current user: public




Query: [OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRRLast
1 -76.000[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali  100  1MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR 344
2 -33.900[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  21  32..........NTNEESSSQDNMKASFGSSKRYDERQKKKRSEYRRLRRINQR-----NRDKFCFACRQQGHIVQDCPEAKCFRCGSK-EHSLNACSKKAKCFICHENGHLSGQCEQNPKGLYCKFCSSVHHLAKDCDQ-----------------VNKDDVSFGHVVGVAGTTGADEDVYHE.................................................................................................................................................................. 195
3 -23.600[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  13  702..........LQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTE----------GLDLHYWKHCLMLTRCDHCKQTEHLLTECDKKDGFGKCYRCSEARHIHKDC----------------NPAKPEKLANRCPLCGEEAHLMGPCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPKGGLSKSSSRT................................................................................................................... 921
4 -16.500[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  12  34................................................PEALESYTGNDDNACVVCFKN-FSIGDCDHPVCYECSTR--CQQNECPLDHPCPKCDARNHVRSE----HKLLYCDLCSHRGH----CEYCNKRYV----DRDELFRHLRREHYFCHFCDADGHFRAECEEGKCATE----VGAFRNEIEYKAHVANVHGKSLNKQQAKQTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARAAQSQHPV 427
5 -16.000[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  15  269..........................................................PNNYCDFCLGDSKINKKTGQPSCSDCGR-SGHPS-QCIECKCCNICGTSE-------NDDQLLFCDDCDRGYHMY--CEGSWSCHLCLD----------------LLKEKASIY............................................................................................................................................................................ 385
6 -15.400[O] KOG2813 Predicted molecular chaperone, contains DnaJ domain  ali follow..  26  193......................................................PNSETVEKCTGCTGRGDVV-------CPTCNADGEPGFYKENQMMKCSTCYGRGLVAH---KDGSDTICTNCNGKG--KLPCPT------CQSRG-----------LIKCQTCDSTGSL........................................................................................................................................................................... 282
7 -14.400[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  17  50................................................TTSSADDTDEENELCVICARK-VSLTPCHHKTCHICGFR----QRALYNKKSCLICRTE--LKFFCPSEHNRMICLICQLRNHQTKGCA----CSGKRFYSDDELYIHMRNQHEKCHICDKMNHFKHSCTV..................................................................................................................................................................... 282
8 -14.300[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  18  3...........................................................GTRCHGCGEEGH--PNC---ACTICKR-RDCLCQLCAQPSNCAGCGRNGHL--GC-------KCKSCGTGEYISKDCEKDYQ----------------GLFGVKCEACHQTGH--SRCNQM.................................................................................................................................................................... 165
9 -14.200[R] KOG4299 PHD Zn-finger protein  ali follow..  12  214..........NVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNF---C----CETCPNS--HFT--CPDDAYCNECKHHSRCHKSALVSQSILACDYCNSYWHP--DCPRKWK-------------------------C--PNHSDHVTPRYRL.................................................................................................................................................................. 466
10 -13.900[O] KOG0802 E3 ubiquitin ligase  ali follow..  11  340.....................................................................GALHAALPDATSEELRAYDD----------ECAICREPMAKAKRLH----------CNHLFHLG--CLRSW--------------DQGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVRE-FQVNFK 588
11 -13.700[R] COG5048 FOG: Zn-finger  ali follow..  16  547.........................................................DKTFECLGCTKRSHIQTSCDHPGCDKAFVRNHHKKSHQEKAYAC-PCGKK-HRSRMICSGGKKYENVVIKRS--RKRGRPRKDGTSSVSSSPIKENINKDHNGQLKLEDQLRREKTNQR........................................................................................................................................................................ 709
