current user: public




Query: [V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst MPLLDIRNLTIEFMTSEGPVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVSKDNWRITADRFRFNDIDLLQLTPRQRRKVIGHNISMIFQEPQSCLDPSESIGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMMSKWATRVNVLYCGQTVESAVCEDLLSTPHHPYTQALIRAMPDFGRSLPHKSRLNTLPGAIPSLEHLPVGCRLGPRCPYAQKTCIETPRLRLVKNHAFACHFPLNLEEQLast
1 -126.000[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali  100  1MPLLDIRNLTIEFMTSEGPVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVSKDNWRITADRFRFNDIDLLQLTPRQRRKVIGHNISMIFQEPQSCLDPSESIGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMMSKWATRVNVLYCGQTVESAVCEDLLSTPHHPYTQALIRAMPDFGRSLPHKSRLNTLPGAIPSLEHLPVGCRLGPRCPYAQKTCIETPRLRLVKNHAFACHFPLNLEEQ 330
2 -117.000[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  36  2MSLLDVKDLRVEFSTQDGIVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNGKI-TGSAKFEGKEILNLPERELNKVRAEQIAMIFQDPMTSLNPYMKVSDQLMEVLMLHKGMGK-----AEAFEESVRMLEAVKIPEARKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKREFNTAIIMITHDLGVVAGSCDKVLVMYAGRTMEYGSVNDIFYNPSHPYAEGLLSAIPRLDTE---GEVLPTIPGNPPNLLRLPVGCPYQERCHRVTDRCKRPILLPFGNSRQRACFSDWEAWTK 324
3 -88.900[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  34  4.PLLEVKNLTKSFDINGGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEP----SSGEVYFAGTEITALSEGDMRKRR-RDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTK-----KEQLERVEELLETVGLS--SDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETFALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTRALLSAVPVPDPDAAKEKIL--LKGDVPSPSNPPEGCAFHTRCPDCMDVCKIPSLHEKEKGHYVACHLYE..... 322
4 -87.900[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  30  4.PLLQVHELSKSY----GGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAV----DHGNVTYISRSIFQLAEAKRRLLMRTEWGFVQQNPRDGLRMRVSAGANIGERLLDIGVRHY-----GNIRDEAAHWLREVEID--PTRIDDLPAQFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNFHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTDQVLDDPQHPYTQLLVSAAL................................................................... 255
5 -84.900[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  33  4.PMLEIRNLSRCFPIHNAEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKP----SCGEIRIDGEMIAAGAHSRAHG---KKVQMVFQNPGSSLNPRRTVGQSVAVPLDAHG------FPSLQRAKRISELLEMVQLP--ANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRLDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDEVFYRPQHAYTQLLLASVPVISAEEVARPKIPLIDGEIPTAEKL---IELRGASAAAQASNANK...................... 299
6 -80.700[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  28  4.TLLEVRNLSKTFRYRTGTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEP----TSGELLIDDHPLHFGDYSFRSQ----RIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEP-----EQRRKQIIETMRMVGLL--PDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLASPLHELTKRLIAGHFGEALTADAWRK........................................................ 266
7 -77.200[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  38  6.TILSVKDLRVRFRTLDGAVEAVKGINIHVNAGETVAVVGESGSGKSQTMMAAMSLLASNGE-ATGSVDYRGRNLLTLSKSDLNKVRGAKISMIFQEPMTSLDPLYSIGNQLIEPIRRHRGLNA-----AEAREEALKLLRLVHIPDPERRMKSYPHEMSGGQRQRVMIAMALANDPDILIADEPTTALDVTIQAQILMLLAELQRKLGMAIVFITHDLGIVRRFADRVYVMRQGEVVEEGEAGAIFANPQHAYTKMLLAAEPTGSKAAPPANAPVVLE................................................... 277
8 -71.900[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  33  29.PLLEVRNLVTEFPLRTGVFRAVNDISFSIEPGKTLCVVGESGSGKSVTARSILQIIDSPGYITSGSIILNKADGLDPRGRAIRAVRGADIAMIFQEPMSSLSPVHTVGDQITEVLRLHLKMSK-----AQARAEAIELLRQVEIPNPEKALDRYAFQYSGGMRQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLISRLQKAHGMAVLFITHDMGVVAQIADDVLVMHHGVVKEYGTVEQIFHKPQDPYTRMLIGSVLKLEQKAEIRLARPPLDQTAAPILEV.......................................... 317
9 -54.100[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  28  1..MIEIKSVNKVFYQGDKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKP----TSGQVIVDGVDLTTLSNPQLCAAR-RNIGMIFQH---NLLSSRTVFENVALPLEL------AGQSQQHIETKVTELLALVGLSE---KRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQLNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPKTELAHQFIRSTLDLSIPEDYQVRLQP..................................................... 259
10 -51.700[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  25  5.NSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGESGSGKS----TLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQHVGFVFQS---MLIPTLNALENVELPALL------RGENSGQSKAGAKALLEQLGL---GKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPA-LAARCDRRLRLVNGQLQEEA......................................................................................... 228
