current user: public




Query: [R] COG5063 CCCH-type Zn-finger protein, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTWLast
1 -91.100[R] COG5063 CCCH-type Zn-finger protein  ali  100  1MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW 285
2 -33.500[R] KOG1595 CCCH-type Zn-finger protein  ali follow..  21  208..........................................................................................................................GVYGTDDFRMFSFKVKPCSRAYSHDWTECPFVHPGENARRRDPRKYPYTCVPCPEF-RKGSCPKGDSCEYAHGVFESWL--HPAQYRTRLCKDETG---CA-RRVCFFAHRRDELRPVNASTGSAMVSPRSSNQSPEMSVMSPLTLGSSPMNSPMANGVPLS. 362
3 -26.800[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  32  4..........................................................................................................................................................................KQITCRYFMH-GVCREGSQCLFSHDLANSK--------PSTICK-YYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHS............................ 80
4 -26.500[K] KOG2494 C3H1-type Zn-finger protein  ali follow..  20  5.............................................................................................................................................................NVALIRDTKW--LTLEVCREFQR-GTCSRADACKFAHPPRVC----HVENGRVVACFDSLK-GRC--RENCKYLHPPPHLKTQLEINGRNNLIQQKTAAA............................ 96
5 -25.700[R] COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein  ali follow..  15  98...........................................................................................................................QSQSDPKKEEMRLKKLEEKKRREAEEAERRALFNPVADQRVRAGVDPKSMVCALF-KLGNCNKGAKCKFSHDLNVGRRMEKKDLYEAVENGKYGWFWICPNGDKCMYRHSLPELKTNEQKRLERESLEKQPKITLEEFIETERGKLDKSKLTPITIANFAQW 305
6 -21.400[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali follow..  25  205..........................................................................................................................................................................SAVYCRYYNANGICGKGAACRFVHEPT-----------RKTICPKFLN-GRCNKAEDCNLSHELDPRR............................................... 260
7 -19.200[S] KOG4791 Uncharacterized conserved protein  ali follow..  34  8..............................................................................................................................................................................C--FFFYSTCTKGDSCPFRHCEAAL---------NETVCTLWQE-GRC-FRRVCRFRH..................................................... 54
8 -18.500[R] KOG1677 CCCH-type Zn-finger protein  ali follow..  20  55..........................................................................................................................................................QHQNFTSNREHNPALRKTKICDHWRRSGSCSYGDACWYAHGEDDLRKVVRIDRSNEEENERPAEIQKSPTKRASTNVKGLTVNIPSNTAFKEQNSS................................... 152
9 -18.000[R] KOG2333 Uncharacterized conserved protein  ali follow..  21  20..................................................................................................................................................DGNKKRKRKERGQNKRREKIHVKENNALCPAISIGNECPYKENCKFPHDVEAY--LATKAPDIGDKCPIFERYGVCPAGFKCRWLHVVIN................................................. 109
10 -16.500[R] KOG1763 Uncharacterized conserved protein, contains CCCH-type Zn-finger  ali follow..  20  101..........................................................................................................................................................................KSVVC-AFFKQGQCTKGDKCKFSHDLTLERKCEKRSVYKTQVCKHFLEAGVCPGGDICMYRHALPPGFVLKKDKKKEEKEDEISLED-----IERERSALGPNVTKITLESFLAW 258
11 -13.200[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  13  18..TELAVPIFQSRRRHRPRQGLKRKKGFKRDDDSGGSSESSNEDMRDNIPIVSGRKKTVRLNRLQRESEQFENSALKDINVEYQSNLSATGESVNTTTVSAINEDTREVILGRPSPKLANQSTLPTELFQSQNDYSRFLPKRKDFEKKSQVGPVLSSNASTVRMNTIIDYQPDVCKDYKLTGYCGYGDTCKFLHMREDYKA-KEDIPFVCLICKKDYRSPIC-FCEQC......................................................... 277
12 -12.200[R] KOG1492 C3H1-type Zn-finger protein  ali follow..  15  228.......................................................................................................................................GNGNQLVRDPKKRTRVLANEKVRWSLHNARLRLAKKKKYCQFFTRFGKCNKDDKCPYVHDPSKIAVCTKHVNPIAPICDGFEATGSCSQGLKCKLHHPKNQSKGRKRKRTNEPSQKNARRRYFSSLHNILSESEPMVFNRRST....... 432
