current user: public




Query: [Q] COG4663 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MDRRSFIKHASIGGLGAAAASALAAPAIAQTNPKVTWRLTSSFPKSLDTIYGGAEVLSKYVSEATDGNFQIQVFAAGEIVPGLQAADAAAAGTVEACHTVAYYYWGKDPTWALGAAVPFALNARGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTGVQMGGWFRKEIKTVADMKGLKMRVGGFAGKVMERLGVVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHAMFNKAAFDGLPKAYQSLLRTACQATDANMLQKYDYLNPSAIKRLVAAGAKLSPFSPEILSACFDESNKVYAEMEASNAPFKKIWESIKAFRAEYFLNAQIAEYNYDTFMMIQQRNGKILast
1 -114.000[Q] COG4663 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component  ali  100  1MDRRSFIKHASIGGLGAAAASALAAPAIAQTNPKVTWRLTSSFPKSLDTIYGGAEVLSKYVSEATDGNFQIQVFAAGEIVPGLQAADAAAAGTVEACHTVAYYYWGKDPTWALGAAVPFALNARGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTGVQMGGWFRKEIKTVADMKGLKMRVGGFAGKVMERLGVVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHAMFNKAAFDGLPKAYQSLLRTACQATDANMLQKYDYLNPSAIKRLVAAGAKLSPFSPEILSACFDESNKVYAEMEASNAPFKKIWESIKAFRAEYFLNAQIAEYNYDTFMMIQQRNGKI 368
2 -75.600[G] COG1638 TRAP-type C4-dicarboxylate transport system, periplasmic component  ali follow..  22  1......MRKLLLTTTAIAFAVGAAAPAMAEF-NSRNIRVSNGINQDHP-VGNGIKAMQACLDDKSGGKLKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGLIPSLGVF-DLPFLFANDKEADAVMDGAFGDMMNKKLEEQGLVNLAYWENGFRNLSNSKHAVNKWEDFSGLKVRVMQIFLDTFQNLGANATPMAFGEVFSALETNAIDAQENP-YVTIDTSKFYEVQKYVTETNHAYTPFL--FLFSKPIFDSYTPEEQTALRECAVVGRDEERKVIRELNQKSLEKIKAAGLEVNTLSPEEQTRIREKSMVVYEKHKAE--IGADVVDAVLADLKKIRG...................... 334
3 -16.300[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  12  1............MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKES----GATVDWRKFDSGA-----SIVRALASGDVQIGNLGSS----------------------------------PLAVAASQQVPIEVFLLASKLGNSEA-VKKTISKPEDLIGKRIAVP-SLLAALKHWGIKPVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFSKSAIDAQQPYIANPDVWLKQPENISKLARLSGVGLVKGNTYLTPQQQTAELTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ........... 320
4 -12.200[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  11  8FSRRKFIFTAGASASAVFLKGPAANVSAEQAPEVTTVKLGYIPIVESAPLIIAKEK----FAKYGLTNVELSKQASWG-----SARDNVEIGSAG----------GGIDGGQWQMPMPHLITE------LITKGNQKIPMYVLCQLITHGNGIAIANKHQGSGIGLRLASAKSLFSKLKASPTWIRYWLAAGGIDPLTVPSAQTVANMKTGTMDAFSTGDPWPFRIVKDKVGFMAALTAEIWKNHPEEYLAMRSDWVDQHPKATKALLKGLMEAQQWCDNFDNRKELAEIVAARAYFNVPVDVLIDPYMGKYDMGEGRQIDDRSMAALYWKDEKGSVSYPYKSHDLW..................... 372
5 -11.200[K] COG3888 Predicted transcriptional regulator  ali follow..  30FSKSTVSEALIKRRTIGGKIKHVWLAEYYPYYDEKLLRIGCLRSTEYVKFVSVAKNYSES----KGIDLIVRFYDDAI-----SLMNDLSQGLLEFALAPIF----------------------------------TEIIYSISNRNSIILGAVASG-------GSGVYKNVNCNCGKILTSESSSEFAKTRKISEIFKDPRRAIKDYESFKAEYIVIWEPYASKIMG-----EKMASFSDVLDSFPCCGISVSENNRENRTLIEIVRLFTAREDVIDIFAKSTSVSPKTAKASLENYIWDIKFYRSDLKKYLEFI-----GYPPIEEIIEKIYEEV............................... 327
