current user: public




COG4608
Query: [E] COG4608 ABC-type oligopeptide transport system, ATPase component, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MGKPLLEVKNLTKSFDINGGFFSRKVGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETFALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTRALLSAVPVPDPDAAKEKILLKGDVPSPSNPPEGCAFHTRCPDCMDVCKIKRPSLHEKEKGHYVACHLYELast
1 -140.000[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali  100  1MGKPLLEVKNLTKSFDINGGFFSRKVGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETFALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTRALLSAVPVPDPDAAKEKILLKGDVPSPSNPPEGCAFHTRCPDCMDVCKIKRPSLHEKEKGHYVACHLYE 322
2 -123.000[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  40  1MTGPMLEIRNLSRCFPIHNA-LGRQTGEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAG--AHSRAHGKKVQMVFQNPGSSLNPRRTVGQSVAVPLDAHGF-PSLQRAKRISELLEMVQLPANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRLDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDEVFYRPQHAYTQLLLASVPVISAEEVAMRPLIDGEIPTAEKL---IELRGASAAAQASNANKTPMRNNQDD.......... 308
3 -115.000[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  39  1MIETLLEVRNLSKTFRYRTGWFRRQT--VEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPL---HFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLASPLHELTKRLIAGHFGEALTADAWR.................................................... 265
4 -105.000[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  36  1MTKPLLQVHELSKSY-----------GGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLAEMRTEWGFVQQNPRDGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDPTRIDDLPAQFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNFHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTDQVLDDPQHPYTQLLVSAALTP............................................................ 257
5 -91.900[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  41  2..MSLLDVKDLRVEFSTQDG-------IVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNGGSAKFEGKEILNLPERELNKVREQIAMIFQDPMTSLNPYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIPRKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKREFNTAIIMITHDLGVVAGSCDKVLVMYAGRTMEYGSVNDIFYNPSHPYAEGLLSAIPRLDTEGEV--PTIPGNPPNLLRLPVGCPYQERCHRVTDRCKREAPILLPFGNSRQRACFSDW 319
6 -88.900[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  34  2...PLLDIRNLTIEFMTSEG-------PVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVSKDTADRFRFNDIDLLQLTPRQRRKVIHNISMIFQEPQSCLDPSESIGLQLIQAIPGWTYKGRHWRKRRAIELLHRVGIKKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMMSKWATRVNVLYCGQTVESAVCEDLLSTPHHPYTQALIRAMPDFGRSLPHKSRLLPGAIPSLEHLPVGCRLGPRCPYAQKTCIE--TPRLRLVKNHAFACHFPL 325
7 -74.200[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  44  271NAPVVLEGRHVEVTFKIGGGFLAGEPLMLRAVDDISIRLQRNQTIGIVGESGSGKSTLGRALLRLL-PSDGLIRFGDRDISTADRQAMRPLRRQMQLVFQDPFGSLSPRMTVGQVITEGLLVHEPNSGKQRDQRAVEALREVGLDPNARNRYPHEFSGGQRQRIAIARAMILKPKMVVLDEPTSALDRSVQKQIVELLRKLQADHELSYLFISHDLSVVRAMADYIIVMKQGKIVEEGPTEAIFSNPQHVYTQTLMAAAIDVTRFRLS...................................................... 538
8 -72.000[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  39  27.AKPLLEVRNLVTEFPLRTG-------VFRAVNDISFSIEPGKTLCVVGESGSGKSVTARSILQIIDSTSGSIILNKADGSDPRGRAIRAVRADIAMIFQEPMSSLSPVHTVGDQITEVLRLHLKMSKAQARAEAIELLRQVEIPEKALDRYAFQYSGGMRQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLISRLQKAHGMAVLFITHDMGVVAQIADDVLVMHHGVVKEYGTVEQIFHKPQDPYTRMLIGSVLKLEQKAEIRL.................................................... 302
9 -60.700[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  34  1....MIEIKSVNKVFYQGDK-------QIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLCAARRNIGMIFQ--HFNLLSSRTVFENVALPLELAGQ-SQQHIETKVTELLALVGLS-EKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQLNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPKTELAHQFIRST............................................................... 244
10 -57.200[D] COG2884 Predicted ATPase involved in cell division  ali follow..  28  1....MITLDHVSKKYK---------SLARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRLRQVIGCVFQD---RLLQQKTVYENVAFALEVIGR-RSDAINQVVPDVLETVGLSGK-ANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRT-GTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEWCGIYGMD............................................................................ 228
11 -55.900[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  29  3.MGVAIEVKGLTKSF-----------GSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELYEIRTLFGVLFQD--GALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLQLVGL-GGDEKKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPREVL-LTSDEPVVRQFLNG................................................................ 244
12 -55.400[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  27  4.NSPLLQLQNVGYLA-----------GDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEI---YRQQVSYCAQTP--TLFGD-TVYDNLIFPWQIRN---RQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEIN-HADKVITLQPHAGEMQEARYEL............................................................................... 224
