current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG4704
Query: [S] COG4704 Uncharacterized protein conserved in bacteria, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MRKKWAVSLILLTTLGNLAWSWSARANFNGKLTVEIDGLKNKQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAGTYAVAAIQDLNGDGTLNRNDLGMPVEPFGFSRNPEVRTSAPKFGDAAFILAGRNTTIQVQMKKLLast
1 -82.500[S] COG4704 Uncharacterized protein conserved in bacteria  ali  100  1MRKKWAVSLILLTTLGNLAWSWSARANFNGKLTVEIDGLKNKQGQVCVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAGTYAVAAIQDLNGDGTLNRNDLGMPVEPFGFSRNPEVRTSAPKFGDAAFILAGRNTTIQVQMKKL 151
2 -10.300[P] COG2822 Predicted periplasmic lipoprotein involved in iron transport  ali follow..  15  1MTINFRRNALQLSVAALFSSAFMANAADVPQVKVTVTDITVNAGKTQFIIQNHSQEWEILKGVMVVEERENIAPGFSQKMTANLQPGEYDMT........................................................... 102
3 -10.100[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  12  1MEFTMKKTTFTLAAASLILVSYSASSADDARIRLATTTSTYDSGLLLLPKFEQDTGY-----------KVDVIATGTGKALKMGENGDVDLVMTHAPKAEASFVEA--GFGVLPRKLMYNDFVVVGPES...................... 118
4 -8.540[S] KOG3306 Predicted membrane protein  ali follow..  13  8RSSPTLAFIVLQICFIFFASTFPCSSGSEDSYTI--------TGRVKIPVIGHIAKFSNVKVILNGGQKITFLRPDGYFTFHEVPAGTHLIEV.......................................................... 95
5 -8.530[S] COG4929 Uncharacterized membrane-anchored protein  ali follow..  1MLKRKWLSIAVIIVALIMVNISIYQKQKGDIIILELAPVDPRQGDYMALSYAFNEQFNAEQEKCREEPLLLCPESKRRLIVELDDRQRATAARIDQGEPQYRFKGRSIQIGTDAYFFQEGHAEDYVNARYGEFRVAKDGSALLTHL..... 165
6 -8.290[S] COG2968 Uncharacterized conserved protein  ali follow..  12  1MKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSGATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFD-NKSGIEKKDVKAANIRTQPEYDYQKSGE................................................. 108
7 -7.760[M] COG5386 Cell surface protein  ali follow..  15  1MKKLWKKGLVAFLALTLIFQLIPGFASAADS--------------------------------------------------RLKDGGEYQVNFYKDNTGKTTKESSEAD---------------------HTATIKVENGQPYMYLTIT.. 84
8 -7.720[P] COG4454 Uncharacterized copper-binding protein  ali follow..  10  1MTRLKLALLLTALATPAFAGGTHSGSKVTQTIQVTMKEFEFKKGKVRFAVKNVGEAKAPEMEHDNPNAISLAPGESGEIVWKFTNDGMFEFAC----LKPGHYEAGMRGD......................................... 152
9 -7.660[S] COG5436 Predicted integral membrane protein  ali follow..  8LRRLFVLLGLVGAGIVHIVVLLLVPEFSERDAWSRLSMASDLYRMNRLDAEAGGAPVVKSVDPLFYATACRFDLEEGMVRIKAPGNVPFWSVSVYDRNGHNIYSFNDHTATGGKLDAAQMIDVRKDLPEGLQGAIFVEAPIDEGIFVIRSF 165
10 -7.650[T] COG3103 SH3 domain protein  ali follow..  1MPKLRLIGLTLLALSATAVSHAEETRYVSDELNTWVRSGPGDHYRXVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQKLKNELI.. 149

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]