current user: public




Query: [E] COG4608 ABC-type oligopeptide transport system, ATPase component, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MGKPLLEVKNLTKSFDINGGFFSRKVGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETFALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTRALLSAVPVPDPDAAKEKILLKGDVPSPSNPPEGCAFHTRCPDCMDVCKIKRPSLHEKEKGHYVACHLYELast
1 -147.000[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali  100  1MGKPLLEVKNLTKSFDINGGFFSRKVGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETFALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTRALLSAVPVPDPDAAKEKILLKGDVPSPSNPPEGCAFHTRCPDCMDVCKIKRPSLHEKEKGHYVACHLYE 322
2 -130.000[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  40  1MTGPMLEIRNLSRCFPIHNA-LGRQTGEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGA--HSRAHGKKVQMVFQNPGSSLNPRRTVGQSVAVPLDAHGF-PSLQRAKRISELLEMVQLPANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRLDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDEVFYRPQHAYTQLLLASVPVISAEEVAMRPLIDGEIPTAEKL---IELRGASAAAQASNANKTPMRNNQDD.......... 308
3 -118.000[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  39  1MIETLLEVRNLSKTFRYRTGWFRRQT--VEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPL---HFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLASPLHELTKRLIAGHFGEALTADAWR.................................................... 265
4 -105.000[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  36  1MTKPLLQVHELSKSY-----------GGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLAEMRTEWGFVQQNPRDGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDPTRIDDLPAQFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNFHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTDQVLDDPQHPYTQLLVSAALTP............................................................ 257
5 -95.800[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  41  2..MSLLDVKDLRVEFSTQDG-------IVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNGGSAKFEGKEILNLPERELNKVREQIAMIFQDPMTSLNPYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIARKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKREFNTAIIMITHDLGVVAGSCDKVLVMYAGRTMEYGSVNDIFYNPSHPYAEGLLSAIPRLDTE-GEVLPTIPGNPPNLLRLPVGCPYQERCHRVTDRCKREAPILLPFGNSRQRACFSDW 319
6 -88.100[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  34  2...PLLDIRNLTIEFMTSEG-------PVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVSKDTADRFRFNDIDLLQLTPRQRRKVIHNISMIFQEPQSCLDPSESIGLQLIQAIPGWTYKGRHWRKRRAIELLHRVGIKKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMMSKWATRVNVLYCGQTVESAVCEDLLSTPHHPYTQALIRAMPDFGRSLPHKSRLLPGAIPSLEHLPVGCRLGPRCPYAQKTCIE--TPRLRLVKNHAFACHFPL 325
7 -76.800[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  44  272.APVVLEGRHVEVTFKIGGGFLAGEPLMLRAVDDISIRLQRNQTIGIVGESGSGKSTLGRALLRLL-PSDGLIRFGDRDISTADRQAMRPLRRQMQLVFQDPFGSLSPRMTVGQVITEGLLVHEPNSGKQRDQRAVEALREVGLDPNARNRYPHEFSGGQRQRIAIARAMILKPKMVVLDEPTSALDRSVQKQIVELLRKLQADHELSYLFISHDLSVVRAMADYIIVMKQGKIVEEGPTEAIFSNPQHVYTQTLMAAAIDVTR.......................................................... 534
8 -76.300[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  39  27.AKPLLEVRNLVTEFPLRTG-------VFRAVNDISFSIEPGKTLCVVGESGSGKSVTARSILQIIDSTSGSIILNKADGSDPRGRAIRAVRADIAMIFQEPMSSLSPVHTVGDQITEVLRLHLKMSKAQARAEAIELLRQVEIPEKALDRYAFQYSGGMRQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLISRLQKAHGMAVLFITHDMGVVAQIADDVLVMHHGVVKEYGTVEQIFHKPQDPYTRMLIGSVLKLEQKAEIRL.................................................... 302
9 -59.500[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  34  1....MIEIKSVNKVFYQGDK-------QIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLCAARRNIGMIFQ--HFNLLSSRTVFENVALPLELAGQ-SQQHIETKVTELLALVGLS-EKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQLNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPKTELAHQFIRST............................................................... 244
10 -55.400[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  31  1MSENKLNVIDLHKRY-----------GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINVADKNQLRLLRTRLTMVFQH---NLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRLQRFLKGS............................................................... 255
11 -54.600[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  33  1....MINFKNVSKHF-----------GKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNS-PNIDERQIRLEAGMVFQQ---YLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKVGL-EDRAHHYPAELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEE-GMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDSLISNPPSERLREFLQHV............................................................... 239
12 -52.400[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  26  4.NSPLLQLQNVGYLA-----------GDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEI---YRQQVSYCAQTPTL----GDTVYDNLIFPWQIRN---RQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEIN-HADKVITLQPHAGEMQEARYEL............................................................................... 224