13 -53.600[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  31  1MSENKLNVIDLHKRY-----------GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINVADKNQLRLLRTRLTMVFQH---NLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRLQRFLKGS............................................................... 255
14 -53.400[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  27  1....MLCVKNVSLRL-----------PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALASCTGELWLNEQRIDILPTA-----QRQIGILFQD---LLFDQFSVGQNLLLALPAT--LKGNARRNAVNDALERSGLE-GAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL.................................................................................... 216
15 -52.300[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  26  1....MLKLTDITWLYH-------------HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPSR-----RPVSMLFQE---NLFSHLTVAQNIGLGLNPGLK-LNAVQQEKMHAIARQMGID-NLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKAS......................................................................... 223
16 -52.300[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  33  1....MINFKNVSKHF-----------GKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNS-PNIDERQIRLEAGMVFQQ---YLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKVGL-EDRAHHYPAELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEE-GMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDSLISNPPSERLREFLQHV............................................................... 239
17 -51.400[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  28  21.RKKVLAVKGLVKAYK----------SQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHQNIAALTTKQMRKWRAKCGMIFQD---CLVPRLDVTNVLLGRLSYTSTLKSEQDQARAIELLQWLNM-LPHALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISEN-DIAVIVNLHSVDLVKDYCTRVIGIAHGRIIFDGPPSMLNDSIIQDIYSDESAEL............................................................... 276
18 -50.900[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  30  2....SIQLNGINCFY-----------GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDTPSDKAIRDLRRNVGMVFQQ---NLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRL-KPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAET-NITQVIVTHEVEVARKTASRVVYMENGHIVEQGDA-SCFTEPQTEAFKNYLS................................................................. 241
19 -50.500[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  34  1....MIELDKLSKTFT------QKNGKEFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTL---RRHIGYVIQQ--IGLFPNMTIEENIMVVPRLLGW-DKARCKEKARELMSMVKLEPKYLQRYPRELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKLGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPADEFVSAFTGQ................................................................ 243
20 -50.300[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  28  3.AENSVEVHRLRKSVGQGE-------HELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRQHVGFVFQS---MLIPTLNALENVELPALLRGE-NSGQSKAGAKALLEQLGLG-KRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAAR-CDRRLRLVNGQLQE...................................................................................... 226
21 -49.800[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  36  2..QPVVHFKNVNKYY-----------GGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLP-----PNRRNVNIVFQD---ALFPHLNVGRNIAFGLELKGL-SSDAIHKRTMELLALVKLQ-DFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVANFIGQS............................................................... 238
22 -49.700[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  27  2..ANMLEVKHINKTY--------KGQVSYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLAHFRRKLGFVFQD---NLLDTLTIGENIMLPLTLEKE-APSVMEEKLHGIAAKLGIE-NLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDDHVTALMVTHDPVSASY-CRRVIFIKDVVLFN...................................................................................... 223
23 -49.600[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  23  16.................................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGCLTPEKRRVGYVFQD--ARLFPHYKVRGNLRYGM-------AKSMVDQFDKLVALLGIE-PLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVMNPWLPKEQQSSI............................................................. 234
24 -48.900[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  30  3.....IEIANIKKSF-----------GRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARD-----RKVGFVFQH---ALFRHMTVFDNIAFGLTVRERPNAAAIKAKVTKLLEMVQLA-HLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFMGEVNRLQGTIRGGQFHVGA............................................... 256
25 -48.500[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  22  1....MINVQNVSKTFILHQ----QNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVVEIRKTVGWVSQ--FLRVIPRISALEVVMQPLLDTGV-PREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTR-GAAIVGIFHDEAVRNDVADRLHPMGASS......................................................................................... 226
