKERLSTIDMMMEI------GVE 437
9 -4.500[R] KOG3807 Predicted membrane protein ST7 (tumor suppressor in humans)  ali follow..  15  9....................EAAAVGASPASVPGLNPTLGWRERLRA----ASLWFVAGLGLL----RIPLRLCENLAAVTVFLNSLTPKALTGTSSLISGLIFI......... 97
10 -4.350[S] COG3821 Predicted membrane protein  ali follow..  10  22...............................ASDGGRGFDRVSLTRLMNEHRARW--IRNSLNRDLKMIDTQIIAGLQAGTAFFASTTIFALGGCFALLGATDQVQMIFSD... 99

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.