11 -51.300[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  20  5.VAIEVKGLTKSF----GSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRP----ERGSILIDGTDIIECSAKELYEIR-TLFGVLFQD--GALFGSMNLYDNTAFPLREHTKKKE-----SEIRDIVMEKLQLVGLGGDE---KKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPR-EVLLTSDEPVVRQFLNGRRI.................................................................. 247
12 -50.800[D] COG2884 Predicted ATPase involved in cell division  ali follow..  26  1..MITLDHVSKKY--KSLARPALDNVNVKIDKGEFVFLIGPSGSGKS----TFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRLR-QVIGCVFQD---RLLQQKTVYENVAFALEV------IGRRSDAINQVVPDVLETVGL---SGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRT-GTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEWCGIYGMD................................................................................. 228
13 -49.600[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  26  1..MINFKNVSKHF----GKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKL-----VITRGQLIVDGLDVNS-PNIDERQIR-LEAGMVFQQ---YLFPHLTALENVAFGPTKVRGTSK-----EEAKKQALALLSKVGLED---RAHHYPAELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEE-GMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDSLISNPPSERLREFLQHV.................................................................... 239
14 -49.000[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  22  23.KVLAVKGLVKAY---KSQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSGEIINYHENGDTQNIAALTTKQMRKWR-AKCGMIFQD---CLVPRLDVITNVLLGRLSYTSTLKSFFKSEQDQARAIELLQWLNMLP---HALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISEN-DIAVIVNLHSVDLVKDYCTRVIGIAHGRIIFDGPPSMLNDSIIQDIYSDESAEL.................................................................... 276
15 -48.700[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  24  4.NKLNVIDLHKRY----GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFL-----KPSEGSIVVNGQTIKVADKNQLRLLR-TRLTMVFQH---NLWSHMTVLENVMEAPIQVLGLSK-----QEARERAVKYLAKVGIDERAQ--GKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRLQRFLKGS.................................................................... 255
16 -48.600[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  24  2..SIQLNGINCFY----GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLL-----MPRSGTLNIAGNHFDFTKTPSDKAIRDRNVGMVFQQ---NLWPHLTVQQNLIEAPCRVLGLSK-----DQALARAEKLLERLRLKP---YSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAET-NITQVIVTHEVEVARKTASRVVYMENGHIVEQGD-ASCFTEPQTEAFKNYLSH..................................................................... 242
17 -48.200[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  19  1..MIRLQDIQVTFNPGTLENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETP----IVGGQVLIDEIDVTKQSVDQRAN----LCARVFQDPLAGTCGALTIEENMALAYMRGKKRGWSLALSNQRRKLFQERISILGL---EDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKEFNLTVMMVTHSMKDALACGDRTVMLHQGQIVLDVTGEQRANMGVPELLEMFSKVR.................................................................... 252
18 -47.800[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  20  2ANMLEVKHINKTYKGQV-SYQALKQISFSIEEGEFTAVMGPSGSGKT----TLLNIISTIDRPDSGDILINGENPHRLKRTKLAHFRRKQLGFVFQD---NLLDTLTIGENIMLPLTLEK------EAPSVMEEKLHGIAAKLGI---ENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDDHVTALMVTHD-PVSASYCRRVIFIKDVVLFNE.......................................................................................... 224
19 -47.000[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  19  1..MLCVKNVSLRL----PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQ-FSCTGELWLNEQRIDILPTAQ------RQIGILFQD---LLFDQFSVGQNLLLAL-------PATLKGNARRNAVNDALERSGLEGAFHQ---DPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL......................................................................................... 216
20 -46.500[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  22  6.PLLQLQNVGYLA----GDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISP----TSGTLLFEGEDVSTLKPEIYRQ----QVSYCAQTPTL-----------FGDTVYDNLIFPWQIRNRQPDPAIFLDFLERFALP--DSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEIN-HADKVITLQPHAGEMQEARYEL.................................................................................... 224
21 -46.100[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  20  1..MINVQNVSKTFQQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKS----TLLRSLYANYLPDEGQIQIEWVDLVTAPARKVVEIRKTTVGWVSQ--FLRVIPRISALEVVMQPLLD------TGVPREACAAKAARLLTRLNVPERLWHLA--PSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTR-GAAIVGIFHDEAVRNDVADRLHPMGASS.............................................................................................. 226
