current user: public




COG5430
Query: [S] COG5430 Uncharacterized secreted protein, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MSRHSTSACLLGFATLCASPLLLAACTTSSGTGNFGSLSSFTVASTAQTITGTTGFKCTGSLLSILSTNTIDATIASTANPLGTTPRLYNAASGTYLPYSICKDNGCGTVYNVGSTVRWSSTTFLGILGLFNATDGSLPLYLRTATGVTLPAGTYTDTIGLNWAWHLCAAGIGPVCVYDDGTASSSVNVTLTVLKDCFIDSAPDLSFGSAALVSAFTAVNQNIGVRCTLNATYTIGFDNGNNFSGGWRRMLSGANAIQYNLYKPGDSTVWTTSNTQAGTGSGAAQNVPYRAIVNPAQGNVPAGTYSDTVRVILTYLast
1 -109.000[S] COG5430 Uncharacterized secreted protein  ali  100  1MSRHSTSACLLGFATLCASPLLLAACTTSSGTGNFGSLSSFTVASTAQTITGTTGFKCTGSLLSILSTNTIDATIASTANPLGTTPRLYNAASGTYLPYSICKDNGCGTVYNVGSTVRWSSTTFLGILGLFNATDGSLPLYLRTATGVTLPAGTYTDTIGLNWAWHLCAAGIGPVCVYDDGTASSSVNVTLTVLKDCFIDSAPDLSFGSAALVSAFTAVNQNIGVRCTLNATYTIGFDNGNNFSGGWRRMLSGANAIQYNLYKPGDSTVWTTSNTQAGTGSGAAQNVPYRAIVNPAQGNVPAGTYSDTVRVILTY 315
2 -14.500[NU] COG3539 P pilus assembly protein, pilin FimA  ali follow..  10VSLLRLFFAAVLMLWCAQTAAYSGQCHTTQGNPYINTTGVVKDKFYQWNESNDYYVSCD----DKDNVRSGRWAFAADSPLVYLGDNWYKINDYLAAKVLLQVKGSSPTAVADTRWHICDPGGQRLGGQGASGNSGSFSLK----LQPFVGSVVIPPMALARLFECYNIPAGDSCTTTGTPVLVYYLSGTINSLGSCSVNAGETVDLGDVHKPLGARTAELAIPVRCNTGNAGLVNVNTATTDPSYPQAIKTSRPGVGVVVTDSQNNIISPAGGTLPLSIPDDADSIA........................... 326
3 -10.100[S] COG1470 Predicted membrane protein  ali follow..  11  446..........................VITIEKEGYETKKEEVELGDGEKKELKLLLVREPYYFNVEAQSDIYPIVMEGLSRPFTIVIENLGKSDDEYKLEI---RGIPENWNAFFTESAEGNIEVTKVKVKSGETKTVYL--KVYPSLNAMPGTYNATITVI----------------SSSGIKKEIPVKIKLIGSYNM---------------NVNLLNYRLTITAGEEKTAMMDIFNFGNAP---------LTNLKITVKGPQGWDVKVDPSQIPSLSPKGRERVTITVKVP---EGTPAGDYRVQITVK... 683
4 -8.980[M] COG1361 S-layer domain  ali follow..  586............................QTIEIHFTLKANERLENNIYPIKIEIKYLSSPDDKLISDERIIGIDVTG-SSISTSPSRILPGTSNVEISFKI-ENVGDGKA-QFPFKLSETSDQIINVGSLGKGDSAQASF--KVDVDENAKSGRYLIPLTIEYK--------------DPTGKFRQIEVNIPV----IIAEKPKLVI-----------TDVRFGEKPVQGKDVNIYITVKNVGGEQAESVV-----IEGVVRSSQPFTLVKRTDYIGTLNPNQTGEGVITLSI---EKDAVPKVY--NILIRMRA 843
5 -6.770[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  11  9..........................................................................................................................................................................................VSLALLLLVGCRSHPEIPVN-DEQSLVMESSLLAAGISAE-------KPVLSTSDIQPSASSTLYNERQTVHYRFY-------WYDARGLEMHPLERPRSVTIPATLYGSANFLGAHKVR--LYLYL.. 125
6 -6.370[S] COG3595 Uncharacterized conserved protein  ali follow..  11  182......................................................................................................................................ELYLPIEINTPHAELKVEKISSQKMNINLMNGNAEVLEVNSDELKINNKNGEIKVIDGTNSDLELTGVNNIRITTAFESGDVSLVNGNILLTEKTGTAHKLNLKNVNGDIK---RTIFGGYKTRLNLDSPFEAGRNGAAIVRQGAESLTFEFETKSGTIWLKDTETTDKEETE........ 371
7 -6.360[T] KOG3275 Zinc-binding protein of the histidine triad (HIT) family  ali follow..  12  10...................................................................................................................................TAAASEDTIFGKILRKEIPCKFIHEDDKCVAFH-----------------DVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLH-GGRQMQW........................................................ 123
8 -5.980[S] COG5608 Conserved secreted protein  ali follow..  2..GKVGAIIGIIFLSWLLYSAYFVMNFSPTVRGEWGPME-------GNNVEIIFHVDLGNPSPIPVAVQSLNLSLAGVEIGRIEQAKIGIFERSTNVVAVVNLDK----------------IAEALVNHIKDKENSIAEINANIKVLGFIPKYSKTIPVKTNILSFLQNVTAEPRVYSLGMIPFKTPGIEGI-----------YARWGKV----STKEIELVGTIKLYNPNSFPIPVTN-----------------LKADMYMNNIKIGEGRTLKGTILQPNSRGTVDVALTFDVEKLKEAFKEHGERSTVKVD. 262
9 -5.780[G] COG4305 Endoglucanase C-terminal domain/subunit and related proteins  ali follow..  11  62...........................................................................................................................................................................................STTVYVTDRYPTGSSGALDLSPNAFASIGNMAQGRIPVQAPVSGNLIYRVKKGSSGWWAAIQVREHRYPVLKLEICQDGT................................................ 146
10 -5.530[C] COG3794 Plastocyanin  ali follow..  11  1..............................................................................................................................................................MHRRAFLAGGTTLSVGVLAGCIGPSVSKSDYDIGMVSNGFVPQEPVEGEDMATHQ---LTAGDTVTWANTGSRNHTVTAYGSGLPEGASYFASGGFDTEPDARRAWQDNVE-----GGGNISPGATYEVTLT----------VPGEYRGKLVVD... 148

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 7 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Li Z, Szczurek E, Godzik A. Putative type IV secretion genes in Bacillus anthracis. Trends Microbiol. 2007 May;15(5):191-5. Epub 2007 Mar 26.