current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG5082
Query: [OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRRLast
1 -91.800[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali  100  1MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR 344
2 -36.900[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  25  73........................................................RNRDKFCFACRQQGHIVQDCPEAKCFRCGSK-EHSLNACSKKGKCFICHENGHLSGQCEQNPKGGCCKFCSSVHHLAKDCDQVNKDD-----------------VSFGHVVGVAGTTGADEDV..................................................................................................................................................................... 192
3 -17.300[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  13  693.KQKKEEIKALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTE---------EGLDLHYWKHCLMLTRCDHCKQTEHLLTECDKKDGFGKCYRCSEPRHIKKDCN----------------PAKPEKLANRCPLCHEKAHLPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPKGGLSKSSSRTYAKR............................................................................................................... 925
4 -17.100[O] KOG0802 E3 ubiquitin ligase  ali follow..  10  345..............................................ALPDATSEELRAYDDECAICREPMAKAKRLH------CN----HL---------------------------------------H--LGCLRSW--------------DQGLNEVYSCPTCRKP--FVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVP 578
5 -16.100[R] KOG4602 Nanos and related proteins  ali follow..  37  219................................................GLGAPGANGGLGTLCNFCKHNGHQLKTCPHYVCPVCGATGDHTLKYCPLNG..................................................................................................................................................................................................................................................... 288
6 -15.100[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  18  204........................................................NSRNITCITCTDV--FQCNSRHVICLDCFHLLQMGGVLCPRPGNGLGCGFA---------------CRECKEAYHEGECSAVFEARAAEQARWEAASKETIKKTTKPCPRCGGCMHMK--CPQPQ................................................................................................................................................................... 412
7 -14.700[O] KOG2813 Predicted molecular chaperone, contains DnaJ domain  ali follow..  25  193......................................................PNSETVEKCTGCTGRG-------DVVCPTCNADGEPGFYKENQMMKCSTCYGRGLVAH---KDGSDTICTNCNGKG--KLPCPT------------------QSRGLIKCQTCDSTGSLLTS........................................................................................................................................................................ 285
8 -14.500[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  308...................LALYQSGTSLWKIWRNNKQLDD--TLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTW------KNKNKKPKRLP-------C---GHI--------------------HL--SCLKNW------------------ERSQTCPICRLP----------------------VFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKKIVIPDKF....... 547
9 -14.200[R] KOG4299 PHD Zn-finger protein  ali follow..  11  205.PTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNF---C----CETCPNS--HFT--CPDDA-CNECKHHSLYNELDEQEELESNCFRCHKSALVSQS--------------------------LACDYCNSYWHP--DCLNPPLATLPS............................................................................................................................................................. 446
10 -14.000[C] COG3005 Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit  ali follow..  12  42........................................................TSTTEFCVSC----HSMQPVYQE------KQSVHFQNASGVRAECHDC----HIPPD-MKENNSATCRSC----HNYDA-----MDHAKQNPEAARQMKIAAKENQSCIDCKGIAH............................................................................................................................................................................ 179
11 -13.900[S] KOG2673 Uncharacterized conserved protein, contains PSP domain  ali follow..  25  110................................................NVEGGLEIIDDPPRCFNCGAYSHSIRECPRPF........................................................................................................................................................................................................................................................................ 141
12 -13.600[R] KOG4684 Uncharacterized conserved protein, contains C4-type Zn-finger  ali follow..  14  4.DGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPP---------TAIASPDASGIPVINCRVCQSLQHVVK-CTV-----CNEATGKKYVRCPCN--CLLICKDTSRRIGCPRP-------NCRRIINLGPV-----MLISEEQPAQPALPIQPEGTRVVCGHCGNRFNTLAKCPHCKKICSSSVGSA......................................................................................................................................................... 188
13 -13.600[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  18  415.............................................................RCARCGEN-HVDIICNNKQCNVCSKP--HP--HC----TCVMCHRS--HCIEDFHKKFAPRCSVCKEP-HVHEDCGGL--------SEGDNQGCYPLDGHILCKTCNSA--IRVLTAK..................................................................................................................................................................... 607