6 -11.100[R] COG2358 TRAP-type uncharacterized transport system, periplasmic component  ali follow..  15  1......MSLSRRFGLFTLAATVTFSTSVFAAPTFINILTGGTSG----VYYPIGVGLSQIYGHDIQG-AKTSVQATK---ASVENLNLLQAGRGE-----------------------LALALGDSVADAWNGVADAGFKAPLKKLRAIGNTYPNY-IQVVASQASGIKTLADLKGKRISVGAPKSAIFKAAGGKVEYLPYAESVELIKNRQLDATLQSS-----MAAIRDLASTMPITAKIDSPAYHAASIPAGTYDGQEQDVPTVSHSGVSDELAYQMTKLMFDNLPRLVTAHAAAIALDKAAKNLPIPLHPGAERFYKE.............................................. 313
7 -9.760[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  12  1MISRRSALVIAAGLSALALASCSGKSDAPAANNEVTFSILST--ESTQNMESYWTPILKDMEKQTGLKVKPFFSSN------SSLIVAMGAKQTDLGWFSNQSGLEAVRRSNG-----------EVFARTFDPSGTDGYKSVI-----------------IVPADSKIQSVQDLKSLDFGIGDAPMTYVFIPANKKPETCFKTVISAVANGKLDAS-------------STAIGLSKARGEGVTDKIRVIWESPTL-KDIDPVVKEKLRQFFLTYAQGDTPE-AEQQRGYLKRLSIGG--FKPADDTHLLVVREMEATEQAKVAAAQKVLDGVKAERLAAEGKAGVVAQPAN................ 341
8 -8.010[P] COG1464 ABC-type metal ion transport system, periplasmic component/surface antigen  ali follow..  14  1MNKEFIMKFSSLLTIAAAASTLILAGCGEKAVDNNKVKIGVMAGAEAQVA----EVAAKVAKEKYNLDVELVTFTDYVTPN-----AALDDGSIDA---------------NAFQHKPY-------------------LDKQIADRGYKLAIVGNTFVYPIAGYSKQIKSVDELQGARIAVPNDPTNLGRSL----LLLQQQGLLKLREDVGLLATVRDIVENPKKLEILELDA--QLPRSLDDVALSIINTTYASSINLTPEKDGIFVENKESPYVNILVAREANVNAENVQNFKKAYQTDEVAKAASEIFQGGAVKGW................................................ 275
9 -7.530[E] COG2113 ABC-type proline/glycine betaine transport systems, periplasmic components  ali follow..  10  1.....MLKQITAMTAGLLMTIGVAAAAEPESCKTVRFSDVG-------TDITSTTAVASTILEALGYAPQS------KLLSIPVTYASMKNKDIDVYLG------------------------------DWQPSMEADRKPFLEDKSIEVIGPNLTGAKYTFAADAGVKDISDLQLDMINKGDFGLTGWELVESSEQGM--AEVERATKDDWIVFLGWAPHPMNTRYQIDYLSGADAYFGPNYGGADIYTNIRAGYAQECPNVARFV----------TNLRFTLEMENEIMNGILNDGNDPKDAAADWLKAHPEAVAPWLEGVTTFD--GAPAKEAVESALKS......................... 312
10 -6.890[S] COG2006 Uncharacterized conserved protein  ali follow..  1MKRRDFLITSAAALSFLLSGCAIGDRVVEEPPKSNPPRKSVVYVLKTERREEAVSKLMQNFSDFEGSTVGLKANYNSADPFPASTHPKTLSAIVDV------------------------LKEQKAEVFMAERSGMGNTSAVLKTMGILDLA-----DSYDGWVLHQPEDSHWKKGYPFADIFLTVDSVIQTCCLKTHRFGGHFTMSLKNGMVARRWKGHDYMSELHTSPHMRKMIA-PERGTVIEPGLMIASND---AIDAVGVAILTPEVSKGSVFEQEQIARAIEIGLSSGEFEIIPANDDAEKICSEIEAV..................................................... 326

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.