22 -45.800[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  24  1..MLKLTDITWLYH------HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTP----ASGALTIDGVDHTTTPPSR------RPVSMLFQE---NLFSHLTVAQNIGLGLNPGL------KLNAVQQEKMHAIARQMGI---DNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKAS.............................................................................. 223
23 -44.700[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  25  1..MIELDKLSKTFQKNGKEFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPP----TSGRVLIDGQDTADLDEVTLRR----HIGYVIQQ--IGLFPNMTIEENIMVVPRL------LGWDKARCKEKARELMSMVKL-EPKQYLQRYPRELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKLGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPADEFVSAFTGQ..................................................................... 243
24 -43.800[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  24  22FKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEP----TRGQVLIDGVDIAKISDAELREVRRKKIAMVFQS--FALMPHMTVLDNTAFGMEL------AGIAAQERREKALDALRQVGLENYAHA---YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQ................................................................ 272
25 -43.500[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  21  16.TAIELKDVQISFRLADGRFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTP----ASGTVEISGQRLQG----------NRKAGYLFQQ--DALMPWKTVLENVAIGLEIA------GTPKAKAREQAREWLNKVGLGTFG---DRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALADRVVIM-RARIMAEYRIP...................................................................................... 238
26 -43.300[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  23  3...IEIANIKKSF----GRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQ----TSGHIRFHGTDVSRLHARD------RKVGFVFQH---ALFRHMTVFDNIAFGLTVLPRRER--PNAAAIKAKVTKLLEMVQLAHLADR---YPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFMGEVNRLQGTIRGGQ......................................................... 251
27 -43.300[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  20  4.PILKVENLTVYQ----GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPR----RVGQIEIFGRPITKLGNLRHLLGYMPQNFIFDRSFPISVEELVGLGWVAEARHQKSSFLSKLRIQSREKSAAIATALKRTDTYHLRNQ-----GTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQEGWTVLQVSHDIDMVSRHCDRVLCL--QTVVCTGQPEIALSPQNLLATYGP........................................................................ 248
28 -42.900[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  27  1..MLNVSGLWAEY----QGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTP----SAGVITLDNIPVSG----------SAERGVVFQNE--GLLPWRDVVSNVEFGLQLA------GMSKEQRRVTALKMLNRVGLAGFE---HHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGQVVERLSLN...................................................................................... 216
29 -42.700[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  22  3.PVVHFKNVNKYY----GGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQP----SSGEIYLEGKPITHLPPNR------RNVNIVFQD---ALFPHLNVGRNIAFGLELKG------LSSDAIHKRTMELLALVKLQDFADR---MPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVANFIGQSNFLEGKLLSHD......................................................... 249
30 -42.700[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  23  2........LELNFSQTLGNHCL--TINETLPANGITAIFGVSGAGKTSLINAISGLTRP----QKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQD--ARLFPHYKVRGNLRYGMA------------KSMVDQFDKLVALLGI---EPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVMNPWLPKEQQSSILKVTVLEHH......................................................... 243
31 -42.500[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  14  12.DAIRVSGMQFAY---EVEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGKHMVGG---KNVVQVLSRSAFHDTQLVCSGDLSYLGGSWSKT--VGSAGEVPLQGDF-------SAEHMIFGVEGTDPVRREKLIDLLDINLQWRM-----HKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQRGATIVYATHIFDGLETWATHLAYIQDGELNRLSKMTDI.................................................................................... 236
32 -42.200[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  22  1..MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEP----SQGVITVDGFDTVKQPAEVKQRI-------VLFGGETGLYDRMTAKENLQYFGRLY------GLNRHEIKARIEDLSKRFGMRDYMNRRVG---GFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKRE-QKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALESL.................................................................................... 224