14 -13.500[TZR] KOG1704 FOG: LIM domain  ali follow..  10  145.............................................................FDTKCGRSWH--FHH---QCAQCNDVADQKYMQRANKPVCLKC----------HSSSSTFSCTTCRLS-HASAEC--------------------------CCCVCSGVKYSRVGCGYQTCGGEDEELLDEDRLGSPHRKVTQKSTKVVRIPASPRVAPQNQRPKPPQRAPPPPPSENIYETVLPCSSNNSPNFDKKYSHELPTSPNHHNYYSKTPNNLLTGYPEMDGYSTSSSSDSDDEQLYISNIMAAASLSRVPAKSSSRKSKKNEPMMMSGGGVRMAKK 480
15 -13.300[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  16  273..............................................................CDFCLGDSKINKKTGQPECSDCGR-SGHPS-QCIECKCCNICGTSENDDQ----------CDDCDRGYHM--YC------------------SEPPEGSWSCHLCLDLLKEKASIYQNQNSS................................................................................................................................................................ 391
16 -13.200[R] KOG3002 Zn finger protein  ali follow..  16  5..........GSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLGHT--------CSSC----LRVQNTCPT------CRYEGNIRCLALEKVAESLEVPCR---YQNLGCQDIFPY------------YSKLKHEQHC-ECSVTGHLKDD........................................................................................................................................................................ 168
17 -13.000[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  13  1MSESVKENVTPTRNFRRTQGPQNNTKPHNDRKNFRRKQKKNNLS--NLTTSSADDTDEENELCVICARKHHTCHICNKKSCLICRTENEHLKSECATHKHAFPCELE-HQTKGNSEGFKGPMCAFCSGKRHMRNQ---------------------------KCHICDKMNHFKHTCLDNK................................................................................................................................................................... 289
18 -12.900[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  11  161.................................................NAKLLEFQIRKFQCNVCGTDCFQLTRCGHVSCQSC-QEGMFSQIKCIDL----DCGKD--VGVQLTNRYKELEEKRRYENDSNIIFCPRSFCQGPSKRDPGQKLAICQKCDFAFCSFCQATWHGDLSPCKLEGDSKKLVEMYLNYQENEPEKALELEKRYGKRIIDRLVEQVKNDEEAEK................................................................................................................... 359
19 -12.900[S] KOG4791 Uncharacterized conserved protein  ali follow..  19  2........................................................PNQGEDCYTC-TKG---DSCP------------HCEAALGNETVCT-------QEGRCFRR-------VCR---HMEID---------------------KKRSEIPCYNC----H............................................................................................................................................................................ 84
20 -12.700[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  13  2...........................................................MVHCAGCERP-HI--KC---QCCECKTNLSEKCFSREGKLYC----------KNDFFRRFGTKCAGCAQG-HLN------------------------------CFTCM-------VCNKQ.................................................................................................................................................................... 98
21 -12.700[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  21  274..............................................ERRARSRPHTLSQDQLCVVCSTNGHV---C---LCEDCAQK---ISVTCP-------CRGS............................................................................................................................................................................................................................................. 328
22 -12.500[C] COG0348 Polyferredoxin  ali follow..  21  197.................................................................CG--------CPIGAAYGVIGAKGLFRIKVEHRQQCDNCMD-------------------C------YNVCPEPQVLRDPLHAKKSESPLVLSKDCISCGRC------IDVCPEKVFIFTTRFNHSVNHSGE................................................................................................................................................... 291
23 -12.400[R] COG5141 PHD zinc finger-containing protein  ali follow..  21  201.................................................NEAECENSNAIVFCDNCNTSVH--QNCEVICCAFCPDRDGHTI--CPEKLVCCICKLRWGTCVQCSDK-------NCYAAYHIT--CAR--RAGFFYKIYSHSASYDSVDMETYCDK-----HTPPD........................................................................................................................................................................ 366
24 -12.400[R] KOG1312 DHHC-type Zn-finger proteins  ali follow..  11  113.......................................KDHKSGSTEEYPYDYLLYYPAIKCSTCRRSKH----C--SICNRCVLVADH---HCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEIPN............................................................................................ 321
25 -12.300[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  16  3...........................................................GTRCHGCGEF-HPNTICKRSNCAGCGRLDKQWHLGC----KCKSCGKV------CEKGLFGVKCEACHQTGKVLEAGDKHYH--------------------PSCARCSR-------CNQ..................................................................................................................................................................... 164
26 -12.200[R] KOG1313 DHHC-type Zn-finger proteins  ali follow..  26  109...............................................THPGVGNGALNNYTFCNYCSRTHH----C--RTCGMCVLDMDH---HCPFIGNC--VGAGNH........................................................................................................................................................................................................................................... 164