12 -13.700[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  17  4.........................................................TMIQSCNECKGKG-SYKICSA--CHGTGFRSTEDIKD-SHEVPCEVCRGKGEVEVR-------ETCPTCGGKGEVN-ICPS------CGRMMKGRDEY--------CPECQKKEKLHPACTMDD................................................................................................................................................................... 125
13 -13.300[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  130.EEERIASMFATQENQ----------EQTQEEMSAATPVFFKSQTNKNSAQENEGPPPPGYMCYRCGGRDHWIKNCPTRIRRTTGIWRKGHFKDLPDDLKCPLTGG--------RQPVKTSKC--CNID------SKEALENALVESD-------------FVCPNCETRDILLDSLVPDQDKEKEVETFLKKQEELHGSSKDGNQPETKKMKLMDPTGTAGLNNNTSLPTSVNNGGTPVPPVPLPFGIPPFPMFPMPFMPPTATITNPHQADASPKK.................................................................. 441
14 -12.800[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  20  23.......................................................PMQQIPQCAGCNQH-HS--SC---KCADCQM---QLADRCFSRAGSVYCKE---------FKRFGTKCTACQQG-HL--HC--------------------------ACIICGDEFYLMEDCKE..................................................................................................................................................................... 142
15 -12.800[R] KOG4377 Zn-finger protein  ali follow..  16  307..............................................................C-RCNHQSHF--HCNRRDC---TRFVQHTARHERMDTLMGDDFRQFRANMQCSRKTSHFHCRKCDYV-HLRQDNAGFRKVGGNEQCDSPGCSYAQRHTHYHCVTCDGG-H............................................................................................................................................................................ 478
16 -12.600[R] KOG1312 DHHC-type Zn-finger proteins  ali follow..  14  132..........................................................PAIKCSTCRRSKH----CS--ICNRCVLVADH---HCIWINNC--IGKGNYLQFYLFLISNIFSMCYA------------FLRLWYISLNSTSTLPRAVLTLTILCGCFT---QL----------AIVKEGMTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEIPNIYDKGTFLANLTD............................................................. 334
17 -12.500[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  11  3............................................................VHCAGCERP------ILDRFLLNVLDRAWHIK--C---VQCCECKTN--LSEKCFSREGKLYCKKCAG-------CAQ--------SPSDLVRKARSKVFHLNCFTCMV-------CNKQ-----STGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRM 258
18 -12.400[R] KOG3002 Zn finger protein  ali follow..  14  5..........GSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVC-PNGHTL-------CSSCKLR----------QNTCPTCRYEGNIRCLALEKVAESLEVPCR---YQNLGCQDI---FPYYSKLKHEQHCRFRSYSCPY-ECSVTGHLKDD........................................................................................................................................................................ 168
19 -12.200[U] KOG3799 Rab3 effector RIM1 and related proteins, contain Rab3a binding domain  ali follow..  15  27.NGYAIKRVFKRQKDEEAK-----ETQISQKASEELSELDKQIT----ETSKKLVGTQDDAICQICQKTGHKCFYCQLRSCARCGGRAQSKNKA-----ACSLCQKRQQILAK....................................................................................................................................................................................................................................... 135
20 -12.000[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  17  182...................................................................EYGEQRQYCP-----VCGSMPQIGTTQGLRYLHCNLCETEWHVVR--------VKCSNCEQSGKLH----------------WSLDDEQAAIKAESCDDCGT............................................................................................................................................................................... 260
21 -11.900[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  329..........................................DTLVTVTVEQLQNSANDDNICIICMDELIHSPN----------QQTWKNKNKKPKRLPC------GHI--------------------HL--SCLKNW------------------ERSQTCPIC-------------RLPVFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK....................... 540
22 -11.900[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  5.............................................................QCDDCGEN--LKKP----------RLPRHM-SMCTATKSCIDCGNHYHN--QCITEAEKYGPMVRSNGESSKQK-------------HDFDINAELFNSQWFCSLCNATAHVYGK-------KHQEKANEVADMDYSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDINATSEQTLLAHANGKKHRVKVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLLSHANGRKHRENVELFDATQQQQLEK... 265
