current user: public




COG5063
Query: [R] COG5063 CCCH-type Zn-finger protein, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTWLast
1 -116.000[R] COG5063 CCCH-type Zn-finger protein  ali  100  1MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW 285
2 -35.600[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali follow..  6LLENIA--SLAGAINQYKNEKAEPTQVLDAAKANKNTRSYPYSVSRNYSFILNKSNRSKSTAASPPYVIPSTSSNADDANKEPEKQSTSDYVSRKNRHMQLIKKNILEHDLQARKANLESYRAKLEKEYKTLAENKIQQRLSDGTKQLVTIDGLQYITGVSDTKEVGNSPSAVYCRYYNANGICGKGAACRFVHEPTRKT-VHIHYSENAPICFEFAKYGFCELGTSCKNQHILQ.................................................. 313
3 -30.900[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  32  3.........................................................................................................................................................................TKQITCRYFMH-GVCREGSQCLFSHDLANSK--------PSTICKYYQK-GYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSP........................... 81
4 -29.600[S] KOG4791 Uncharacterized conserved protein  ali follow..  30  4..........................................................................................................................................................................QGEDCYFFFY-STCTKGDSCPFRHCEAALG--------NETVCTLWQE-GRC-FRRVCRFRHMEID................................................. 58
5 -28.600[K] KOG2494 C3H1-type Zn-finger protein  ali follow..  25  12......................................................................................................................................................................TKWLTLEVCREFQR-GTCSRADDCKFAHPPRVCHVENG----RVVACFDSLK-GRCT-RENCKYLHPPPHLKT.............................................. 78
6 -28.300[R] KOG1595 CCCH-type Zn-finger protein  ali follow..  15  79..TPLMVAAIATGRSDVNRV-CSDEKVTALHCAVSGCSVSIVE--IIKILLDASSPNCVDANGNKPVDLLAKDSRFVPNQSRKAVEVLLTGIHGSVMEEEEEELKSVVTKYPADASLPDINEGVYGTDDFRMFSFKVKPCSRAYSHDWTECPFVHPGENARRRDPRKYPYTCVPCPEF-RKGSCPKGDSCEYAHGVFES----HPAQYRTRLCKD---ETGCAR-RVCFFAHRRDELRPVNASTGSAMVSPRSSNQSPEMSVMSPLTLGSSPMNSPMANGVPLS. 362
7 -26.400[R] COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein  ali follow..  13  40..KPLGFTHIKSQESYISKMPPKKGKQAQAAG---KKKDNVDKTFGMKNKNRSTKVQKYIKQVQSQSD------------------------------------------------------------PKKEEMRLKKLEEKKRREAEEAERRALFNPVADQRVRAGVDPKSMVCALF-KLGNCNKGAKCKFSHDLNVGRRMEKKDLYTDKVCKYFIEA-ICPGGDKCMYRHSLPEGFVLKTNEQKRLERESLEKQPKITLEEFIETERGKLDKSKLTPITIAQW 305
8 -19.300[R] KOG1763 Uncharacterized conserved protein, contains CCCH-type Zn-finger  ali follow..  17  101..........................................................................................................................................................................KSVVCAFF-KQGQCTKGDKCKFSHDLTLERKCEKRSVYIDAVCKHFLEA-VCPGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITLES-----LAW 258
9 -19.300[R] KOG2333 Uncharacterized conserved protein  ali follow..  22  20..................................................................................................................................................DGNKKRKRKERGQNKRREKIHVKENNALCPAISIGNECPYKENCKFPHDVEAYLATKAPDI--GDKCPIFERYGVCPAGFKCRWGHVVIN................................................. 109
10 -14.800[R] KOG1492 C3H1-type Zn-finger protein  ali follow..  11  101.WSKSIERDSRKANEEATLAVAAYSKKE-------SEKQSGQNNTSTASRNHLAHGRMTLFPANLKFFIIDFWFSGERVFRFGSLRYKMDSSRRTLQRISDVDSPCSGPSENGKGVKRPFIPKRLVIGNEEYVRFGNGNQLVRDPKKRTRVLANEKVRWSLHNARLRLAKKKKYCQFFTRFGKCNKDDKCPYVHDPSNCKLTHKVIPERMPDCSYYLQ-GLCN-NEACPYRHVHVNPIAP............................................. 347
11 -12.100[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  12  1....MEQKNLNINQASGSKINTELAV-----IFQSRRRHRPRQGLKRKKGFKRDDDSGGSSESSNEDMRDNIPIVSGRKKTVRLNRLQRESEQFENSALKDINVEYQSNLSATGESVNTTTVSAINEDTREVILGRPSPKLANQFEKKSQVGPVLSSNASTVRMNTIIDYQPDVCKDYKLTGYCGYGDTCKFLHMREDYKAGWQLDREWDSVCL-------CPIATTC--GH..................................................... 271
12 -11.600[R] KOG1677 CCCH-type Zn-finger protein  ali follow..  20  47..................................................................................................................................................QDSSQCFWQHQNFTSNREHNPALRKTKICDHWRRSGSCSYGDACWYAHGEDDLRKVVRIDRSNE-------EENERPATAEIQKSPTKRA................................................. 129
13 -11.000[A] KOG2202 U2 snRNP splicing factor, small subunit, and related proteins  ali follow..  25  14..........................................................................................................................................................................DRVNCPFYFKIGACRHGDRCSRLH........................................................................................... 37