27 -12.000[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  16  204FIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICMDS--VSTKCGHVFCRECIETAIRATHKCPI------CNKK............................................................................................................................................................................................................................................. 308
28 -12.000[P] COG3303 Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit  ali follow..  16  154.......................................................DGPQAMACWTC----KGPD--NSIGCADC-----HDTTS-KRAEICANCHVEGQTVDDIEKGKNGVTCVDC----HMPKVQGADGKVY-----TDHQIQNPFEAFDSTCANC----HDQSK........................................................................................................................................................................ 377
29 -11.800[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  13  219...........................QLDREWDSVQEKYKKGAKLEEGMVKNEKKEDIPFVCLICKKD--IATTCGHHFCEQCAITRYRKTPTCIQ------CGAD............................................................................................................................................................................................................................................. 294
30 -11.700[K] KOG3815 Transcription factor Doublesex  ali follow..  32  19....................................................PRAPLQRTPKCARCRNKGH-KRYCR---------------KDC----TCEKC................................................................................................................................................................................................................................................ 58
31 -11.700[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  14  227...GSWIYGRKRTNDSITRSSVGLQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMN--SCAPCGHLFCWSCLMSWCKERPECPL------CRQH............................................................................................................................................................................................................................................. 326
32 -11.500[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  12  262.......LGRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKCGHVFH--EFCIRG------VVGKL--QTCP---YCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLI............................................................................................................................................................................................................. 395
33 -11.500[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  120TTTANVSGTTEEERIASMFATQENQWEQTQEEMSAATPVFFKSQTNKNSAQENEGPPPPGYMCYRCGGRDHWIKNCPTNS-----IWRKGHFKDLPDDLKCPLTGG--------RQPVKTSKC--CNID---------------------------------FSKEALENALVESDCPNCETRDILLDSPDQDKEKEVETFLKKQEELHGSSKDGNQPETKKMKLMDPTGTAGLNNNTSLPTSVNNGGTPVPPVPLPFGIPPFPMFPMPFMPPTATITNPHQADASPKK....................................................... 441
34 -11.400[R] KOG1819 FYVE finger-containing proteins  ali follow..  18  565.......................................................PDEDCEQCTACSMP-HHCRNCGRIFCHKCSCNT-EHGYDRKPVVSSPQS................................................................................................................................................................................................................................................ 622
35 -11.400[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  11  1MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEEL-----------------------CPVCGDKGHYG------TCESC-TVQNNKRYTCIENQNC--------------DKTQRKRCPYCRFQ------------------------------------KCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPH.................... 257
36 -11.400[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  14  175...............................................IPGKARAEYGEQRQYCPVCGTQGLRYLHCN-----LCETEWHVVRVKCSN------CEQSGKLHDDEQAAIKAESCDDCGT........................................................................................................................................................................................................................ 260
37 -11.300[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  16  263................................................DKDSDEDENALPFACFICREP--VVTKCKHYFCEHCALKHHTKNKKCF-------CNQP............................................................................................................................................................................................................................................. 317
38 -11.300[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  18  55.EITTTTTPALVSPNEHRDSTAGVIHERSRERLVENGENKTYLIAKALNMEKTSSVPGGFFDCNICLEKGHL---C---GCFYQLPLIYLNIKECPV------CDGE............................................................................................................................................................................................................................................. 159