13 -52.300[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  30  3.....IEIANIKKSF-----------GRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARD-----RKVGFVFQ--HYALFRHMTVFDNIAFGLTVLPRRNAAAIKAKVTKLLEMVQLA-HLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFMGEVNRLQGTIRGGQFHVGA............................................... 256
14 -52.200[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  34  2..QPVVHFKNVNKYY-----------GGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLP-----PNRRNVNIVFQD---ALFPHLNVGRNIAFGLELKGL-SSDAIHKRTMELLALVKLQ-DFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVANFIGQSNFLEGKLLSH..................................................... 248
15 -51.600[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  30  2....SIQLNGINCFY-----------GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDTPSDKAIRDLRRNVGMVFQQ---NLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRL-KPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAET-NITQVIVTHEVEVARKTASRVVYMENGHIVEQGDA-SCFTEPQTEAFKNYLS................................................................. 241
16 -50.900[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  27  1....MLCVKNVSLRL-----------PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALASCTGELWLNEQRIDILPTA-----QRQIGILFQD--ALLFDQFSVGQNLLLALPAT--LKGNARRNAVNDALERSGLE-GAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVPADSSVLDMA---------QWSENYNKLR.......................................................................... 217
17 -50.700[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  27  1....MLKLTDITWLYH-------------HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTP-----PSRRPVSMLFQE---NLFSHLTVAQNIGLGLNP-GLKLNAVQQEKMHAIARQMGID-NLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGK........................................................................... 221
18 -49.000[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  29  3.MGVAIEVKGLTKSF-----------GSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELYEIRTLFGVLFQD--GALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLQLVGLGGDE-KKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPREVLLTSD-EPVVRQFLNGRR.............................................................. 246
19 -48.400[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  21  1....MINVQNVSKTFILH----QQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVVEIRKT-TVGWVSQFLRVIPRISALEVVMQPLLDTGV-PREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTR-GAAIVGIFHDEAVRNDVADRLHPMGASS......................................................................................... 226
20 -48.200[D] COG2884 Predicted ATPase involved in cell division  ali follow..  30  1....MITLDHVSKKYK---------SLARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRLRQVIGCVFQD---RLLQQKTVYENVAFALEVIG-RRSDAINQVVPDVLETVGLSGK-ANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRT-GTTVLMATHDHHIVDSMRQRVVELSLGRLVR...................................................................................... 218
21 -48.000[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  33  2..AIKLEVKNLYKIF-LSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKIAMVFQS---ALMPHMTVLDNTAFGMELAGI-AAQERREKALDALRQVGLEN-YAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGV-------DISQVFSAKDI............................................. 279
22 -47.800[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  27  1....MITLTDCSRRF-------QDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTV----KQPAEVKQRIGVLFGGE-TGLYDRMTAKENLQYFGRLYGL-NRHEIKARIEDLSKRFGMR-DYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKRE-QKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALESLYES............................................................................ 227
23 -47.700[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  28  3.AENSVEVHRLRKSVGQGEH-------ELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRQHVGFVFQ--SFMLIPTLNALENVELPALLRGE-NSGQSKAGAKALLEQLGLG-KRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAAR-CDRRLRLVNGQLQEEA.................................................................................... 228
24 -47.600[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  34  1....MIELDKLSKTFTQKNG------KEFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTL---RRHIGYVIQQ--IGLFPNMTIEENIMVVPRLLG--DKARCKEKARELMSMVKLEPKYLQRYPRELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKLGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPADEFVSAFTGQ................................................................ 243
25 -46.500[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  27  1....MLNVSGLWAEY-----------QGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSGPSA--------ERGVVFQN--EGLLPWRDVVSNVEFGLQLAGM-SKEQRRVTALKMLNRVGLA-GFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLL--GQVVERLSLN................................................................................. 216