13 -11.000[A] KOG2202 U2 snRNP splicing factor, small subunit, and related proteins  ali follow..  26  16............................................................................................................................................................................VNCPFYFKIGACRHGDRCSRLH-FEELGKFGE-TDFREATCRQY-EENNCNRGGYCNFMH..................................................... 172
14 -10.700[S] KOG4020 Protein DRE2, required for cell viability  ali follow..  23  275....................................................................................................................................................DPEDLKKPDPASLRAASCGEGKKRKACKN------C----TCGLAEELEKEKSREQMSSQPKSAC------GNCYLGDRCAFKPGEK.................................................. 356
15 -9.900[R] KOG4582 Uncharacterized conserved protein, contains ZZ-type Zn-finger  ali follow..  14  113................................................................................................................................................................VDDPSNFTIHDAVEC------------DGCG-LIGF----------RYKCVQCSNY---DLC---QKCELAHPEHLMLRMPTNNGP....................................... 174
16 -9.530[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  18  59..........................................................................................................................................................................AAPKCNNCSQRGDCPH-IICSYCHYSRHC---------KAIQCSKCDEVGHCPHKWKCTLCHSKER................................................. 135
17 -9.360[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  2....................................................................PPRRSYPFSGHGGTIARFIEFGEAFGHYGEEEDEEEEDEEEAYVDYGEVQEEDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVSVWKFGPAS-DSIVF---------------VDT---CMDIPASTSGFS---SDEVEGSLRDVRKIYASRVAAVDDEAHKRILFLEAKLRSIEQKTASWSNKEVQWKI... 203
18 -9.360[R] KOG1312 DHHC-type Zn-finger proteins  ali follow..  11  112......................................................................................................................................................SKDHKSGSTEEYPYDYLLYYPAIKCSTCRRSKHCSICNRCVADH--------------------------HCIWINNCQFY...................................................... 180
19 -9.360[K] KOG3815 Transcription factor Doublesex  ali follow..  19  1.................................................................................................................................................MNGYGSPYLYMGGPVSQPPRAPLQ-RTPKC------------ARCR--HGLSWLKGHKRYCRFKD--CT-------C---EKCILIIERQRVMAAQVALRRQQANESL................................ 83
20 -9.340[R] KOG1280 Uncharacterized conserved protein containing ZZ-type Zn-finger  ali follow..  13  534.....................................................................................................................................................................SDSDFSDECGSEVM---YC---GQC-FTH-DRRIKIIYHRSFLDKDASKSYN----CVF---C-QLH..................................................... 614
21 -9.120[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  21..FHFENGADSSLPQVSAQGVVRETDSSNFDASPVASGSGISDVGPFGADFHQLQQHVQTPYGGMTMPASSSSGATSVPPEQDPSLSVSFNRLPKSASTKTKNGRIRSSRREDDNRIPFYDLDVAEGAEDDLQEDFHVEGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCS------VCQRGDGCNSPH----------------QLCAEW----FCM---KC......................................................... 243
22 -9.110[R] COG5048 FOG: Zn-finger  ali follow..  17  539..............................................................................................................................................................DKYVKEMPDKTFECLFCKTFKRRYNCDH-PGCAFVRNHD----LIRHKKSHQE--KAYA----CP----CKFNHRSRMI................................................ 631
23 -9.090[R] KOG4299 PHD Zn-finger protein  ali follow..  13  95..AEKGDHDTSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYR--NNDYCSACHGPGNC---ETCSF-H------------------C-AW----YCN---EC......................................................... 309

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.