39 -11.200[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  21  264................................................TKPSDDENSDNSNECVVCLSDRHL---C---LCTSCADTLRYQANNCP-------CRLF............................................................................................................................................................................................................................................. 319
40 -11.200[R] KOG1311 DHHC-type Zn-finger proteins  ali follow..  96.....................................................NGITVRMKWCVTCKRSSH----C--SVCNRCIETFDH---HCPWVHNCVGKRNYRYFFFFLCSLSIHMMYVFFLCFAYVWSGSDTNARDHIARGRTTNEQVTGKFTSGYNPFTIGCWGNCKKTLCHSQLPTFKSHVMEFRKQRKEEQARLANRINGPVEEQNAHADDERDETSVLYVPDQKRADGKMVAVVEFNKNNSVLRQQNTTTTTSRSESQNRITESQSQSMSMSSGCDESRITVGGGGGGAEADGSTCNLFEMERGGGRHKKN....................... 392
41 -11.200[K] KOG4216 Steroid hormone nuclear receptor  ali follow..  13  37.PTPAGEGARSSSTCSSLSRLFWSQLEHINWDGATAKNFINLREFFSFLLPALRKAQIEIIPCKICGDKGHYG------TCEGC---KGFFRRSQQSNAT-YSCPRQK----NCLDRTSRNRCQHCR------QKC................................................................................................................................................................................................................ 158
42 -11.200[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  11  1.............................................................MMQSATVP-KGLPEMLGPQCAGCNQH--HS--SC----KCADCQMQ------CKEKRFGTKCTACQQG-----------------PPTQVVRKAQDFVYHLHCFACII-------CNRQ.................................................................................................................................................................... 123
43 -11.100[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  5.............................................................QCDDCGEPRHMSM-CTKFSCIDCGNMHYHNQ--CITEAE--KYGPMVRSNGESSKQKHDFDCSLCYGKKHQEKEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDIN--------------------------------ATSEQTLLAHANGKKHRVKVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLLSHANGRKHRENVELFDATQQQQLEKTTVDKKDTTVNASDGNSEQKKVDLLVSSGVANGYSQAHK 304
44 -11.100[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  25  273................................................AQDTKKMCRVGMSMCRSCGKGRHM---C---LCSVCGSS-----NTCP-------CKSP............................................................................................................................................................................................................................................. 324
45 -11.100[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  18  150.................................................QQQERNDTNFHGVCMFCNEE-HMQKKLDNLQCLYCEKTKDHMRKEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQVHMEDDLLKIKSELGLNFYQQVKLVNRRQVHQCRCYGCHVK-HMEET........................................................................................................................................................................ 367
46 -11.100[L] KOG0287 Postreplication repair protein RAD18  ali follow..  23  23.........................................................DTLLRCHICKD---VLTPCGHTFCSLCIRTHLNNQPNCP---LCLFEFRESLLRSE....................................................................................................................................................................................................................................... 77
47 -11.100[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  23  23.........................................................DTLLRCHICKD---VLTPCGHTFCSLCIRTHLNNQPNCP---LCLFEFRESLLRSE....................................................................................................................................................................................................................................... 77
48 -11.000[L] COG0551 Zn-finger domain associated with topoisomerase type I  ali follow..  22  2.........................................................ETDIKCPTCGRNGVF--GCTGKRCTKCGTAAHRKIHICGNNPNCDGYLIEEGSFKIKGYDGPVVECDKCGADMHLKLGCTNCDNTRKILKNGEVAPPKEEPVHELKCEKSDASGVF-PKSRETRP.................................................................................................................................................................. 199
49 -10.900[R] COG5048 FOG: Zn-finger  ali follow..  16  547.........................................................DKTFEC-GCTKT-HLEDRCDHPGCDKAFVRNHHKKSHQEKAYAC-PCGKK-HRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSSVSSSPIKENINKD------------HNGQLMFKLED..................................................................................................................................................................... 684
50 -10.900[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali follow..  230................................................LPKEVQQSLPQRGECPVCLLS-TACSVSGYVFCWKCIVSHMKEHGTCP---VTHYPISLDDLVR........................................................................................................................................................................................................................................ 293
