current user: public




COG4742
Query: [K] COG4742 Predicted transcriptional regulator, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MQSELIDVVFRSQKRRDLLLLLGEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARALVDVLTLVEKDNYWIEHDLGGIPQYLLDKIGEIKDCNLVKADPSQIFEPNTELLEYFASSRYLMVFSSFYRPEFLPLYSKLGRLESEVSLIFTESVLEKFLYNYEKKIRRLATMDNTELCVCKDGVKIAELIVSDRGMMISLFDSQGRFYHEYMYCSEPQAISWARELFDFYESRALRVDGEKSLDSFICTPESGAFSESLLLSLHLast
1 -112.000[K] COG4742 Predicted transcriptional regulator  ali  100  1MQSELIDVVFRSQKRRDLLLLLGEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARALVDVLTLVEKDNYWIEHDLGGIPQYLLDKIGEIKDCNLVKADPSQIFEPNTELLEYFASSRYLMVFSSFYRPEFLPLYSKLGRLESEVSLIFTESVLEKFLYNYEKKIRRLATMDNTELCVCKDGVKIAELIVSDRGMMISLFDSQGRFYHEYMYCSEPQAISWARELFDFYESRALRVDGEKSLDSFICTPESGAFSESLLLSLH 284
2 -22.900[K] COG1777 Predicted transcriptional regulators  ali follow..  11  4.DIDNFIAAIENSTRREIIRMLTQERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSSVGAKRKLYEPTGFSTLIVDYGRNF---------------IQRIPLENDSERVSVSFDEAISKLESIQHHIEELTKKRTELVKKKDELMAAIKYQLEDEDPITREIVLEYLN-----------------TFDVEEVSRRTALPLEIVLKILKSKGIVLDEG........................................................... 198
3 -20.000[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  18  13.ELVSIFHAADSEVKRKLLLDLSTGWITLPVIEQKYG---KEGRRALLYLDKIKMIETQ................................................................................................................................................................................................................................. 67
4 -19.900[K] COG4190 Predicted transcriptional regulator  ali follow..  10  57FTSYDDLMDTLTPRVLELIEAIRQEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRK........................................................................................................................................................................................................................... 122
5 -19.700[K] COG3432 Predicted transcriptional regulator  ali follow..  35.............GTMEIMFDICEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSELLRTDSE...................................................................................................................................................................................... 130
6 -18.600[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  14  6IFREIINDMDTLKRHISVINVLLEQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGAILTPDFIEHKEQIIA.............................................................................................................................................................................................................. 84
7 -16.900[K] COG2345 Predicted transcriptional regulator  ali follow..  17  7...GNDAHTGDGDTRRKILLILLEAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRYRLTDKGRSIFGHEYDSLAAAALATLREVGGDDAVRQFARKRIETIVEGITPAD--VTDQSIEDTAKSLVEAFSRHGYAATVDATRNGLQLCQISTVATEFPEL---AEHQAVSELLGQHTQPLATIADGHGICTTNIP................................................................................... 221
8 -16.700[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  17  1MSEKEIDELINDYDMLRVLKHFTIHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTYQINKKAEAVLKEITP.............................................................................................................................................................................................................. 102
9 -16.600[K] COG3355 Predicted transcriptional regulator  ali follow..  22  26...........SKSDVEVLHILQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKA............................................................................................................................................................................................................................... 76
10 -15.900[K] COG1733 Predicted transcriptional regulators  ali follow..  20  12..LSMAAEVLCTRWTMVLMRELVAGSTRFNDLRRGVKMSPTLLSQRLKELELAGIVERKIFDYRLTEAGRDLRPVVEAMGFW.......................................................................................................................................................................................................... 99
11 -15.700[K] COG4738 Predicted transcriptional regulator  ali follow..  14  26..VELLRRLNINRPVALTLACLKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKYKLTVQMETIIDTIEE.............................................................................................................................................................................................................. 113
12 -15.600[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  15  12...DLLKAIGLKKNEIRIYRLLKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQYTPVSPLEILQKIKEHLMKSIEELER.................................................................................................................................................................................................... 105
13 -15.400[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  13  175.EEKKVVSALQNATNQRIISEIQNGKNTNLALAREIGVSRATISWYVKNLKETGLIDETRSGYSINPSYEPLIEKY................................................................................................................................................................................................................ 254
14 -14.700[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  16  2...........KMKTLFLLIKLAEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRVELTEKGINLLEKLYEEISTALYSGFIVGEVISGIGEGAYYVRQYAPLIREYLGFDPYPGTLN----RVLFPKTIFDALCTARPIIIPGFTRRAYRVRIDGIEGAIVIPSKIAEIIAPVKLRDALNLKDGDKVRIEVV.................................................................................... 212
15 -14.400[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  17  1MELSPVF-----ARRLYLALLVESLERNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDYQLSDWGQWVTERKKDIAASLG........................................................................................................................................................................................................ 92
16 -13.900[K] COG1510 Predicted transcriptional regulators  ali follow..  10  30...........PSTVGRVLGIINRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFA--ANWTKVVSKNKVLYKKLNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKECSSLK..................................................................................................................... 185
17 -13.600[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  16  82...........SPIEILILHSIRDREKKLADICLALDIETHIATYAIRKLEKAGLLTTGKAAVKITAKGAEACAHYAQIRERL......................................................................................................................................................................................................... 160
18 -13.500[K] COG1654 Biotin operon repressor  ali follow..  22  1........MKDTTVPLTLISLLADGEHSGEQLGERLGMSRAAINKHIQTLRDWGVFTVPGKGYSLPE......................................................................................................................................................................................................................... 62
