current user: public




Query: [S] COG4704 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MRKKWAVSLILLTTLGNLAWSWSARANFNGKLTVEIDGLKNKQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAGTYAVAAIQDLNGDGTLNRNDLGMPVEPFGFSRNPEVRTSAPKFGDAAFILAGRNTTIQVQMKKLLast
1 -83.200[S] COG4704 Uncharacterized protein conserved in bacteria  ali  100  1MRKKWAVSLILLTTLGNLAWSWSARANFNGKLTVEIDGLKNKQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAGTYAVAAIQDLNGDGTLNRNDLGMPVEPFGFSRNPEVRTSAPKFGDAAFILAGRNTTIQVQMKKL 151
2 -8.880[S] KOG3306 Predicted membrane protein  ali follow..  11  6IIRSSPTLAFIVLQICFIFFASTFPCSSGSEDSYTI------TGRVKINVIGHIAKFSNVKVILNGGQKITFLRPDGYFTFHEVPAGTHLIEV.......................................................... 95
3 -8.240[S] COG3656 Predicted periplasmic protein  ali follow..  25AAALGASRVVPGALAEAATSSKAWASGMQLDIQFSVATIEDESGKTVRTLTQQRRLNPRWLEESLRRWTRDNGQLVSTVSSATRNPGTYAVA-WDGKTDKNAL------APQGDYYVCVESGREHGPYGLVRQKVSVGTSAFKKSLG.... 181
4 -7.650[R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins  ali follow..  1MPGSPRPAPSWVLLLRLLALLRPPGLGEACSIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQIT............. 161
5 -7.510[R] KOG4680 Uncharacterized conserved protein, contains ML domain  ali follow..  11  1MSRIFAILPLAAVFLLLLVSPIVAIDAPGEPATFTISANTGSFGKLVIEVSYFGWHVHSETHDLCTETSCPIQTGDFLVAHGYTPPGSYLLKMKMLDAKKKEL................................................ 135
6 -7.180[P] COG2032 Cu/Zn superoxide dismutase  ali follow..  10  3MKTLLALAVSAVCSVSVAQAHEHNTIPKGASIEVKVQQLDPVNGNKDVGTVTITES---------------NYGLVFTPDLQGLSEGLHGFHI-HENPSCEPKEKEGKLTAGLGAGGHWDPK............................. 108
7 -6.830[S] COG4929 Uncharacterized membrane-anchored protein  ali follow..  10  1MLKSIAVIIVALIMVNISIYQKQHLLAKGDIIILELAPVDPRQGDYMALSYAFNEQFNAEQEKCREEPLLLCPESKRRLIVELDDRQRATAARIDQGEPQYRFKGRSIQIGTDAYFFQEGHAEDYVNARYGEFRVAKDGSALLTHLLDA.. 168
8 -6.780[M] COG1361 S-layer domain  ali follow..  651.......................LPGTSNVEISFKIENVGDGK-YIIIMPNPQFPFKLSETSDQIINVGSLGKGDSAQASFENAKSGRYLIPLYKDPTGKFRQIEVNIPVIIAE-------KPKLVITDVRFGEKPVQGKDVNIYITVK.. 778
9 -6.750[S] COG4315 Uncharacterized protein conserved in bacteria  ali follow..  12  1MRAHHFVLAGAMALASTAALAEPYAGGAVVEKATAKGTILTDAKGMTLYTFDNDGDASSACYDGCAKKWPPLAALK-----TDKADGDYKPIARKD----GTMQWSHDGKPLYRWQMDKKPGDITG......................... 117
10 -6.560[S] COG2968 Uncharacterized conserved protein  ali follow..  11  1MKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSGATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFNKSGIEKKDVKAANIRTQPEYDYQKSGE----------KGYRAVRQVQVTLGLNEIRAVELGVASPET......... 157

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.