current user: public




Query: [K] COG4742 Predicted transcriptional regulator, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MQSELIDVVFRSQKRRDLLLLLGEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARALVDVLTLVEKDNYWIEHDLGGIPQYLLDKIGEIKDCNLVKADPSQIFEPNTELLEYFASSRYLMVFSSFYRPEFLPLYSKLGRLESEVSLIFTESVLEKFLYNYEKKIRRLATMDNTELCVCKDGVKIAELIVSDRGMMISLFDSQGRFYHEYMYCSEPQAISWARELFDFYESRALRVDGEKSLDSFICTPESGAFSESLLLSLHLast
1 -98.800[K] COG4742 Predicted transcriptional regulator  ali  100  1MQSELIDVVFRSQKRRDLLLLLGEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARALVDVLTLVEKDNYWIEHDLGGIPQYLLDKIGEIKDCNLVKADPSQIFEPNTELLEYFASSRYLMVFSSFYRPEFLPLYSKLGRLESEVSLIFTESVLEKFLYNYEKKIRRLATMDNTELCVCKDGVKIAELIVSDRGMMISLFDSQGRFYHEYMYCSEPQAISWARELFDFYESRALRVDGEKSLDSFICTPESGAFSESLLLSLH 284
2 -17.500[K] COG3432 Predicted transcriptional regulator  ali follow..  27.....MQLERRKRGTMEIMFDICEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENYEITEKGKLLRTHIEEFIKIRENLYS.................................................................................................................................................................................................... 116
3 -17.100[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  15  6.DGNILRSLNRSELRRKVLFYLLSYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKFKINPEIVEEVRNMKNMFS........................................................................................................................................................................................................... 103
4 -15.800[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  17  1MSEKEIDELINDYDMLRVLKHFTIHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTYQINKKAEAVLKEITP.............................................................................................................................................................................................................. 102
5 -15.600[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  13  6IFREIINDMDTLKRHISVINVLLEQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGAILTPDFIEHKEQIIADAEKV......................................................................................................................................................................................................... 89
6 -14.600[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  16  1.....MELSPVFARRLYLALLVESLERNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNNDGYYQLSDWGPFDSQWVTERKKDIAAS...................................................................................................................................................................................................... 90
7 -14.400[K] COG3355 Predicted transcriptional regulator  ali follow..  22  26...........SKSDVEVLHILLQGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKA............................................................................................................................................................................................................................... 76
8 -14.100[K] COG4190 Predicted transcriptional regulator  ali follow..  11  66.........TLTPRVLELIEAIRQEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDG.............................................................................................................................................................................................................................. 119
9 -13.900[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  15  2...........KMKTLFLLIKLAEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRVELTEKGINLLEKLYEEISTALYSGFIVGEVISGIGEGAYYVRQYAPLIREYLGFDPYPGTLNVRVLFPKTIFDALCTARPIIIPGFTRNGRTFYRVRIDGIEGAIVIPSKIAEIIAPVKLRDALNLKDGDKVRIEVV.................................................................................... 212
10 -13.800[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  12  82...........SPIEILILHSIRDREKKLADICLALDIETHIATYAIRKLEKAGLLTTGKAAVKITAKGAEACAHYAQIRERL------------------------VDSTANARPSEETLSELAALLRFMSGAFNQATR................................................................................................................................................ 194
11 -13.800[K] COG1777 Predicted transcriptional regulators  ali follow..  14  4.DIDNFIAAIENSTRREIIRMLTQERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSSVGAKRKLYEPTGFSTLIVDYGRNF----------------LMIQRIPLENDSERVSVSFDEAISKLESIQHHIEELTKKRTELVKKKDELMAAIKYQLEDEDPITREIVLEYLNTFDVEEVSRRTALPLEIV....................................................................................... 184
12 -13.500[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  16  12...DLLKAIGLKKNEIRIYRLLVERGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQYTPVSPLEILQKIKEHLMKSIEELER.................................................................................................................................................................................................... 105
13 -13.300[K] COG1695 Predicted transcriptional regulators  ali follow..  23  2...........DRYAIKALVLLSKKPRTSKEISTGVQVSHGTLMPMIRKLLQERYIDFETRGYHLTERGSRFVESLGK.............................................................................................................................................................................................................. 76
14 -12.400[K] COG1846 Transcriptional regulators  ali follow..  18  41...........TPSEIHTIDAITDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPVVLTDKGREAYRAHADMHAAF......................................................................................................................................................................................................... 120