33 -41.300[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  19  1..MLEARELLCER----DERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRP----DAGEVLWQGQPLHQVRDSYHQ-----NLLWIGHQ--PGIKTRLTALENLH-------------YHRDGDTAQCLEALAQAGL---AGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQ-GGIVILTTHQPLNVAESKIRRISLTQTRAA............................................................................................ 205
34 -40.500[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  24  23.AAMATEDLHVYY----GDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMND-DGCRMEGQILYDGININR-KEVDLYNVR-KEIGMVFQKP----NPFKSIYENVAFGLKRHGMKNK-----KEIMERVEKSLRRAALDEVKDDLGKSALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKY--TIIIVTHNMQQAARVSDYTSFFYLGEVVEFSGTSELFTNPQEKQTEDYISG..................................................................... 268
35 -40.200[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  17  75LPKDLAKDTTHRY----GANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPN----LGRFNTPPDWEEILTHFRGSELQSYFIRVVEENLKTAIKPQHVDYIKEVVRGNLGKMLEK-----LDERGLMEEICADMEL---NQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSVLDYLSDFVCCLY-GKPGAYGVVTLPF-SVREGINVFLAGFIPTENLRFRDES......................................................... 328
36 -40.100[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  22  5MSSLQILQGTFRL----SDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPL----LKGERQSQFSHITRLSFEQLQKL----VSDEWQRNNT---DMLGPGEDDTGRTTAEIIQDE-----VKDAPRCMQLAQQFGI---TPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQS-GITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEELLQQALVAQLAHSEQLEGVQLPEPDEPSARHALPANEPRI............................................. 265
37 -39.800[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  16  1..MIEINDVNKKY----QQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAA----DSGNVLFNGLDVAKTSGDKL----ATILSVLRQENHF------TSRLTVSDLVGFGRYPYSRGRLNKNDRQHIDAAMEFLNLMPLKDRYLD---ELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADELHKTIILVIHDINFASAYSDHIIAMKNGEVIYRGAPAEIMQP................................................................................. 226
38 -39.300[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  21  1MSILTAENLAKSY----KSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQD----QGKIVIDGEDISLLPMHNRAQR----IGYLPQE--ASIFRRLTVYENLMAVLEIRKDLTP-----QQRREKADELIEEFNI---SHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNR-GLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQ............................................................................... 229
39 -39.300[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  21  1..MLKLASISKRF----GGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEP----TGGTLTFGGTSLVGKKPHQITQM----IARTFQN--IRIFKEMTLLENVVVGMHRHLDYGGYRAAERRARDRALELLSWVKL---DHKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIR-ARGYTIFMIEHDMRFVMGLCERIAVLNFGRIIAEGPPEAIRNNPQ............................................................................... 241
40 -39.000[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  19  3MSAISTETLSLGY----GDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKP----RGGSVLLEGRAIAKLPTKEV----AKELAILPQGPSAPEG--LTVHQLVKQGRYPYQNWLKQWS--KEDEEAVERALKATKLEDMADRAVD---SLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVI-------TCDLVQNVFSMNCQV............................................................. 245
41 -38.500[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  20  2.....VENLSKVYPIALRQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKP----SGGKVRVAGFDPFRRQTAFLRRT-------LVMGQKQQLIWDLPTLDSLRINGAIYE------IPDQVFEQRLGELSEMLDL---TTELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRYQATVLLTSHYMADITTLCERVLLIHQGQLMYDGDLEAL.................................................................................... 240
42 -38.500[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  21  6.PSIRVTDLSYSV----AGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGELGK------SGVELFGQPLRDIKPAEA----AKRRAVLPQQTPLSFA--YEVLDVVLLGRIPHGQ-----RETVQDRAIAAACLERVGLSGYETRD----LTLSGGEQQRVHFARTLA-GERVLLLDEPTASLDLAHQHATLRLARELCRE-GVGVLAVLHDLNLAAQYADRVLMLAEGHVIACDHPAVALTP................................................................................. 233
43 -38.100[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  23  1..MLTIDHVTKTF----GDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSI----TEGSISWKGRPVNYHISNK--------IGYLPEER--GLYPKMKVRDQLVYLARLK------GMEKREAVKELGTWLERFNI---TDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNS-GVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEI.................................................................................... 216