26 -48.400[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  35  2..AIKLEVKNLYKIF-LSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKIAMVFQS--FALMPHMTVLDNTAFGMELAGI-AAQERREKALDALRQVGLEN-YAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGV............................................................... 268
27 -47.300[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  32  13PHPTAIELKDVQISFRLADG------GRFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLN--------RKAGYLFQQ--DALMPWKTVLENVAIGLEIAGT-PKAKAREQAREWLNKVGLG-TFGDRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALADRVVIMSAGPRARIMAEYRI............................................................................... 237
28 -47.100[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  27  1....MLNVSGLWAEY-----------QGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSGPS--------AERGVVFQN--EGLLPWRDVVSNVEFGLQLAGM-SKEQRRVTALKMLNRVGLA-GFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLL--GQVVERLSLN................................................................................. 216
29 -47.000[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  22  1....MIRLQDIQVTFN------PGTILENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQR---ANLCARVFQDPLAGTCGALTIEENMALAYM--SLALSNQRRKLFQERISILGLGEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKEFNLTVMMVTHSMKDALACGDRTVMLHQGQIVLDVTGEQRANMGVPELLEMFSKVR---GEELADDSLLLS................................................ 264
30 -45.500[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  25  1....MLEARELLCER-----------DERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDS----YHQNLLWIGHQP--GIKTRLTALENLH-------FYHRDGDTAQCLEALAQAGLA-GFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQ-GGIVILTTHQPLNVAESKIRRISLTQTRAA....................................................................................... 205
31 -45.000[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  23  1MNSPILKVENLTVYQ-----------GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPI-----TKLGNLRHLLGYMPQNFIFDRSFPISVEELVGLGWVAEARHQKREKSAAIATALKRTDTY-HLRNQAIGTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQEGWTVLQVSHDIDMVSRHCDRVLCL--QTVVCTGQPEIALSPQ........................................................................... 240
32 -44.400[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  31  21.LPAAMATEDLHVYY-----------GDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDRMEGQILYDGININR-KEVDLYNVRKEIGMVFQKP----NP-KSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKY--TIIIVTHNMQQAARVSDYTSFFYLGEVVEFSGTSELFTNPQEKQTEDYISG................................................................ 268
33 -44.400[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  27  1....MITLTDCSRRF-------QDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTV----KQPAEVKQRIGVLFGG-ETGLYDRMTAKENLQYFGRLYGL-NRHEIKARIEDLSKRFGMR-DYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKRE-QKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALESLYES............................................................................ 227
34 -43.900[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  17  3YKMSSLQILQGTFRL-----------SDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLS---FEQLQKLVSDEWQRN---NTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGI-TPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQS-GITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEELLQQALVAQLAHSEQLEGVQLPEPDEPSARHALPANEPR......................................... 264
35 -43.600[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  24  2.......VENLSKVYPIALHFWQRRYRQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPF----RRQTAFLRRTSLVMGQ-KQQLIWDLPTLDSLRINGAIYEI-PDQVFEQRLGELSEMLDLT-TELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRYQATVLLTSHYMADITTLCERVLLIHQGQLMYDGDLEALVER............................................................................ 243
36 -42.700[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  21  73INLPKDLAKDTTHRY-----------GANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPDWEEILTHFRGSELQSFIRVVEENLKTAIKPQHVDYIKEVVRGNLGKMLEKLDERGLMEEICADMEL-NQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSVLDYLSDFVCCLY-GKPGAYGVVTLPF-SVREGINVFLAGFIPTENLRFRDESLTFR................................................ 332
37 -41.000[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  26  2...SILTAENLAKSY-----------KSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNR--AQRGIGYLPQE--ASIFRRLTVYENLMAVLEIRKDLTPQQRREKADELIEEFNIS-HIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNR-GLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDE........................................................................... 228
38 -40.600[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  14  10.GDDAIRVSGMQFAYE----------VEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGKHVGGKNVVQVLSRSAFHDTQLVCSGDLSYLGGSWSK-TVGSAGEVPLQGDFSAEHMIFGV--EGTDPVRREKLIDLLDIN---LQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQRGATIVYATHIFDGLETWATHLAYIQDGELNRLSKMTDI............................................................................... 236