15 -12.200[K] COG1654 Biotin operon repressor  ali follow..  19  1........MKDTTVPLTLISLLADGEHSGEQLGERLGMSRAAINKHIQTLRDWGV-TVPGKGYSLPEPIQLLDAD................................................................................................................................................................................................................. 70
16 -11.600[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  13  176..EKKVVSALQNATNQRIISEIQNGKNTNLALAREIGVSRATISWYVKNLKETGLIDETRSGYSINPSYEPLIEKY................................................................................................................................................................................................................ 254
17 -11.400[K] COG4738 Predicted transcriptional regulator  ali follow..  13  27...ELLRRLNINRPVALTLACLSKDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKYKLTVIDTIEENVIAESKTILQNIERLKSL................................................................................................................................................................................................ 132
18 -11.400[K] COG1510 Predicted transcriptional regulators  ali follow..  14  29........MPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEK.................................................................................................................................................................................................................................. 78
19 -11.300[K] COG1414 Transcriptional regulator  ali follow..  12  6LETDDRYRAPALDKGLDILELLASGGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDYSLTL----LFGLAQLHAPVRRLASFATPFMRELADRSKQAN--QLAVFDRGSVVVIAQQEA--------DYWGISIRVGSHISLFDTGSGHVLLAFRSPEEREMMIAAHVKSRDEVNLDQDFYDRLDQIRERGYEMMASAQMAGAYNL-----SAPILGPDGTCVAALTCPYITLVNP--TQTISLLQKTVRDLSKL........................ 255
20 -10.800[K] COG1497 Predicted transcriptional regulator  ali follow..  15  7.........KGELTRFQILSEIAMRYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSGRYKITRRGDEVLESMSFYRSVWPAIAWEDLQEGDKVEDVALSELGGTIPLQRGKVTIAVLPGISEDLERLRELSRGHDRTLNLQVDFEFATPHAALAAAKRGLNVLVLAVGKMSRSITEKLEKE................................................................................................... 250
21 -10.600[K] COG1733 Predicted transcriptional regulators  ali follow..  22  18........VLCTRWTMVLMRELVAGSTRFNDLRRGVKMSPTLLSQRLKELELAGIVERKE-DYRLTEAGRDLRPVVEAM............................................................................................................................................................................................................. 96
22 -10.500[S] COG2469 Uncharacterized conserved protein  ali follow..  14  189..EKSKPKEKLSEVEEQILTMVYTG-VDSVSVESILGVTTEELNKMYDRLVNLGLARVIRKEIELTPRGVALVSEIMK.............................................................................................................................................................................................................. 265
23 -10.500[K] COG2973 Trp operon repressor  ali follow..  14  52............GTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAP...................................................................................................................................................................................................................................... 93
24 -10.500[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  18  247...........SPELCEVLDIIRGGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLR-------NGR...................................................................................................................................................................................................................... 300
25 -10.500[K] COG1378 Predicted transcriptional regulators  ali follow..  11  28...EVLKRLGFRDYEARVYATLATGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKSSFRAIDPESVLEEYKEQLVSAVDTAI------RSIRESEDFSTLHPVWCVRGLAGIK----------NRAKAMLQRSEEVITAKRVYLDMILKIKSPEDITVVTDNAEKFSDLSVKTLELKKEFSGIFNDA------VIDGVRYRFELLLISGYESFGVYRAGDE--LLGVSISLPIIILFQRMIFLGLLAK............................... 259
26 -10.100[K] COG2345 Predicted transcriptional regulator  ali follow..  18  15...........GDTRRKILLILLEAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAERPAKTYRLTDKGR-LAAAALATLREVGGDDAVRQFARKRIETIVEGITPAD----------VTDQSIEDTAKSLVEAFSRHGYAATVDAT---------LQLCQHHCPISTVATEQAVSELLGQHTQPLATIADGHG.......................................................................................... 214
27 -9.970[S] COG4754 Uncharacterized conserved protein  ali follow..  10  18...............LYVMNNIFDGKTDLYQLEKEMEVDIDDLMPIVYTASRLGFVSAESGDIIVTEEGKEYIRA................................................................................................................................................................................................................. 77
28 -9.630[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  15  142.........PFTPKRAQVVCVLLDAPQPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVRTDELL.................................................................................................................................................................................................................... 208
29 -9.010[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  22  2.......VLMHTDRIEEYLETINQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPQGVELTEKGAEEAVRIKRKHQVLETF...................................................................................................................................................................................................... 87

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]