44 -37.600[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  22  3.SILSISGVSKTY---ATGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNR----STGTVTVDGHDIGKDYRAARSL-----IGLVPQE--LTIDAFESVWATVNYSRGLF--------GKPPNHGFVEKVLRDLSLWDKK---DAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLRED-GVTIILTTHYIEEAEAMADRVGVINRGEIILVENKAELMHK................................................................................. 224
45 -36.800[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  22  3MSFLKITDLYKSY----GSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGL-----PITSGDIAINGKSVSNLHPSQ------RDIAMVFQS---ALYPNMTVAGNIAFGMEIRKVPKPERDKAIQQVADMLQI---------GHLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNNPANMFVADFMGS-PAMN................................................................ 242
46 -36.000[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  19  3.IVMQLQDV--------AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSG-----KGSIQFAGQPLEAWSATKL----ALHRAYLSQQQTPPF------ATPVWHYLTLHQ-------HDKTRTELLNDVAGALALDDKLGRS----NQLSGGEWQRVRLAAVVL-AGQLLLLDEPMNSLDVAQQSALDKILSALCQQ-GLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAYGM........................................................................ 232
47 -34.700[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  23  4.KILEIQDLTVSF----DGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQP----TEGRVLFQGKDIRKIPEYRIARL----VGRKFQTP--RVYLNLTVAENLDLAVNRKKSVTLMGQATGAEQRSVGGLLETIGL---TPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAE--SHSIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQIQNDPK............................................................................... 237
48 -34.000[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  22  1..MLSFDKVSTYY----GKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQA----ASGSIRYEGEELVGLPSSTIMRK-------IAVVP----------GRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRRE-GVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPK............................................................................... 225
49 -33.600[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  22  323...LELRNVTFAYQDNA---FSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQ----SGEILLDGKPVSGEQPEDYRK----LFSAVFTDVWL----------------LLGPEGKPANPQLVEKWLAQLKMAHKLELSNGRIV------KLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEMGKTIFAISHDDHYF-IHADRLLEMRNGQLSELTGEERDAAS................................................................................. 539
50 -32.600[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  22  476....YVELKNITFGYSRLEAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQP----WTGEIYFDSQPREEISLQLLTN----SVAMVEQE-------ILLFGGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSMSGGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR----GCTCIIVAHRLSTIRD-CDQIIVLERGKVVQQGTHQELWQV................................................................................. 700
51 -31.200[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  16  335....ELRVENVTIVPPGERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMP----AAGKVRLDGASFDQWDRETLGR----HIGYLPQG-------VELFDGTIGENISRFDDNPDPEAIIAAARAAGAHELILRFEKGYDSDIGEAGSTLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKAR-GGIAVVVAHRPSAIGA-VDYILMMEDGRMKAFGPRDEVLSK................................................................................. 562
52 -30.800[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  22  350...IIANDLVVLSPQGK---RLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFMP-----YQGSLTINGIELRELDHAQWRQ----TISWVGQNP-------LLLYGTIRDNVTLKHNIADEQVTQTLQAAYAQEFVEQQGL---DYPISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ--QRTALFVTHQLQPLQS-VEQILVMENGLLVQAGHFEDLSQQ................................................................................. 571
53 -30.600[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  22  227.KVIEVEELQ--------LKKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSAS----RRKIKLDGVDTRLSGPDDALMR----IGLLPESRKEGLITSFSILQNISLNNYRKYRKAHWFLDLKKELEHTTKAMAQVQVKAQGPYAR---DTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAAR-GHSIIMISSELPEVIGMSDRVCVFRSGGIVATVEGEDI.................................................................................... 454
54 -30.000[R] COG3910 Predicted ATPase  ali follow..  4LDSVAMKEKPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRA-EDVLGYIRRQNENALDDFR---------WEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHG-EGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADS-GGQLIIATHSPVLLAIPEATIYYFDEDGITERL-LRRFLDRPSK.............................................................................. 254