14 -10.900[R] KOG4582 Uncharacterized conserved protein, contains ZZ-type Zn-finger  ali follow..  14  126......................................................................................................................................................................................EC---DGCG--------LAPLIGFRYKCVQCSNY---DLC---QKCELAHLMLRMPTNNGP.......................................... 174
15 -10.500[R] KOG3002 Zn finger protein  ali follow..  15  2....................................................................................................................APGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYPSSCRVQNTCPTCRYELGNIRCLALEKVAESLCRY-QNLG-CQHEQHCRFRH..................................................... 164
16 -10.300[S] KOG4020 Protein DRE2, required for cell viability  ali follow..  26  297..........................................................................................................................................................................KRKACKN------C----TCGLAEELEKEKSREQMSSQPKSAC------GNCYLGDRCAFKPGEK.................................................. 356
17 -10.100[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  17.....DYAGFHFENGADSSLPQVSAQGVVRETDSSNFDASPVASGSGISDVGPFGADFHQLQQHVQTPYGGMTMPASSSSGATSVPPEQDPSLSVSFNRLPKSASTKTKNGRIRSSRREDDNRIPFYDLDVAEGAEDDLQEDTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCS------VCQRGDGCNSPH----------------QLC---DVDAFCM---KC......................................................... 243
18 -10.100[R] KOG4299 PHD Zn-finger protein  ali follow..  98.......GDHDTSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPY-NNDYCSACHGPGNC---ETCPF-H------------------C---LPDDYCN---ECK........................................................ 310
19 -9.840[W] KOG4004 Matricellular protein Osteonectin/SPARC/BM-40  ali follow..  12  68..........................................................................................................................................................................AENPCQNHH----CKHGKVCELDENNTDPTSCPAPIGEFEKVC----NDNK-TFDSSCHFFATK................................................... 129
20 -9.530[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  271................................................................................................................................TARMASRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTKMVEDEDEKLYKLSCGHVHEF----------------C-VVGKLQTCPY---CKERVDLQRMFKNPWEKPHLFYGKLLDWIRY........................... 387
21 -9.470[K] KOG2857 Predicted MYND Zn-finger protein/hormone receptor interactor  ali follow..  27  5..........................................................................................................................................................................ATQTC------EICE-----------------KVVSKYKCPSC----LVPYC--SLGCFKIHKVCN................................................. 41
22 -9.370[R] COG2158 Uncharacterized protein containing a Zn-finger-like domain  ali follow..  16  10................................................................................................................................................................EENPLGKASGPDENCEFY-----CHFGQNCAFCY------------------CPFYRDRGSC---QDCTWIHTDSAVECVKRSLGDIISGPDDLMDKKRELLKLRRECLMRG............. 111
23 -9.280[S] COG3369 Uncharacterized conserved protein  ali follow..  12  51......................................................................................................................................................................PRRESYILCR-------CGSSENCDGTHSKIGFDGMEKAETVEGPDLKLTDAPELCDHSRFC......................................................... 117
24 -9.180[K] KOG2845 Activating signal cointegrator 1  ali follow..  11  1MAVAVSGEPLVHCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEKKGQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTRERQDRLAVALP--------GRHPCQKHKLINNC----IC---------------------VCEQ-EGSGPCLF---CILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLL. 270
25 -9.040[R] KOG2858 Uncharacterized conserved protein  ali follow..  25  2...........................................................................................................................................................................AVLC------GVCG-----------------IKEFKYKCPRC----LVQTCS---ECSKKHKTRD................................................. 37

FFAS is supported by the NIH grant R01-GM087218-01
6 0 3 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.