current user: public




Query: [S] COG5430 Uncharacterized secreted protein, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MSRHSTSACLLGFATLCASPLLLAACTTSSGTGNFGSLSSFTVASTAQTITGTTGFKCTGSLLSILSTNTIDATIASTANPLGTTPRLYNAASGTYLPYSICKDNGCGTVYNVGSTVRWSSTTFLGILGLFNATDGSLPLYLRTATGVTLPAGTYTDTIGLNWAWHLCAAGIGPVCVYDDGTASSSVNVTLTVLKDCFIDSAPDLSFGSAALVSAFTAVNQNIGVRCTLNATYTIGFDNGNNFSGGWRRMLSGANAIQYNLYKPGDSTVWTTSNTQAGTGSGAAQNVPYRAIVNPAQGNVPAGTYSDTVRVILTYLast
1 -114.000[S] COG5430 Uncharacterized secreted protein  ali  100  1MSRHSTSACLLGFATLCASPLLLAACTTSSGTGNFGSLSSFTVASTAQTITGTTGFKCTGSLLSILSTNTIDATIASTANPLGTTPRLYNAASGTYLPYSICKDNGCGTVYNVGSTVRWSSTTFLGILGLFNATDGSLPLYLRTATGVTLPAGTYTDTIGLNWAWHLCAAGIGPVCVYDDGTASSSVNVTLTVLKDCFIDSAPDLSFGSAALVSAFTAVNQNIGVRCTLNATYTIGFDNGNNFSGGWRRMLSGANAIQYNLYKPGDSTVWTTSNTQAGTGSGAAQNVPYRAIVNPAQGNVPAGTYSDTVRVILTY 315
2 -14.500[NU] COG3539 P pilus assembly protein, pilin FimA  ali follow..  10VSLLRLFFAAVLMLWCAQTAAYSGQCHTTQGNPYINTTGVVKDKFYQWNESNDYYVSCDCDKDNVRSGRWAFAADSPLVYLGDNVLLQVKGSSPTAVPFENVGTGADTRWHICDPGGQRLGGQGA------SGNSGSFSLK---ILQPFVGSVVIPPMALARLFECYNIPAGDSCTTTGTPVLVYYLSGTINSLGSCSVNAGEEVDLGDVFAANGARTAELAIPVRCNTGNAGLVNVNTATTDPSYPQAIKTSRPGVGVVVTDSQNNIISPAGGTLPLSIPDDADSIA........................... 326
3 -8.550[S] COG1470 Predicted membrane protein  ali follow..  11  453...................................GYETKKEEVELGDGEKKELKLLLVREPYYFNVEAQSDIYPIVMEGLSRPFTIVIENLGKSDDEYKL-EIRGIPENWNAFFTESAEGNIEVTKVKVKSGETKTVYL--KVYPSLNAMPGTYNATITVI----------------SSSGIKKEIPVKIKLIGSYNMNVNLL---------------NYRLTITAGEEKTAMMDINFGN----------APLTNLKITVKGPQGWDVKVDPSQIPSLSPKGRERVTITVKVP---EGTPAGDYRVQITVK... 683
4 -7.130[S] COG5608 Conserved secreted protein  ali follow..  1MGKVGAIIGIIFLSWLLYSAYFVMN-FSPTVRGEWGPME-------GNNVEIIFHVDLGNPSPIPVAVQSLNLSLAGVEIGRIEQAKIGIFERSTNVVAVVNLDKIAEALVNHIKDKENSIAEINANIKVLGFISKTIPVKTNILSFLQNVTAEPRVYSLGMIPFKTPGIEGIYARWGKVSTKEIELVGTIKLYNPIPVTNLKDMYMNNIKIGEGRTLKGTILQPNSRGTVDVALTFDVEKLKEAFKEHIRNG-ERSTVKVDIELVVEVGGAEYEVPIKDIETTFETNILSGIKFA................... 296
5 -6.580[M] COG1361 S-layer domain  ali follow..  586............................QTIEIHFTLKANERLENNIYPIKIEIKYLSSPDDKLISDERIIGIDVTGSEK-STSPSRILPGTSNVEISFKIENVGDGKA--QFPFKLSETSDQIINVGSLGKGDSAQASF--KVDVDENAKSGRYLIPLTIEYK------------DPTGKFRQIEVNIPVIIAEKPKLVITD------------------RFGEKPVQGKDVNIYITVKNVGGEQAESVV-----IEGVVRSSQPFTLVKRTDYIGTLNPNQTGEGVITLSI---EKDAVPKVY--NILIRMRA 843
6 -6.290[R] KOG1891 Proline binding protein WW45  ali follow..  13  2.....................................................................................................................................................................................................................................GRVAATSLGNLTNHGSEDLPLPPGWSV-KYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGT-----------YVDHTNKKAQY 83
7 -5.750[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  14  9..........................................................................................................................................................................................VSLALLLLVGCRSHPEIPVN-DEQSLVMESSLLAAGISAEKPVLST-----DIQPSASSTLYNERQEPVTVHYRFY-------WYDARGLEMHPLERPRSVTIPATLYGSANFLGAHKVR--LYLYL.. 125
8 -5.700[B] COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2  ali follow..  12  1..............................................................................................................................................................................................MSNKFHCDVCSA---------------DCTNRVRVSCAICPEYDL-FSQGSYTGKHRPY--------DYRIIETNSCPDWGADKGAQTLGLGNWQD--IADHIGSRGKEEVKEHYLKYYL..... 109
9 -5.580[T] COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1  ali follow..  16  2...................................................................................................................................................................................................GVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFD--LDASAFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKILPLIPAD---------VDKIVFVVT. 110
10 -5.500[U] KOG4088 Translocon-associated complex TRAP, delta subunit  ali follow..  12  16..........................................................................................................................................................................................SSLSRCSAEACLEPQITPSYYTTSAVISTETVFIVEISLTCKNRVQ-NMAL---ADVGGKQFPVTRGQDVGRYQV-------SWSLDHKSAHAGTYEVRFFDYSLLRKAQRNNEDISIIPPLFTVSVDH 138

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 0 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.