39 -40.400[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  22  1....MLTIDHVTKTF-----------GDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVN-------YHISNKIGYLPEER--GLYPKMKVRDQLVYLARLKGM-EKREAVKELGTWLERFNIT-DYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNS-GVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRS............................................................................ 219
40 -40.300[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  26  1MNMSFLKITDLYKSY-----------GSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ-----RDIAMVFQS---ALYPNMTVAGNIAFGMEIRKV-PKPERDKAIQQVADMLQIG-HLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNNPANMFVADFMGS................................................................ 238
41 -40.300[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  23  1....MLKLASISKRF-----------GGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQI--TQMGIARTFQN--IRIFKEMTLLENVVVGMHRH-RAAERRARDRALELLSWVKLD-HKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIR-ARGYTIFMIEHDMRFVMGLCERIAVLNFGRIIAEGPPEAIRNNP........................................................................... 240
42 -40.000[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  21  1....MIEINDVNKKY-----------QQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLA---TILSVLRQENHFT--SRLTVSDLVGFGRYPYSRGRNKNDRQHIDAAMEFLNLM-PLKDRYLDELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADELHKTIILVIHDINFASAYSDHIIAMKNGEVIYRGAPAEIMQPSI.......................................................................... 228
43 -40.000[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  22  2..PSILSISGVSKTYA----------TGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIG----KDYRAARSLIGLVPQE--LTIDAFESVWATVNYSRGLFGK---PPNHGFVEKVLRDLSLW-DKKDAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLRED-GVTIILTTHYIEEAEAMADRVGVINRGEIILVENKAELMHK............................................................................ 224
44 -39.300[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  28  1MGMSAISTETLSLGY-----------GDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVA---KELAILPQGPSAPEG--LTVHQLVKQGRYPYQ---SKEDEEAVERALKATKLE-DMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDL.......................................................................... 234
45 -38.300[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  23  4.SSPSIRVTDLSYSV-----------AGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGELGK--SGVELFGQPLRDIKPAEAA---KRRAVLPQQTPLSFA--YEVLDVVLLGRIPHGQRETVQDRAIAAACLERVGLS-GYETRDVLTLSGGEQQRVHFARTLAIGERVLLLDEPTASLDLAHQHATLRLARELCRE-GVGVLAVLHDLNLAAQYADRVLMLAEGHVIACDHPAVALTPES.......................................................................... 235
46 -37.300[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  29  1MTSKILEIQDLTVSF-----------DGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRI--ARLGVGRKFQTP--RVYLNLTVAENLDLAVNRKK-QATGAEQRSVGGLLETIGLT-PKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAE--SHSIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQIQNDP........................................................................... 236
47 -37.200[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  22  323.....LELRNVTFAYQDNA----------FSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDY---RKLFSAVFTDVW-------LFDQLLGPEGKP---ANPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIH-ADRLLEMRNGQLSELTGEERDAAS............................................................................ 539
48 -35.500[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  23  8.......................QDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMT-SGKGSIQFAGQPLEAWSATKLA---LHRAYLSQQQTPPFA--TPVWHYLTLHQHDK------TRTELLNDVAGALALD-DKLGRSTNQLSGGEWQRVRLAAVVL-AGQLLLLDEPMNSLDVAQQSALDKILSALCQQ-GLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPN.......................................................................... 225
49 -35.100[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  24  464.SSSLQALPKLQGYVELKNITFGYSRLEAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLL---TNSVAMVEQEILGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSM-------DAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNL----RRRGCTCIIVAHRLSTIRD-CDQIIVLERGKVVQQGTHQELWQV............................................................................ 700
50 -34.200[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  24  1....MLSFDKVSTYY-----------GKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTI-----RKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRL---KERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRRE-GVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNP........................................................................... 224
51 -33.900[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  24  224SAAKVIEVEELQL---------------KKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDD--ALMRGIGLLPESKEEGLITSFSILQNIRKYRKAHWFLDLKKELEHTTKAMAQVQVKAQGPYARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAAR-GHSIIMISSELPEVIGMSDRVCVFRSGGIVATVEGEDINSETI.......................................................................... 459