55 -29.800[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  20  1..MLEIRNLHARIVDDGTEI--IRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAG--REDYEVTEGDILYNGQSILEMDPAERAT---SGIFLAFQYPME---PGVATMEFLKVAMNEQRKARGEEPLKIPEFLKRVKEAAASLNMDMAMLKRPLNVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAP-DRAFLVITHYQRLLEHIVDSVHVLYRGQVIKSGDKSLALDLEANGYAG.......................................................................... 245
56 -29.000[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  22  4.AAIELIGINKSF----GAVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQAD----SGEIRVGGKPASIKTPNDAIAL----IGMVHQH---MLVDNFSVLENI---ILGAESDALLKSSIAKARSELERLEREYGLEDPDAIIE----ELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQ-GKTVVLITHKLREIMAITDNVSVMRQGTMVATRETSKTTVGELAELMVGRRVLLRVEKGEAEAGAVKLAVKN.................................................. 262
57 -28.900[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  24  338....SLTLRDVQFTYPEQSQQALKGISLQVNAGEHIAILGRTGCGKS----TLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQ----TISVVPQRV-------HLFSATLRDNLLL--------ASPGSSDEALSEILRRVGLEK-NSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR--EKTVLMVTHRLRGLSR-FQQIIVMDNGQIIEQGTHAELLAR................................................................................. 562
58 -28.400[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  23  334.SMVSFNSFSKQY----GDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKP----DEGDPGIEVK-------------------ISYKPQYIKADTPVSVQDFLRGI-----------TKRFGTSYYEVEIANPLQL---ERIYESLLTELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENNQKTAMVVDHDIYMIDMLSQRLLVFEGKPSVY........................................................................................... 530
59 -28.000[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  24  341....DIEFRHVTFYYPGKDTPALNDINIHLEAGKTVALVGRSGSGKS----TIANLLTRFYDVSEGSILLDGHDLRDYRLGALR----NQVALVSQN-------VHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGDTVIGENGIMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQK--NRTSLVIAHRLSTIEK-ADEIVVIEDGRIVERGVHAELLVQ................................................................................. 568
60 -27.800[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  20  411.TVLESFGVRQRV----VERYVLRDVNLEIKPGEIVAVVGASGSGKT----TFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIPSE-----------LEPQITEKSILEQIF-----------DITGDIHLAVEVLNRAGISD-AVLYRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREAKITLIAVTHRKEVINALSDRILYVGYGGVTES.......................................................................................... 619
61 -27.500[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  22  363...ISFKDVHFAYDPQR---PILRGISFDVPAGKTVAIVGPSGAGKS----TISRLLFRFYDIQSGSITIDGQDVRDVTQESLRK----FIGMVPQD-------TVLFNDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSR--GRTTLVIAHRLSTVIG-ADEIIVLKDGLIAERGTHRHLLDQ................................................................................. 587
62 -27.100[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  15  19..VIQATNLGVSFHSGYKIVWPLRNLDFTGYKGEILGIIGSNGAGKTTLCKMLSGILKP----DEGELYVDGRVSALFS-----------LGMGFKKELTGRENAYLNGMML-------------GIEKDQIDQFIDEIHEFSGL---GSFIDQPMKYYSSGMKARLGFSVAAFLEPEILILDEALNTGDAAFGKKAAAKMKELVSK-AKMVILVTHSLRYARKNCDRLLWLDRGEIRAIGEPAEVIEK................................................................................. 259
63 -26.600[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  15  442...IRFDNVPLVTPNGD---VLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWP----LFGGTLTKPAKGKLFYVPQRPYMTLGTRDQIIYPDRPLDMIRKGVSDSDLEQML------------------ENVQLTHILEREGGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLC----REKNITLFTVSHRKSLWKY-HEYSLYMDGRGSYRFEQIDDQSDQ................................................................................. 658
64 -26.400[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  23  439...ISFENVHFSYLPER---KILDGISFEVPAGKSVAIVGSSGSGKS----TILRMIFRFFDVDSGNVKIDGQDIKEVRLESLRS----SIGVVPQD-------TVLFNDTIFHNIHYGNLSATEEEVYNAARRAAIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLAS--NRTCIFIAHRLTTAMQ-CDEILVMEKGKVVEKGTHEVLLGK................................................................................. 663