26 -46.400[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  34  14.HPTAIELKDVQISFRLADG------GRFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLN--------RKAGYLFQQ--DALMPWKTVLENVAIGLEIAGT-PKAKAREQAREWLNKVGLGT-FGDRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALADRVVIM............................................................................................. 223
27 -45.900[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  27  2..ANMLEVKHINKTY--------KGQVSYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLAHFRRKLGFVFQD---NLLDTLTIGENIMLPLTLEKE-APSVMEEKLHGIAAKLGIEN--LNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDDHVTALMVTHDPVSASY-CRRVIFIKDVVLFN...................................................................................... 223
28 -44.800[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  29  21.RKKVLAVKGLVKAYK----------SQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINDTQNIAALTTKQMRKWRAKCGMIFQD-FCLVPRLDVITNVLLGRLSYTSTLKSEQDQARAIELLQWLNMLPHALQR-AENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISEN-DIAVIVNLHSVDLVKDYCTRVIGIAHGRII--------FDGPPSMLNDSIIQDI............................................................... 268
29 -43.600[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  26  1MNMSFLKITDLYKSY-----------GSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ-----RDIAMVFQS---ALYPNMTVAGNIAFGMEIRKV-PKPERDKAIQQVADMLQIG-HLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNNPANMFVADFMGSPAM............................................................. 241
30 -42.100[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  23  1MNSPILKVENLTVYQ-----------GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPI-----TKLGNLRHLLGYMPQNFIFDRSFPISVEELVGLGWVAEA-IQSREKSAAIATALKRTDTY-HLRNQAIGTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQEGWTVLQVSHDIDMVSRHCDRVTVVCTGQPEIALSPQNL............................................................................... 242
31 -41.500[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  14  10.GDDAIRVSGMQFAYE----------VEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYLGGSWSKT-VGSAGEVPLQGDFSAEHMIFGV--EGTDPVRREKLIDLLDIN---LQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQRGATIVYATHIFDGLETWATHLAYIQDGELNRLSKMTDI............................................................................... 236
32 -40.100[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  22  1....MLKLASISKRF-----------GGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQITQIARTFQTLLENVVVGMHRHLDYGAPGLLLSLPGYRAAERRARDRALELLSWVKLD-HKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIR-ARGYTIFMIEHDMRFVMGLCERIAVLNFGRIIAEGPPEAIRNNP........................................................................... 240
33 -39.800[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  31  21.LPAAMATEDLHVYY-----------GDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDRMEGQILYDGININR-KEVDLYNVRKEIGMVFQKP----NP-KSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKY--TIIIVTHNMQQAARVSDYTSFFYLGEVVEFSGTSELFTNPQEKQTEDYISG................................................................ 268
34 -38.100[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  21  1....MIEINDVNKKY-----------QQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLA---TILSVLRQENHFTS--RLTVSDLVGFGRYPYSRGRNKNDRQHIDAAMEFLNLM-PLKDRYLDELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADELHKTIILVIHDINFASAYSDHIIAMKNGEVIYRGAPAEIMQPSI.......................................................................... 228
35 -36.900[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  22  8................IRVTDLSYSVAGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGELGK--SGVELFGQPLRDIKPAEA---AKRRAVLPQQTPLSFA--YEVLDVVLLGRIPHGQRETVQDRAIAAACLERVGLS-GYETRDVLTLSGGEQQRVHFARTLA-GERVLLLDEPTASLDLAHQHATLRLARELCRE-GVGVLAVLHDLNLAAQYADRVLMLAEGHVIACDHPAVALTPESIRTAYGHEVLV-TQHPCLNCPLIV.................................................. 258
36 -35.500[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  25  16.................................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKG-LTPEKRRVGYVFQD--ARLFPHYKVRGNLR-------YGMAKSMVDQFDKLVALLGIEP--LDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSS........................................................................... 220
37 -35.400[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  26  2...SILTAENLAKSYKSR-----------KVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHN----RAQRGIGYLPQEASIFRRLTVYENLMAVLEIRKDLTPQQRREKADELIEEFNIS-HIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNR-GLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDE........................................................................... 228
38 -35.400[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  21  2..PSILSISGVSKTYA----------TGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDI----GKDYRAARSLIGLVPQE---TIDAFESVWATVNYSRGLFGKPPNHGFVEKVLRDLSL-----DKKDAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLRED-GVTIILTTHYIEEAEAMADRVGVINRGEIILVENKAELMHK............................................................................ 224