23 -11.800[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  18  443.............................................................TCIICNNEKKA---CEPEQCNVCSK---H---HC----TCVMCHRSGLI---CIEKKFAPRCSVCKEP-HV--HC---YRCEDCGGSEGDNQGCYPLDGHILCKTCNSA-RIRVLTAK..................................................................................................................................................................... 607
24 -11.800[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  20  197..............................................................CQSC-QEGMFSQKCIDLDCGKDAPVNDSNIIFCPRSAFCSFCQATWHGDLSPCKLLNGQRCPTCDRVVERIDGCCHM------------------LCGTHFCFLCGAYKHFNDSC....................................................................................................................................................................... 416
25 -11.600[A] COG5183 Protein involved in mRNA turnover and stability  ali follow..  1MDVDSDVNVSRLRDELHKVANEETDTATFNDD------------------------APSGATCRICRGEATLFHPC---KCR--GSIK-HES--------CLL----ASKNIDISKPGADVKCDICHYP--YAENMPEFGKLYTMMLDGSSPYPGDFLKSLIYGYDQSATPELTTR-VFHKIGPRLSPKDLKSRLKERFPMMDDRMVEYLAREMRAHDENRQEQGHDRLNMPAAAADNNNNVINPRNDNVPPQDPNDHRNFENLRHVDELDHDEATEEHENNDSDNSLPSGDDSSRILPGSSSDNEEDEEAEGQQQQQQPEEEADYRDHIEPNPIDMWANRR.. 397
26 -11.500[S] KOG4367 Predicted Zn-finger protein  ali follow..  13  3.......................................................EMEEELKCPVCGS---IILPCSHNLCQACARN-PATCITCPAALKCQLCKAPKEATVMCEQ--DVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSELENHSMYCVQCKM---VCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTT....................................................... 364
27 -11.500[R] KOG1313 DHHC-type Zn-finger proteins  ali follow..  17  14.......................................................NEDYEAICWGCGLNLVLPSYAPVFKCGWCGTHPGVGNGALNNYTFCNYCSKRTH---HC------RTCGMC-DMDH---HCP-------------------------FIGNCGAGNH............................................................................................................................................................................ 164
28 -11.500[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  300...................................................CHSIPSRGGFHCPRC-----KAKVCTLPICPSCSILSTHLARS-PKSTHCFACQLPPVSPFDESTSSMRYACPSCKN---------------------------------HFCLDCDVFAHEQHECY...................................................................................................................................................................... 414
29 -11.500[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  17  300...................................................CHSIPSRGGFHCPRC-----KAKVCTLPICPSCSILSTHLARS-PKSTHCFACQLPPVSPFDESTSSMRYACPSCKN---------------------------------HFCLDCDVFAHEQHECY...................................................................................................................................................................... 414
30 -11.400[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  11  483.....................................SSSHNDSSFNGVPNQQQENGKTRYACKDCNKT-HVRTHTGERPCEICTKLQKHHLVHTERPHRCDICDKNGQKPYTCDVNERPYSCGTCGKK-TTCKEEDMKDS-----------MRDDLMDIKGEIDEGSMS-LNSEPIETIYSKYNLPNASLLGQGPSGMQEQQAPP.......................................................................................................................................... 724
31 -11.400[R] KOG1280 Uncharacterized conserved protein containing ZZ-type Zn-finger  ali follow..  12  515...............................................LEEDKESGEEENGDEDDGASDSDFSDECGSEMYCGQC-HTETHLNGDASKSYNCVFCKKRFHLSEM-NPADASALTVMLEDLENRIAT................................................................................................................................................................................................................. 646
32 -11.400[S] KOG4791 Uncharacterized conserved protein  ali follow..  22  8..............................................................CYTCTK-G---DSCP------------HCEAALGNETVCT---QEG----RCFRR-------VCR---HMEID---------------------KKRSEIPCYNC----H............................................................................................................................................................................ 84
33 -11.400[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  18  26................................................KMVNYSYDEDLEELCPVCGDSGHYG------TCESC---KGFFKRTVQNNKR-YTCIE----NQNCQDKTQRKRCPYCR------QKC................................................................................................................................................................................................................ 100