65 -26.400[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  23  504...VDFENVTFTYRTRPH-TQVLQNVSFSLSPGKVTALVGPSGSGKS----SCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR----VISLVSQEPVL-------FARSITDNIS-YGLPTVPFEMVVEAAQKANAHGFIMELQDGSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQ--KHTVLIIAHRLSTVEH-AHLIVVLDKGRVVQQGTHQQLLAQ................................................................................. 730
66 -26.100[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  19  384.PVIMVQNVNFRYNDETPWI--YKNLEFGIDLDTRLALVGPNGAGKS----TLLKLLYGDLVPTSGMIRKN---------------SHLRIARYHQHLHELLDLDASPLEYMMRAF-----------PDVKEKEEMRKIIGRYGLT--GRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDM----ETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKD................................................................................. 593
67 -26.100[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  22  5WRLIELRVDKYTYPNGR---VGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVNGLIPNLGGTLEGKVRVFG-----------EKPNPRIAFFVKQNPEEMI--STQVIDELV-------PLIQQGFGWGEAKREAEEVCEELGI---GGLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILRDY------PHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEP..................................................................................... 218
68 -25.800[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  17  672.PILGVHNVTFAF---PSQKPLFIKVDFGIDLTSRVAIVGPNGVGKS----TFLKLLLGELEPQEGEQRKN---------------HRLHVGRFDQHSGEHLTAEESAAEYLQRLF-------------NLPHEKARKALGSFGLV--SHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDI----ESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTI-------NEIVGEFDDYRKEVLDSLGEVVNNPSVVANAAVLQ................................................... 901
69 -25.600[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  18  5.IEIVNTDFSLAY----GSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANQLDGFPDKDTLRTCFVEHKL-------------------GEEGDLDLVSFIALDEELQST----------------SREEIAAALESVGFDE--ERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHT---DITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVE................................................................................. 210
70 -24.700[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  22  576...IEFSNVTFGYSPEK---IVLRNVSFTVPAGKTVAIVGPSGAGKS----TIMRLLFRFYDVQTGAILIDGQNIKLVQQQSLRK----AIGVVPQD-------TVLFNNTIFYNIE-YAKLGASDEAVYEAARAADIHERILGFPEKETKVGERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCA--NRTTIIVAHRLSTIIH-ADEILVLQQGSIAERGRHEELVLREDGIYAD.......................................................................... 807
71 -24.600[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  19  102..............ARPKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGS--LKGTVKLNGETLQSRMLK-------VISAYVMQDDL--LFPMLTVEETLMFAAEFRLPRS---LPKSKKKLRVQALIDQLGIRNAAKTIDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASLSPIPENENRTEFALDLIRELEGSAGGTR........................................................ 357
72 -24.300[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  19  505...ISLRAVPVVTPNCD---IVVPKLTLCIEPGVHLLITGPNGCGKS----SLFRILSGLWPIYAGELHIPRPVKDV-----------PCMFYIPQRPYMSIG---SLCDQII-----YPDTREDMKRKHITENELRSILKMVSLRDSFDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM----GITLLTITHRPTLWKYHTHILEFDGLGQFRKMNSDEEQKGQ................................................................................. 727
73 -23.400[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  17  426...VHVVAVEVRTSAGE---QLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWP----YASGTLSRPDGK--------------NETMFLSQLPYVPLG---NLRGVVCYP----------NAPADIPEDTVRDTLTKVALNPLCDRLDDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELP--DCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEKEPLH.................................................................................. 637
74 -21.800[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  14  6..VYTMHRVGKVVPPKR---HILKDISLSFFPGAKIGVLGLNGAGKS----TLLRIMAGVDKEFEGEARPQPGIKIGYLPQEPK----EPQQTVREAVEEAVSEVKNALTRLDEVYALYADPDADFDKLAAEQANLEAIIQAHDGHNLDNQLERA-EHLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDA----ESVAWLERFLHDYEGTVVAITHDRYFLDNVAGWILELDRGEGIP........................................................................................... 240
75 -18.100[R] COG3044 Predicted ATPase of the ABC class  ali follow..  13  207VPFIAPKSLEVTLSTPN----QGELVGMGIPQGITL-IVGGGFHGKSTLLTALERSVYNHIPGDGRERMVTDVKAMKIRAEEGRCVHNLNLSNYINH-----------------------------------------------LPMGKDTTDFSTQDASGSTSQSAWLQESIEAGVTTLLIDEDTSATNFMIRTPLVDRIGQLRDDLGISTLVVMGGSGDYLDVADTVIQMHDYQPVDVTEAREVIAQHPTLRRNECETPLATFTPRALNCATLQK..................................................... 447

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.