39 -35.200[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  24  1....MIRLQDIQVTFN------PGTILENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANL---CARVFQDPLAGTCGALTIEENMALAYM--SLALSNQRRKLFQERISILGLGEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKEFNLTVMMVTHSMKDALACGDRTVMLHQGQIV....................................................................................... 228
40 -35.000[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  24  469......ALPKLQGYVELKNITFGYSRLEAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLL---TNSVAMVEQEILLFGGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSMSGGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR----GCTCIIVAHRLSTIRD-CDQIIVLERGKVVQQGTHQELWQV............................................................................ 700
41 -34.900[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  29  1MTSKILEIQDLTVSF-----------DGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRI--ARLGVGRKFQTP--RVYLNLTVAENLDLAVNRKK-QATGAEQRSVGGLLETIGLT-PKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAESH--SIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQIQNDP........................................................................... 236
42 -34.500[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  21  1....MLTIDHVTKTF-----------GDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVNYHISNKIGYLPEE---------RGLYPKMKVRDQLVYLARLKGM-EKREAVKELGTWLERFNITDYENKKV-EELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNS-GVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRS............................................................................ 219
43 -34.100[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  24  2.......VENLSKVYPIAQHFWQRRYRQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFD----PFRRQTAFLRRTSLVMGQ--QQLIWDLPTLDSLRINGAIYEI-PDQVFEQRLGELSEMLDLT-TELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRYQATVLLTSHYMADITTLCERVLLIHQGQLMYDGDLEALVER............................................................................ 243
44 -34.000[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  26  1MGMSAISTETLSLGY-----------GDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVA---KELAILPQGPSAP--EGLTVHQLVKQGRYPYQ---SKEDEEAVERALKATKLE-DMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVFSMNCQV-TQDPLFGTPLCIPHG............................................... 260
45 -33.800[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  24  1....MLSFDKVSTYY-----------GKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTI-----RKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRL---KERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRRE-GVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNP........................................................................... 224
46 -33.400[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  24  5....................MQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMT-SGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFA-----TPVWHYLT--------QHDKTRTELLNDVAGALALD-DKLGRSTNQLSGGEWQRVRLAAVVL-AGQLLLLDEPMNSLDVAQQSALDKILSALCQQ-GLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPN.......................................................................... 225
47 -32.100[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  24  224SAAKVIEVEELQL----------------KGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDD--ALMRGIGLLPESKEEGLITSFSILQNIRKYRKAHWFLDLKKELEHTTKAMAQVQVKAQGPYARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAAR-GHSIIMISSELPEVIGMSDRVCVFRSGGIVATVEGEDINSETI.......................................................................... 459
48 -32.100[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  29  339.....LTLRDVQFTYPEQS----------QALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAAL---RQTISVVPQRVHATLRDNLLLASPGSSDEALSEILRRVG----LEKLLEDAGLNS-WLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR--EKTVLMVTHRLRGLSRF-QQIIVMDNGQIIEQGTHAELLAR............................................................................ 562
49 -30.900[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  23  402LEKVSDEVRTVLESFGVR-----QRVVERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIP----------SELEPQITEKSILEQIF------DITGDIHLAVEVLNRAGISDALYRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREAKITLIAVTHRKEVINALSDRILYVGYGGVTE...................................................................................... 618
50 -30.200[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  22  323.....LELRNVTFAYQDNA-----------SVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPV---SGEQPEDYRKLFSAVFTDVW-----------LFDQLLGPEGKPANPQLVEKWLAQLKMAHKLELSNGRIV-KLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEMGKTIFAISHDDHYF-IHADRLLEMRNGQLSELTGEERDAAS............................................................................ 539
51 -28.900[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  25  333.....LEVERAKGDIEFRHVTFYYPGKDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYR---LGALRNQVALVSQNVHL----NDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGELSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQK--NRTSLVIAHRLSTIEK-ADEIVVIEDGRIVERGVHAELLVQ............................................................................ 568