34 -11.300[S] KOG4623 Uncharacterized conserved protein  ali follow..  11  38.........................................................DARVNCWFCNGNVRVPYQDRNSTCPSCEQYNGF--------------TKDGDYNRDITSQRKNGLCDQCNEAQRLK----EKLSQFEPKNESRFDQELKVYRERLLCSSCERH.............................................................................................................................................................................. 173
35 -11.300[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  16  298........................................................QMGGVLC-GCGEPDQRKVTCEGGNGLGCG-------------AFCRECKEAYHEGECSAVKKTTKPCPRCHVPVEKNGGCMHM-------------KCPQPQCRLEWCWNCGCE.............................................................................................................................................................................. 424
36 -11.300[R] KOG1315 Predicted DHHC-type Zn-finger protein  ali follow..  12  69TWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHRCHH----CS--VCAMCVLKMDH---HCPWVNNC--IGFSNYKFFLQFLAYSVLYCLYIATT-HCWLVSRNK------TTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET........................................................................................................ 337
37 -11.300[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  15  96.....................................SSVHHHHGEQGEILNSTSLLEDEHICPECGKKYSTSSNLAR-------HRQTHRSIMDKKARHCPYCEKMPAYSMHVRTHNQGCECQFCGKR-HTGEKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKA-HEESSCMKNR................................................................................................................................................................... 259
38 -11.300[TZR] KOG1704 FOG: LIM domain  ali follow..  15  195..................................................................GRSWH--FHH---QCAQCNDVQKYMQRA--NKPVCLKCFH---------SSSSTFSCTTCRLS-HASAEC--------------------------CCCVCSKGESL---CGY..................................................................................................................................................................... 292
39 -11.200[T] KOG3575 FOG: Hormone receptors  ali follow..  17  22................................................FPEPSPSSKRPTENCKVCGDRPRYGA-----ACLGC-AVVKNLKYKCMKEQNC--------------SCTYRNACRYCR------QKC................................................................................................................................................................................................................ 96
40 -11.200[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  21  178.....................................................................................TALKRKSRKVDMVTLCSVCQR-----GHSPLSNRIVFCDGCNSPYH--QLC----------HPPIDDATVQDVDAEWFCMKC................................................................................................................................................................................. 243
41 -11.200[C] COG0348 Polyferredoxin  ali follow..  21  197.................................................................CG--------CPIGAAYGVIGAKGLFRIKVEHRQQCDNCMD-------------------C------YNVCPEPQVLRDPLHAKKSESPLVLSKDCISCGRC------IDVCPEKVFIFTTRFNHSVNHSGE................................................................................................................................................... 291
42 -11.100[O] KOG2824 Glutaredoxin-related protein  ali follow..  17  193..........................GKYVGGADVIKSLFEIGELAKILKE---PMRQPGFVCHCCGDIRFV-------PCSNCSGSKKLFDEDEDRVKRCPECNENG------------IRCPDCSS........................................................................................................................................................................................................................ 274
43 -11.100[T] KOG0297 TNF receptor-associated factor  ali follow..  21  29.........................................................EAKYLCSACRNRRPFQAQCGHRYCSFC-SILSSGPQNCAAPAVCPSCTWKGCHEGRC--PLMLTECPACKGLRHLEHECPERSLSCRHCRAPCCGADVKAPKFPLTCDGCGKKQDHVKTCGKC.................................................................................................................................................................... 212
44 -11.100[R] KOG4399 C2HC-type Zn-finger protein  ali follow..  20  396......................................................KNVAGYKFCEVCDRVTERNVHCDR--CQACTSVEQGKWNHCE---KCDKCVKPRYV---CAQ------CARCHLYGR..................................................................................................................................................................................................................... 460
