current user: public




Query: [Q] COG4663 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MDRRSFIKHASIGGLGAAAASALAAPAIAQTNPKVTWRLTSSFPKSLDTIYGGAEVLSKYVSEATDGNFQIQVFAAGEIVPGLQAADAAAAGTVEACHTVAYYYWGKDPTWALGAAVPFALNARGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTGVQMGGWFRKEIKTVADMKGLKMRVGGFAGKVMERLGVVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHAMFNKAAFDGLPKAYQSLLRTACQATDANMLQKYDYLNPSAIKRLVAAGAKLSPFSPEILSACFDESNKVYAEMEASNAPFKKIWESIKAFRAEYFLNAQIAEYNYDTFMMIQQRNGKILast
1 -122.000[Q] COG4663 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component  ali  100  1MDRRSFIKHASIGGLGAAAASALAAPAIAQTNPKVTWRLTSSFPKSLDTIYGGAEVLSKYVSEATDGNFQIQVFAAGEIVPGLQAADAAAAGTVEACHTVAYYYWGKDPTWALGAAVPFALNARGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTGVQMGGWFRKEIKTVADMKGLKMRVGGFAGKVMERLGVVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHAMFNKAAFDGLPKAYQSLLRTACQATDANMLQKYDYLNPSAIKRLVAAGAKLSPFSPEILSACFDESNKVYAEMEASNAPFKKIWESIKAFRAEYFLNAQIAEYNYDTFMMIQQRNGKI 368
2 -31.600[G] COG1638 TRAP-type C4-dicarboxylate transport system, periplasmic component  ali follow..  21  2........RKLLLTTTAIAFAVGAAAPAMAEFNSRNIRVSNGINQDHP-VGNGIKAMQACLDDKSGGKLKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGLIPSLGVFD-LPFLFANDKEADAVMDG-GDMMNKKL-EEQGLVNLAYWENGFRNLSNSKHAVNKWEDFSGLKVRVNNIFLDTFQNLGANATPMAFGEVFSALETNAIDAQE--NPYV-DTSKFYEVQKYVTETN--HAYTPFLFLFSKPIFDSYTPEEQTALRECAVVGRDEERKVIRELNQKSLEKIKAAGLEVNTLSPEEQTRIREKSMVVYEKHKAEADVVDAVLADLKKIRGQ......................... 335
3 -7.040[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  15  8FSRRKFIFTAGASASAVFLKGCLGNPPETTG--------GTQSAPTAQPAANVSAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASW---GGIDGGQWQMPMPHLITEGLITK--THGNGIAIANKHQGSGIGLRLASAKSLFSKPTPFTAAQTFPAVNQDFWIRYWLAAGGIDPDADVKLLTVPSAQTVANMKTGTMDAFSTGDPWPFDKVGFMAALTA------WKNHPEEYLAMRSDWVDQHPKATKALLKGLMEAQQ-------NFDNRKELAEIVAARAYFNV-PVDVLIDPYMGKYDMGEGRQIDDRSMAALYWKDEKFITESVRWGFLPKDYIDNN.......... 391
4 -6.970[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  15  45............................................................FAKESGATVDWRKFDSGA-----SIVRALASGDVQIGN------LGSSPLA---VAASQQVPIEVFLLASKLGNSEALV------------------------VKKTISKPEDLIGKRIAVPFISTAALKHWGVEIVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVL---------WGAPTLDVWVVRKDFEKHPEVVKAFSKSLKQPENISKLARLSGVPEGDVPGLVKGNTQTAELTGPVNKAIIDTAQFLKEQ.............................................. 300
5 -6.570[R] COG0627 Predicted esterase  ali follow..  15  1MKFVDRFRGAVAGMLRRLVVEAMGVALLSALIGVVGSAPAEAFSRP-----GLPVEYLQVPSPSMGRDIKVQFQNGGANSPALYLLDGLRAQDDFSG-TAFEWYYQSG----ISVVMPVGGQSSFYSDWYSPACGSELPQYLQSNKQIKPTGSAAVGLSMAG---------LSALTLAIYHPDQFIYVGSMSGLLDPSNAMGPSLIGLDAGGYKAADMWGPSTD--------------PAWKRNDPTVNV-IWMYCGNGKPTELGGLLEGLVRTSNIKFQDGYNAGGHNAVFNFPDSGTHSWEYWGEQLNDMKPDLQQYLGATPGA.......................................... 330
6 -6.390[K] COG3888 Predicted transcriptional regulator  ali follow..  11  42LEEKGIIKRRTIGGKIKHVWLAEYYPYYDEKLLRIGCLRSTEYVKFV--------SVAKNYSESKGIDLIVRFYDDAI-----SLMNDLSQGLLEFALA---------PIFTEIIYSISNRNSIILGAVASGGSG--------------------------------VYKNVNCNCGKILTSESSSEFAKTRKISEIAIDPRRAIKDYESFKAEYIVIWEPYASKIMG----EKMASFSDVLDSFPCCGISVSENNREN--RTLIEIVRLYKRSRFIDIFAKSTSVSPKTAKASLENYIWDIKFYRSDLKKYLEFIGYPPIEEIIEK......................................... 322
7 -6.260[T] KOG3759 Uncharacterized RUN domain protein  ali follow..  15  565..........................FLGLGRAMHAWELVLAYYRLK------GEEYNNTPARKLSQSFQLDIVDAQAVTAKQSLLSAV--GMILAMHRP----YKRSNNAHFKAFVCAGLNSHLLVEWLN----HELVDTYYSADSYVA----RTG------FRDSLRSIDALSRFDFDLP.......................................................................................................................................................................................... 700
8 -5.990[S] COG5400 Uncharacterized protein conserved in bacteria  ali follow..  13  1MTMRLTKTRTGLGKIVALLASLLMWVTPAFAQTSDQYSIQEVVDAGHGFFGETTGGLAKVVERAFQQYGLPNGYILGQEGSAFVAGLTYGEGTLYTKNAGQHPV---------------------------------------------FWQGPSLGLDYGGQGTRNLPSVDALYRRYGGVAGVGMTYLKSSDVTLAPIIGARLGINVGYLKLTQQPTWNPF.................................................................................................................................................. 198
9 -5.370[R] COG2358 TRAP-type uncharacterized transport system, periplasmic component  ali follow..  17  1MSLSRRFGLFTLAATVTFSTSVFAAPTF----------INILTGGTSGVYYPIGVGLSQIYGHDIQG-AKTSVQATK---ASVENLNLLQAGRGE-----------------------LALALGDSVADAWNGVADAGFKAPLKKLRAIGNTYPNY-IQVVASQASGIKTLADLKGKRISVGAPKSAIFKAAGLSVEYLPYAESVELIKNRQLDATLQSSGLGMAAI---------------DLASTMPITFVAIPADVVAKIDSPAYHAASIPAGTYDGQEQDVPTVAIDNILVSHS----GVSDELAYQMTKLMFDNLPRLVTAHAAAKDI................................... 290
10 -5.060[S] COG5138 Uncharacterized conserved protein  ali follow..  10  2..............................................................................IYPSLRVLRDKCRRVVKIAMEL--------------------MPTLFLVLYFYNRRASIERMGYYDIDDVLA-----DGTEFPCKFQYDIPGLGYLKNTKLSLPLWLARILAIVGGDEVELLPPDMFSTKVMNAIKT-------DPVALDLHSINSHFFSLAIKWIMLFSEKELANVVSELLLQRAQELNHHASSLSIDLNADSTGKNSANTNIATSTFLLKLEEMEKEIYKKSHESYKDTKRWMFKK.......................................... 236

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]