52 -28.700[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  24  364.............................RLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFM-PYQGSLTINGIELRELDHAQW---RQTISWVGQNPLL-LYGTIRDNVTLGKHNIADEQVTQTLQAAYAQEFVEQQGLDYP-ISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ--QRTALFVTHQLQPLQSV-EQILVMENGLLVQAGHFEDLSQQ............................................................................ 571
53 -28.500[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  22  332.FQSMVSFNSFSKQY-----------GDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEVK------------------ISYKPQYIKADTPVSVQDFLRG------ITKRFGTSYYEVEIANPLQLER--YESLLTELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENNQKTAMVVDHDIYMIDMLSQRL-LVFEGKPSVYGEAHGPFS--MESGMNRFLENLGITDEETRRPRVNNLGSRLDREQKESGNYYYS............................... 585
54 -28.500[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  28  504.....VDFENVTFTYRTRPH--------TQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYL---HRVISLVSQEPVRSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQD--GYSTETGEK---QLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQ--KHTVLIIAHRLSTVEH-AHLIVVLDKGRVVQQGTHQQLLAQ............................................................................ 730
55 -28.500[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  14  363..............................KLEVMEGEFTDSQIIVMLGENGTGKTTFIRMLAGAFPREEGVQ-------SEIPEFNVSYKPQGNDSKRECTVRQL--------------LHDKIRDACAHPQFMSDVIRPLQIEQ--MDQVVKTLSGGEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIMATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNHFLSHLNITFRRDPTNFRPRINKLESIKDKEQKTAGSYYY................................ 600
56 -28.400[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  24  1....MLEARELL------------ERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDSYHQ------NLLWIGHQPGIKTRLTALENLHFYHRDGD-------TAQCLEALAQAGLAG-FEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISL.............................................................................................. 199
57 -28.100[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  19  4.VWRLIELRVDKYTYP----------NGRVGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVNGLIPNLEGKVRVFGEKPN----------PRIAFFVKQNPEEMI--STQVIDELVFPLIQQGF-GWGEAKREAEEVCEELGIG-GLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILR------DYPHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEP................................................................................ 218
58 -27.700[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  18  4.KMSSLQILQGTFRL-----------SDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLS------FEQLQKLVSDEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGIT-PLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQS-GITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEELLQQ............................................................................ 229
59 -27.400[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  23  1....MLEIRNLHARIVDDG----------EIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILA--YEVTEGDILYNGQSILEMDPAE--RATSGIFLAFQYPME---PGVATMEFLKVAMNEQRKARGEEPLKRVKEAAASLNMDMAMLKRPLNVFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAP-DRAFLVITHYQRLLEHIVDSVHVLYRGQVIKSGDKSLALDLEANGY....................................................................... 243
60 -27.100[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  23  1MAQAAIELIGINKSFG-----------AVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPND--AIALGIGMVHQ--HFMLVDNFSVLEILGAESDALLKSSIAKARSELERLEREYGLEVD--DAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQ-GKTVVLITHKLREIMAITDNVSVMRQGTMVATRETSKTTVGELAELMVGRRVLLRVEKGEAEAGAVKLA................................................ 259
61 -26.600[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  20  381VPPPVIMVQNVNFRYNDETPWI---------YKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIR--------------KNSHLRIARYHQHLHELLDLDASPLEYMMR------AFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDM----ETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETV-------TKWKGGILDYKDHLKNKITSENEKKAKAG.................................................... 610
62 -25.900[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  21  327.....MALPKPEKELRVENVTIVPPGERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETLGRLPQGVELFIGENISRFDDNPDPEAIIAAARAAGAHELILRFEKGYDSDIGEAGST----------LSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKAR-GGIAVVVAHRPSAIGAV-DYILMMEDGRMKAFGPRDEVLSKVLRVPQAQAAKG................................................................ 574
63 -25.700[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  26  377.............................PILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESL---RKFIGMVPQDTVDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPD--GYKSMVGER---KLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSR--GRTTLVIAHRLSTVIG-ADEIIVLKDGLIAERGTHRHLLDQ............................................................................ 587