45 -11.000[R] KOG3608 Zn finger proteins  ali follow..  20  187..........................................GNKYRLIEHISTHSNKKQVACFHCGEL-HLRRQPENNQCAQCFKLKSHVVRH-VNCYKCTMCDMT-HIRYR--LKDKPLKCSECDTRKHVQPDCHYSVRTYT-QMRRHFLEVHGNNPILYACHCCERF-HL........................................................................................................................................................................... 369
46 -11.000[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  53..........EDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVPAVA---------------------------NTKS---GILSIVFPVDASTSGFSSDEVEGSLRD.................................................................................................................................................................................................................. 157
47 -10.900[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  14  263.............................GRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCGGRSEHVHDADAVVTTKMVEDEDEKLYKLS-------CGHVFHE--FCIRGGKLQTCPYCKERVDLQRMFKNPWEKPH........................................................................................................................................................................................................ 375
48 -10.900[R] KOG1311 DHHC-type Zn-finger proteins  ali follow..  13  65LDPAVHPYAIGSEEPTQVDDLRAPLYKNVDINGITVR------KW-----------------CVTCKRSSH----CS--VCNRCIETFDH---HCPWVHNC--VGKRNYRYFFFFLCSLSIHMMYVFFLCYVWSGSDTNARDHILSPPYLCAIVLLALCAVLCVPVIGLTVHLNEQVTGKFTSGYNPFTIGCWGNCKKTLCHSQLPTFKSHVMEFRKQRKEEQARLANRINGPVEEQNAHADDERDETSVLYVPDQKRADGKMVAVVEFNKNNSVLRQQNTTTTTSRSESQNRITESQSQSMSMSSGCDESRITVGGGGGGAEADGSTCNLFEMERGGGRHKKN 392
49 -10.800[R] KOG3612 PHD Zn-finger protein  ali follow..  11  776IEKLQ---HQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAY----C------------------CWNTSYCYPCQQA-HM-KSCTQSATA................................................................................................................................................................................................................................ 877
50 -10.700[R] KOG3116 Predicted C3H1-type Zn-finger protein  ali follow..  11  2...............................................................................QCRNMSNSKDEKSQDAADRIKAATLTAAKGLSRTQAERAAAAAARNVNAYGQKEEG-PSRWQMYLMSTEKSASAVGSSASAASQCQKCFQAGHWTYECKNERVYISRPSRTQQLKNPKLR-----TKPSVDDLDGSDDDDEEERPDATNGKAEVEKRSKKSKRKHRSKSDSESDSEASVFETDSDGSSGESSSEYSSSSDSEDERRRRRKAKKSKKKQKQRKERRRRYSSSSSESSESESASDSDSDEDRSRRKKKSKRHSNKRR 280
51 -10.600[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali follow..  13  203........................................................SPSAVYCRICGK----GAACRPTRKTIC---PKFLNGRCNKAEDC----NLSHE----LDPRRIPACRKCNN-----PNCR-----YVHIHYSENAPICFEFAKYGFC-SCKNQ-HI--QCTDYAMFGSCNNPQCSLYHGAVSADVPEQTEAPISKTAGSINPEDSGSEIGSNSL................................................................................................................. 368
52 -10.500[S] COG4393 Predicted membrane protein  ali follow..  12  282..RLSEAIPVHMDDKNQVYIPIEQVKDGKLHRFVWIADDGKAVRFFLINRLPDRLSLAAVFACILCGDQGYVMEG---------------------DQVICVGCGVRMFIPS-------------IGKPG----GCPVPIENWQQTDTQVIIHKKSLEDGLHYFSTVVE............................................................................................................................................................................... 412
53 -10.500[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  26  253.................................................RDIDESQKEELYKCPICMDS--SKREPVSTKC-------GH--------VFCREC----RATHKCP---------ICNKK....................................................................................................................................................................................................................... 308
54 -10.500[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  21  264................................................TKPSDDENSDNSNECVVCLSDRHL---C---LCTSCADTLRYQANNCP-------CRLF............................................................................................................................................................................................................................................. 319