51 -10.900[J] COG1499 NMD protein affecting ribosome stability and mRNA decay  ali follow..  10  3......................................................GRDVAKIPCPFC---GRLVDRLIEGMCEDCYVERHPLVK---RVLRCRYCGARGRWIREGRGGVEELAAKVLSDKASVSGAIERIESPHPSIEPRLFTYVLTFEYVYDICNSCRESRREVAVLQIRGYPRGIENDVKKKIIFIIEQELYKLKDKKIGFISDIKDLKNGIDIYTTNANLARHLAYVIHRQFPSVVTETAKVVGVKDGRKIYH............................................................................... 232
52 -10.800[R] KOG4582 Uncharacterized conserved protein, contains ZZ-type Zn-finger  ali follow..  23  113................................................VDDPSNFTIHDAVECDGCGLIG-FRYKC----------------VQCSNYDLCQKCELAHK------------------HPEH..................................................................................................................................................................................................................... 163
53 -10.800[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  1............................................................MPCESCGVE-RACFDCKRYYC-----------ANCIASRRCKRCS----FAQRPLSRTDLLKLKPKDLIFYLQSK-------------------------HISTEGCLEKEELVG----THVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECS....... 243
54 -10.800[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  11  3.............................................................LC-KCPKRKVTNLFCRVNVCEFC--TDQDYDPNCS---LCKTTLAEGDTIR-------------CLHLLHW--KCFDEW----------ANFPATTAPAGYRCPCC-------------SQEVFPPINEVSPLIEKLREQLKQSNWARAALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRSSTPATHLEMEDTASYSVSNNDVTFARKKNYGAESSSDTRPLLQLRDADNEENKYKRRPTMDWMRGLWRAKHGGSGVPQERASAK........... 253
55 -10.500[R] KOG1315 Predicted DHHC-type Zn-finger protein  ali follow..  16  74.....KSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHRCHH----C--SVCAMCVLKMDH---HCPWVNNC................................................................................................................................................................................................................................................... 165
56 -10.500[U] KOG3799 Rab3 effector RIM1 and related proteins, contain Rab3a binding domain  ali follow..  15  23HTQNNGYAIKRVFKRQKDEEAKET--QISQKASEELSELDKQIT----ETSKKLVGTQDDAICQICQKTGHKCFYCQLRSCARCGGRAQSKNKA-----ACSLCQKR............................................................................................................................................................................................................................................. 129
57 -10.400[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  13  1MQNGKPRSSARPSFHRRPKDGVANTTTDNAAVK---------------PEALESYTGNDDNACVVCFKN-FSIGDCDHPVCYECSTR----MRVLCQQNECPICRHV-AEIRQQFFKLLDHPCPKCDAPNHVRSECVETLNIFTFERRTKGDPDNRSHRGHPLCEYCNKR-HLRRECDAD.................................................................................................................................................................... 239
58 -10.400[K] KOG2845 Activating signal cointegrator 1  ali follow..  10  110.RNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTRERQDRLAVALPGRHPC-DCLGQKHLINNC-----LICGR-----------------CEQEG-----------SGPCLFCGTL------CTHEEQDILQRDSNKSQKLLKKLMSGV---------------ENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEP.......................... 375
59 -10.400[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  18  4.........................................................TMIQSCNECKGKG-SYKICSA--CHGTGFRSTEDIKD-SHEVPCEVCRGKGEVE--------RETCPTCGGKGEVNI-----------------------------CPSCGRMMKGRDECPECQKK................................................................................................................................................................. 111
60 -10.300[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  16  132.DNRIPFYDLDVAEGAEDDLQEDFHVEGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCSVCQR-GHSPLSNRIVFCDGCNS---H--QLCVDAE-CMKC................................................................................................................................................................................................................................................ 243
61 -10.200[S] KOG3931 Uncharacterized conserved protein  ali follow..  11  524.DEYDDEVAANESLTAATELADQSIIDDIFGEDTLLKEFQRENDVQPSCSSYAKRIENDIVSCPICFEK-HF-DGCAIMV----RLEPPSFKPKNRRTTASLTSKDSSGASTSRRAKSKAKSSKGIDKLNLSSSTDSSTLPSSEDELTPRQRRQRNLFKETVGCPRCGLKVHG-SVCAGRKK.................................................................................................................................................................. 723
62 -10.200[TV] KOG3966 p53-mediated apoptosis protein EI24/PIG8  ali follow..  353.................................................................................................................................................................................................................WSKANRLSAMQRQQYELQQRQRLLQRDEQLLKQRKQQYVQQQRLQQEQLMRRDRSHSRSQTPQLGHPHRYAQAPVFDAGRVRDSSASSTHSSNAPSINSHRPPPYYGSSLRGAAPLVPTPVPGAPRAPLTPPVIR 487
63 -10.200[S] COG1852 Uncharacterized conserved protein  ali follow..  14  88.................................................EDRFKKAKKRVLILPHCLR----DTKCPAKECIFCNR--------CRVGEIIKVAEEKGYKVYIVPSTFLKRILKEEKPEAVFGVACNRDLFYGMNMLSRKGIPSQGQPLLRDGCINTL................................................................................................................................................................................ 201