52 -33.500[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  23  323.NAAAMALPKPEKELRVENVTIVPPGERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETL---GRHIGYLPQGVEGTIGENISRFDDNPDPEAIIAAARAAGAHELILRFEK--GYDSDIGEA---TLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKAR-GGIAVVVAHRPSAIGA-VDYILMMEDGRMKAFGPRDEVLSK............................................................................ 562
53 -32.600[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  23  1MAQAAIELIGINKSFG------------VRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPND--AIALGIGMVHQH---MLVDNFSVLEILGAESDALLKSSIAKARSELERLEREYGLEVD-PDAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQ-GKTVVLITHKLREIMAITDNVSVMRQGTMVATRETSKTTVGELAELMVGRRVLLRVEKGEAEAGAVKLA................................................ 259
54 -31.300[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  23  1....MLEIRNLHARIVDDGT---------EIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAG-YEVTEGDILYNGQSILEMDPAE--RATSGIFLAFQYPME---PGVATMEFLKVAMNEQRKARGEEPLKRVKEAAASLNMDMAMLKRPLNVFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAP-DRAFLVITHYQRLLEHIVDSVHVLYRGQVIKSGDKSLALDLEANGY....................................................................... 243
55 -31.200[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  25  364.............................RLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFM-PYQGSLTINGIELRELDHAQW---RQTISWVGQNPLGTIRDNVTLGKHNIADEQVTQTLQAAY----AQEFVEQQGLDYPISDR--AGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ--QRTALFVTHQLQPLQS-VEQILVMENGLLVQAGHFEDLSQQ............................................................................ 571
56 -30.400[R] COG3910 Predicted ATPase  ali follow..  11  1....MLFLDSVAMKEKPEG--REEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPIVRNNSLDRRSHGE-GFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADS-GGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLD..................................................................... 250
57 -30.400[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  29  339.....LTLRDVQFTYPEQSQ---------QALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAAL---RQTISVVPQRVHATLRDNLLLASPGSSDEALSEILRRVG----LEKLLEDAGLNSWLGEG---QLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR--EKTVLMVTHRLRGLSR-FQQIIVMDNGQIIEQGTHAELLAR............................................................................ 562
58 -29.800[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  26  377.............................PILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESL---RKFIGMVPQDTVDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPD--GYKSMVGER---KLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSR--GRTTLVIAHRLSTVIG-ADEIIVLKDGLIAERGTHRHLLDQ............................................................................ 587
59 -29.700[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  26  331QFQSMVSFNSFSKQY-----------GDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGI------------------EVKISYKPQYIKADTPVSVQDFLRG------ITKRFGTSYYEVEIANPLQLE-RIYESLLTELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENNQKTAMVVDHDIYMIDMLSQRLLVF............................................................................................. 523
60 -29.700[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  22  16.NEVVIQATNLGVSFHSGYR-GQEESKIVWPLRNLDFTGYKGEILGIIGSNGAGKTTLCKMLSGILKPDEGELYVDGRVSALFSLG-----------------MGFKKELTGRENAYLNGMMLGI-EKDQIDQFIDEIHEFSGLG-SFIDQPMKYYSSGMKARLGFSVAAFLEPEILILDEALNTGDAAFGKKAAAKMKELVSK-AKMVILVTHSLRYARKNCDRLLWLDRGEIRAIGEPAEVIEK............................................................................ 259
61 -29.300[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  20  381VPPPVIMVQNVNFRYNDETPWI---------YKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNS--------------HLRIARYHQHLHELLDLDASPLEYMMR------AFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDM----ETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKD............................................................................ 593
62 -29.200[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  22  442.....IRFDNVPLVTPNGDVL----------IERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPAKG--------------KLFYVPQRPYMTLG---TLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLC----REKNITLFTVSHRKSLWKY-HEYSLYMDGRGSYRFEQIDDQSDQ............................................................................ 658
63 -29.100[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  29  504.....VDFENVTFTYRTRPH--------TQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAY---DHKYLHRVISLVSQEPVRSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQD--GYSTETGEK---QLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQ--KHTVLIIAHRLSTVEH-AHLIVVLDKGRVVQQGTHQQLLAQ............................................................................ 730