64 -24.500[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  28  453.............................KILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESL---RSSIGVVPQDTNDTIFHNIHYGNLSATEEEVYNAARRAAIHDTIMKFPD--KYSTAVGER---MLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLAS--NRTCIFIAHRLTTAMQ-CDEILVMEKGKVVEKGTHEVLLGK............................................................................ 663
65 -24.300[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  20  12.....................FSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIA------------NGQLDGFPDKDTLRTCFVEHKLQGEEGDLDLVSFIALDEELQS-----------TSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVE............................................................................ 210
66 -24.200[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  27  590.............................IVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSL---RKAIGVVPQDTVNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPE--KYETKVGER---RLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCA--NRTTIIVAHRLSTIIH-ADEILVLQQGSIAERGRHEELVLREDGIYAD..................................................................... 807
67 -22.000[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  23  308..............................ALKNVSFDIKEGEVVGIIGHNGAGKSTLCKLLTKILTPDEGELELSGETTSLL----------SYGTGFNAQLSGKDNVYLNGMLLG--------IPKERVAQEYPNIVAFSELE-KHMDKPVKSYSSGMKSRLGFSIAATLQPDIFIIDEALSTGDVAFQQKASEKIQEMMER-AKAVIIVSHSMKFVESVCTRAIWLEKGQVRFDGDPEEAVKL............................................................................ 503
68 -22.000[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  22  438.QDNVIRFDNVPLVTPNGDVL----------IERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLT--------------KPAKGKLFYVPQRPYMTLG---TLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK----NITLFTVSHRKSLWKYHEYSLYMDGRGS......................................................................................... 646
69 -21.600[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  19  101......................TARPKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGKGTVKLNGETLQSRMLKVISAYVMQDDLLF--------PMLTVEETLAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASLPR-----FFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKK.............................. 365
70 -21.300[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  22  422.NDGTVHVVAVEVRTSAGEQL----------IDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTL-------------SRPDGKNETMFLSQLPYV---PLGNLRGVVCYPNAPADIPE-----DTVRDTLTKVALNPDEERDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLR--SELPDCIIVSVSHRRAVELLHAQQLELLGGGQ......................................................................................... 625
71 -21.200[R] COG3910 Predicted ATPase  ali follow..  11  22...........................SVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKYPKIRMFLR---EDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRG-IVRNNSLDRRSHGE-GFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADS-GGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDEL----ENIAFLRRFLD................................................................. 250
72 -20.600[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  22  501.KNMSISLRAVPVVTPNCDIV----------VPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGEL----------HIPRPVKDVPCMFYIPQRPYMSIG---SLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM----GITLLTITHRPTLWKYHTHILEFDGLGQFRKMNSDEEQKGQFL.......................................................................... 729
73 -20.300[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  23  669LQPPILGVHNVTFAFPSQKPLF----------IKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQR--------------KNHRLHVGRFDQHSGEHLTAEESAAEYLQRLF--------NLPHEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDI----ESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEV---LDSLGEVVNNPSVVANAAVL................................................... 900
74 -19.300[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  25  320LGDKVIEVQNLTKSY-----------GDRTLIDDLSFSIPKGAIVGIIGANGAGKSTLFRMLSGQEQPDSGSV----------------TMGETVVLASVDQ-DSMDDKKTVWEEVSNGQDILTIGNFEIPSRAYVGRFNFKGVDQQ---KRVGELSGGERGRLHLAKLLQRGGNVLLLDEPTNDLDV----ETLRALENAILEFPGCAMVISHD----RWFLDRIATHILD--YGDEGKVTFYEGNFSDYEEWKKKTLGDAATQPHRIK.................................................... 550
75 -11.300[L] COG0419 ATPase involved in DNA repair  ali follow..  16  492.............................................................................VAIMQLHSMKMNEINRIVDELWKQTYCGTD------------IDTILIRSDSEGKGNRTYNYRVCMVKGDAELDMRGRCSAGQK-RLALAECLGVNCGILALDEPTTNLD-SLAKNLSRIVEFRRKQANFQLIVITHDEQFIRLVNSDAYCSYYYRVKRDTNQKSMVRF............................................................................ 658

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.