64 -10.100[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  15  10................................................QQLQQAINSTIDKECAVCYSE--TIPSCGHKFCFIC-GVSVSNNGDCPI------CRGP............................................................................................................................................................................................................................................. 66
65 -10.100[R] KOG3183 Predicted Zn-finger protein  ali follow..  13  13..............................................................C-YCKQIDFLPFTCDR--CLQCLDHRSYMKHDCPKG----------------RGDVTVVICPLCAKEKHVNTDCNYEKAVKKKKCPVPRCRELLTFSNTIKCRDCSID-H-DHSCSGPKKPESSFSFMGFLSTNTKEAPASSSSSSRWSSLFASAEASISRLGNDISQKLQFASGNDGNSEKTQERNGKQNCGK........................................................................................ 216
66 -10.100[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  300...................................................CHSIPSRGGFHCPRC-----KAKVCTPIECPSCS-LSTHLARS-PKSTHCFACQLPPVSPFDESTSSMRYACPSCKNH---------------------------------FCLDCDVFAHEQHECY...................................................................................................................................................................... 414
67 -10.100[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  300...................................................CHSIPSRGGFHCPRC-----KAKVCTPIECPSCS-LSTHLARS-PKSTHCFACQLPPVSPFDESTSSMRYACPSCKNH---------------------------------FCLDCDVFAHEQHECY...................................................................................................................................................................... 414
68 -10.100[R] COG5273 Uncharacterized protein containing DHHC-type Zn finger  ali follow..  16  130SDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKY-----------------CPSCRRSSH----C--STCNVCVMVHDH---HCIWVNNC................................................................................................................................................................................................................................................... 209
69 -10.100[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  13  511................................................SAFCGNQIYEPGEEC-DCGFSQADCDQMGDKCCAQCSPSQGRQESECSNLQTC-----DGR-NAQCPVSPPKHDGIPCQDSTKVSGQCNGSVCAMFGLEDCFLTEGKADELCFLACIKCNNKGYIFRKCRSVDANGPLARLKNLLFNKRTIETLTQ---AVHTPSTNPNKPPALNIYQTLTRPGTLIRQHRQRHRAAAGSVPPGPGAQPRSGAASAPSRTTPSARPSAPPLVAPQVAVAVPPGVVGPPIPLIATHPGSSSSTPAVIVLEPPPPYTAADPGSAMGGPRRGHRKNKRQ 904
70 -10.000[S] KOG4260 Uncharacterized conserved protein  ali follow..  14  189.........................................................EKKLLCTQC------HAACGEKSCRKCKKLEQQRPNPCRPQQFCFSCLECDRSCDGCDGD-GPDMCRKCADGYELEGKCHDISAEQRSNYVSFTRMLTYFGMCVATCVIFQSSTHIAWGCIV..................................................................................................................................................................... 334
71 -10.000[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  21  355.........................................................LRDFECAICSN---VRLGCSHVFCLHC-ILQKQKVDFCPL------CRAK............................................................................................................................................................................................................................................. 401
72 -9.950[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  25  4............................................................IQCNHCNQTKLYLTACGHVFCQNC--TKAAFNSQCYL------CKKP............................................................................................................................................................................................................................................. 46
73 -9.830[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  17  267.TKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDE-------STRRATFGVECVIC-TKGDKVVALP------C----KHFHRPCDYRHACPTCNTE............................................................................................................................................................................................................................................. 365
74 -9.820[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  17  96.....................................SSVHHHHGEQGEILNSTSLLEDEHICPECGKK-HRSIMDKKAHCPYCEKV--HVRTH-NQGCECQFCGKRGHIRTHTGEK----KCGVCEKA-HSNTTCARCGKAFALKSYLYKHEESSCMKNRGGVPGSGASGNRPPSSPK..................................................................................................................................................................... 278
75 -9.800[K] KOG4215 Hepatocyte nuclear factor 4 and similar steroid hormone receptors  ali follow..  20  1MDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEG------------TNLNAPNSLGVSALCAICGDTGHYG------SCDGC-SVRKNHMYSCRFSRQC--------------DKDKRNQCRYCR------KKC................................................................................................................................................................................................................ 111

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]