64 -29.000[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  24  328KDEGKLEVERAKGDIEFRHVTFYYPGKDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYR---LGALRNQVALVSQNVHLFND---TVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGELSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQK--NRTSLVIAHRLSTIEK-ADEIVVIEDGRIVERGVHAELLVQ............................................................................ 568
65 -28.900[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  22  505.....ISLRAVPVVTPNCDIV----------VPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPV----------KDVPCMFYIPQRPYMSIG---SLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM----GITLLTITHRPTLWKYHTHILEFDGLGQFRKMNSDEEQKGQ............................................................................ 727
66 -28.500[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  28  453.............................KILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESL---RSSIGVVPQDTVDTIFHNIHYGNLSATEEEVYNAARRAAIHDTIMKFPD--KYSTAVGER---MLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLAS--NRTCIFIAHRLTTAMQ-CDEILVMEKGKVVEKGTHEVLLGK............................................................................ 663
67 -28.400[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  22  410..RTVLESFGVRQRV-----------VERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIP----------SELEPQITEKSILEQIF------DITGDIHLAVEVLNRAGISDALYRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREAKITLIAVTHRKEVINALSDRILYVGYGGVTE...................................................................................... 618
68 -27.000[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  16  3.EGIEIVNTDFSLAY-----------GSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFPD-------------------KDTLRTCFVEHKLQGEE----GDLDLVSFIALDEELQSTSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHT---DITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVE............................................................................ 210
69 -26.900[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  22  669LQPPILGVHNVTFAFPSQKPLF----------IKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQR--------------KNHRLHVGRFDQHSGEHLTAEESAAEYLQRLF--------NLPHEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDI----ESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTI-------NEIVGEFDDYRKEVLDSLGEVVNNPSVVA.................................................... 895
70 -26.700[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  20  426.....VHVVAVEVRTSAGEQL----------IDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTL-------------SRPDGKNETMFLSQLPYVPLG---NLRGVV-----CYPNAPADIPEDTVRDTLTKVALNPDEERDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELP--DCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEKEPLH............................................................................. 637
71 -26.600[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  27  590.............................IVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSL---RKAIGVVPQDTVNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPE--KYETKVGER---RLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCA--NRTTIIVAHRLSTIIH-ADEILVLQQGSIAERGRHEELVLREDGIYAD..................................................................... 807
72 -26.500[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  19  5..WRLIELRVDKYTYPNGR----------VGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVNGLIPNFLGGTLEGKVRVFGEKPN-----PRIAFFVKQNPEEMI--STQVIDELVFPLIQQGF-GWGEAKREAEEVCEELGIG-GLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILRDY------PHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEP................................................................................ 218
73 -24.000[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  23  320LGDKVIEVQNLTKSY-----------GDRTLIDDLSFSIPKGAIVGIIGANGAGKSTLFRMLSGQEQPDSGSVT----------------MGETVVLASVDQFDSMDDKKTVWEEVSNGQDILTI---GNFEIPSRAYVGRFNFKGVDQQKRVGELSGGERGRLHLAKLLQRGGNVLLLDEPTNDLDV----ETLRALENAILEFPGCAMVISHDRWFLDRIATHILDYYEGNFSDYEEWKK................................................................................ 536
74 -23.600[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  21  101......................TARPKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKLKGTVKLNGETL------QSRMLKVISAYVMQDD--LLFPMLTVEETLAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASLSPIPENENRTEFALDLIRELEGSAGG..................................................... 355
75 -16.000[R] COG3044 Predicted ATPase of the ABC class  ali follow..  13  215.....................LEVTLSTPNQGELVGMGIPQGITL-IVGGGFHGKSTLLTA---LERSVYNHIPGDGRERM-VTDVKAMKIRAEEGRCVHN--------------------------------NLSNYINHLPMGKDTTDFSTQDASGSTSQSAWLQESIEAGVTTLLIDEDTSATNFMIRTPLVDRIGQLRDDLGISTLVVMGGSGDYLDVADTVIQMHDYQPVDVTEAREVIAQHPTLRRNECETPLATFTPRALNCA.................................................... 443

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.