55 -10.400[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  230...............................................................................................NKYDTCVIC-IEDDKLRVLP----------CSHPYH--THCIDPW------------------ENRRVCPIC--KRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLASTVRPATSSGAHERINPFDRAPNLPAHLAEQLTESRRSVWSRINFASFFRRQPAVISVAAPPYLERVES..... 446
56 -10.200[S] KOG3899 Uncharacterized conserved protein  ali follow..  12  240VSDFHIRINALEFRNLENRVRRPIAIPSNIQLHRNVIDRFVDVFKAQVAQNPIFPDDATTEKCFACMLN-KIHKQCADF---------DRNGAPLANGACCSNC--------YC----RPMWCVEC--AARQSDVDREVW------------------EQKCTCPMCRAKFCVLDVSYITTTVDATNSTQSQGTEEDTNDTT.............................................................................................................................................. 409
57 -10.200[R] KOG4684 Uncharacterized conserved protein, contains C4-type Zn-finger  ali follow..  15  44................................................AIASPDASGIPVINCRVCQSLINLDGKLHQVKCTVCNEATGKKYVRCP----C-NC---------CKDTSRRIGCPR--------PNCRRI-MLISEEQPAQPALPIQPEGTRVVCGHCGNRFNTLAKCPHCKKICSSS............................................................................................................................................................. 184
58 -10.200[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  12  1............................................................MPCESCG---EFTVFRRKRACFDC------------KRYYCANC-------------IASRRCKRCSSRTDLLKLKPKDLIFY--------------QSKHISTEGCLEKTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSER..... 254
59 -10.200[O] KOG1815 Predicted E3 ubiquitin ligase  ali follow..  14  124.................................................SHVVPPSDDSELTCGICFDS--ASVSCGHPFCTTC---TGYISTTINDGLRCPSCLEDNRKGLEIMMFANSKPCPRCKRPIEKNQGCMHMTCTPPCKYE--------------FCWLCLGMDH............................................................................................................................................................................ 285
60 -10.100[L] COG0551 Zn-finger domain associated with topoisomerase type I  ali follow..  21  2.........................................................ETDIKCPTCGRNGVFKERCKRKRCTKCGTAAHRKIHICGNNPNCDGYLIEEGSFKIKGYDGPVVECDKCGADMHLKLGCTNCDNTRKILKNGEVAPPKEEPVPELKCEKSDRDGASGVSAHNFPKSRETR............................................................................................................................................................. 198
61 -10.100[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  22  276................................................RARSRPHTLSQDQLCVVCSTN---PKEIILLPC-------GHV---C----LCEDCAQK--ISVTCP---------VCRGS....................................................................................................................................................................................................................... 328
62 -10.100[K] KOG3815 Transcription factor Doublesex  ali follow..  31  24.........................................................QRTPKCARCRNHGVLS------------WLKGH-------KRYCR---------KDC-------TCEKC.......................................................................................................................................................................................................................... 58
63 -10.100[R] KOG3183 Predicted Zn-finger protein  ali follow..  21  8......................................................................DLGKHCSVDYC--------KQIDFLP---TCDRCLQLDHRKHDCPKDVTVVICPLCAKGKHVNTDCDPSNYEKAVKKKKCPVPRCRELSNTIKCRDCSIDKH-DHSCSG..................................................................................................................................................................... 139
64 -10.000[R] COG5273 Uncharacterized protein containing DHHC-type Zn finger  ali follow..  15  130SDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKY-----------------CPSCRRSSH----C--STCNVCVMVHDH---HCIWVNNC--IGKRNY........................................................................................................................................................................................................................................... 215
65 -9.970[R] KOG1314 DHHC-type Zn-finger protein  ali follow..  25  88.................................................KPEISQDTMYLQYCKVCQPRSH---HC--RKCNRCVMKMDH---HCPWINNCC-----GYQNHA....................................................................................................................................................................................................................................... 142