19 -13.300[K] COG1497 Predicted transcriptional regulator  ali follow..  24  2....KALRKKGELTRFQILSEIRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSGRYKITRRG....................................................................................................................................................................................................................... 70
20 -13.300[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  14  5VDGNILRSLNRSELRRKVLFYLLSYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKFKINPEIVEEVRNMKNMFS........................................................................................................................................................................................................... 103
21 -13.100[K] COG1695 Predicted transcriptional regulators  ali follow..  23  6...............IKALVLLSKKPR-SKEISTGVQVSHGTLMPMIRKLLQERYIDGREKVYHLTERGSRFVESLGK.............................................................................................................................................................................................................. 76
22 -12.800[K] COG0640 Predicted transcriptional regulators  ali follow..  17  1............................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMGYRIAP------EKFEDMVDWLDSILH.................................................................................................................................................................................................... 58
23 -12.700[K] COG4189 Predicted transcriptional regulator  ali follow..  12  12.KEFDVLKAAASLIRVQILKLLHENGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKQKICF--ATCDELIVSFRKPETPAASNYIAVAMPLGLYTQSSVTAPCGICSPEGIIGLLDVPDTFMDPDRMKTALLWLTSGFVEYQFPNNAKIQGRNVEE-IEFSMEVSSEV-PGTHSNWPSDITLSVNGKEIGVWTSPGDFG----------------DKRGVFT------------DWWKLSGSQY--------------KTWRITPQGTYVDGTRIS.. 256
24 -12.600[K] COG1846 Transcriptional regulators  ali follow..  18  41...........TPSEIHTIDAITDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPVVLTDKGREAYRAHADMHAAF......................................................................................................................................................................................................... 120
25 -12.500[K] COG1378 Predicted transcriptional regulators  ali follow..  11  27..IEVLKRLGFRDYEARVATLATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKSSFRAIDPESVLEEYKEQLVSAVDTAIRSIRESEDFSTLHPVWCVRGLAGI----------------KNRAKAMLQRSEEVITAKRVYLDMILKIKSPEDITVVTDNAEKFSDLSVKTLELKKEFSGIF------DAVIDGVRYRFELLLISGYESFGVYRAGD---ELLGVSISLPIIILFQRMIFLGLLAK............................... 259
26 -12.200[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  13  13..LNELVGRAAGEVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRR.............................................................................................................................................................................................................................. 72
27 -12.100[S] COG2469 Uncharacterized conserved protein  ali follow..  16  198...........SEVEEQILTMVYTG-VDSVSVESILGVTTEELNKMYDRLVNLGLARVVKIRIELTPRGVALVSEIMK.............................................................................................................................................................................................................. 265
28 -11.000[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  17  247...........SPELCEVLDIIRGGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNG.............................................................................................................................................................................................................................. 299
29 -10.900[K] COG1414 Transcriptional regulator  ali follow..  12  6LETDDRYRAPALDKGLDILELLASGGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDYSL---TLKLFGLAQLHAPVRRLASFATPFMRELADRSKQANQLAVFDRGSVVVIAQQEAP---------DYWGISIRVGSHISLFDTGSGHVLLAFRSPEEREMMIAAHVKSRDEVNLDQDFYDRLDQIRERGYEMMASAQMAGAYNLS-----APILGPDGTCVAALTCPYITLVNP--TQTISLLQKTVRDLSKL........................ 255
30 -10.600[K] COG2973 Trp operon repressor  ali follow..  15  53.............TRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKA........................................................................................................................................................................................................................................ 91
31 -10.300[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  25  8..........RIEEYLETILYLITGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPQGVELTEKGAEEAVRIKRKHQVLETF...................................................................................................................................................................................................... 87
32 -9.790[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  15  142.........PFTPKRAQVVCVLLDAPAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVRTDELL.................................................................................................................................................................................................................... 208
33 -9.560[S] COG2739 Uncharacterized protein conserved in bacteria  ali follow..  17  18.........LLTTKQKSYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEES--LEKYEEKLGMLRKYQQREKLFDQLEAQLTKKNFLDEQVKDTLEQLKN...................................................................................................................................................................................... 108
34 -9.540[K] COG1522 Transcriptional regulators  ali follow..  13  1.....MSKVELDKIDRKILEVLQNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIRQYAALLDPGKIGLGLSAYIN-----VRLEKQGGAPKGKAPSDIFRAAVATWPEVVTCYAMTGEMDYLLKVFRFIRDQLLAHPAVIDVKSSF........................................................................................................................................ 147
35 -9.280[L] COG2963 Transposase and inactivated derivatives  ali follow..  8.........YSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWVTAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKAAVDSICQCN.......................................................................................................................................................................................... 96
36 -9.170[K] COG0583 Transcriptional regulator  ali follow..  15  6...........DWDKLRIFHAAAEA--SFTHAAQTLHLSQSAISRQVSALEQDPLFHRHARGLILTEQGETLYRTAHDVLMKLENVRSK---------------------------LAESREKPSGRLRVTTTVGLGSGWLIERIQEFVELYPDVQLQLILDNEELDLT................................................................................................................... 138

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.