66 -9.940[S] COG4260 Putative virion core protein (lumpy skin disease virus)  ali follow..  19  313................................................QMQAQAENKADTWTCPECNTK-NTGKFCSN-----CGQAKPSATPVMPENMACNEC---GAVVNLANGVPK---CPECGKP....................................................................................................................................................................................................................... 383
67 -9.900[R] KOG4602 Nanos and related proteins  ali follow..  19  220.................................................LGAPGANGGLGTLCNFCKHNGESRH------------YSSHQLKTCPRHYVCPVCGATGHTLKYCPLNGGQQS.............................................................................................................................................................................................................................. 292
68 -9.860[S] KOG3990 Uncharacterized conserved protein  ali follow..  17  8.............................................................ACSKCFSRHLYEKGCRGGKCTYCRS----FQPATKSQSACKKCEHYLGKYGKIVAAFGGSKCMRC-ASYEAKYGPPV-------------------------CDEC................................................................................................................................................................................. 106
69 -9.830[O] KOG0715 Molecular chaperone (DnaJ superfamily)  ali follow..  22  181.........................................................DAYVFCDSCDGLG-HPSDAAMSICPTCRGVG--RVTIPPFTASCQTCKGTGHIIKE--------YCMSCRGSGIVEGT................................................................................................................................................................................................................. 247
70 -9.820[D] KOG3056 Protein required for S-phase initiation or completion  ali follow..  21  416..........DRELMRKSRIEKIMAATSSHTNLVEMREREAQEEYFNKLERKEAMEEKMLTT---------YKMPCKAVICQVCKYTAFSASD---------RCKEQKHPLKVVDAEKRFFQCKDCGNRTTTVFKLPK-----------------------QSCKNCKGS.............................................................................................................................................................................. 534
71 -9.740[R] COG5141 PHD zinc finger-containing protein  ali follow..  14  199...............................................ICNEAECENSNAIVFCDNCNTSVH--QNCPE-FCKKCLLAPH-------EVICCAFCPDRDHTI--CPKSRWKLVCCICKLRW----TC-------------------------VQCSNCYAAYHIT--CARRAGFFYKIYSHSASYDSVDMETY----DKHTPPDYLNGLMKRLFPLAELYYKRMATDVPLNFQATKAPDFVPEGPWK........................................................................................ 409
72 -9.730[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  21  228LQQVLAAVERNRWEEPPTVADDAQSCCGSNDEGDSEEERWKLAG---EAQDTKKMCRVGMSMCRSCGKGEASVLLLP---C-------RHM---C----LCSVCGSS---LNTCP---------ICKSP....................................................................................................................................................................................................................... 324
73 -9.540[R] COG5063 CCCH-type Zn-finger protein  ali follow..  18  171..........................................................KTELCESFTLKG----SCPYSKCQFA-----HGLGEL-RTKPCVNWEKLGY----CPYGRR---CCFK----HGDDN................................................................................................................................................................................................................. 236
74 -9.530[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  19  102................................................NMEKTSSVPGGFFDCNICLEKAE------DPILTCCG----HL---------CWGC-----FYQLPLIYLNIKECPVCDGEVTDAEVIP............................................................................................................................................................................................................... 167
75 -9.520[K] KOG4215 Hepatocyte nuclear factor 4 and similar steroid hormone receptors  ali follow..  20  37................................................TNLNAPNSLGVSALCAICGDRAHYGA-----SCDGC-SVRKNHMYSCRFSRQC--------------DKDKRNQCRYCR------KKC................................................................................................................................................................................................................ 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]