current user: public




Query: [R] COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MTIVDVRILVEGASDVEVISKALQGLALGSEYNITISSIIPTTNVEIAKSAAAGADLLIIATDADRVGRELAERLFNELSEMVGHIERMKIPIGHDLEHIDVELVRKELKNALVRAGLKTLQRVPEYMELRRDYLDLKGKFEELQKEKEELLKRLEELEAKYNEVQDELKRLEVENSRLNEMLKKRPKVYDLKKKWDELFPGVELPEEELFSKAVKTLNLAGKVIVGQGYIYAEDEKLVEDLLKTVYLSLKLREEEEVEVIREGIEEIIPEIDSGGEGGESEGLast
1 -70.400[R] COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease  ali  100  1MTIVDVRILVEGASDVEVISKALQGLALGSEYNITISSIIPTTNVEIAKSAAAGADLLIIATDADRVGRELAERLFNELSEMVGHIERMKIPIGHDLEHIDVELVRKELKNALVRAGLKTLQRVPEYMELRRDYLDLKGKFEELQKEKEELLKRLEELEAKYNEVQDELKRLEVENSRLNEMLKKRPKVYDLKKKWDELFPGVELPEEELFSKAVKTLNLAGKVIVGQGYIYAEDEKLVEDLLKTVYLSLKLREEEEVEVIREGIEEIIPEIDSGGEGGESEG 283
2 -16.900[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  12  12.................................LVLGGIIAALGDHLGSKVGKARLRLFKLRPRQTAVLLTVITGTLISASTLGILFTFSKSLREVFQLDDILAQLRVAKTELEQASQAKEEIESELTAVREEQQLVQERSRELNRNYTKALQLLRRVSEQSRNLRQEVANLSAERAQLNEQKDSLLAESSELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRFASLEAQRQQLQAEINQRDTKIDQLDQAIAAKDNDIQAREEKLQGLETELS. 261
3 -16.700[YU] KOG4460 Nuclear pore complex, Nup88/rNup84 component  ali follow..  10  449.....VEHILCTRPLPCRQPAPIRGFWIVPDI-ICITSTYECLIWPLLSTVHPASPPLLCTREDVEVAESSLRVLAETPDSFEKHIRSIATQVFREQYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKLLHS---FHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHV................... 739
4 -15.400[S] KOG2216 Conserved coiled/coiled coil protein  ali follow..  11  2..........................................EDGEIEEGMVTADEFPTPEVTTIETIQPPREPGKSPLELLRESKTSVEEIVAKMLSMKKQGNHKSEIRELLTQMFLNFVNLRQANRAILTEEDKVKAETERAKAPVDFTTLQLHNLMYEKSHYVKAIKACRDFKSKYPD---DLVPEQDFFRHAPEAIKDQSLSSDSSHVLMPKRLNFELHQRKELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHLGIQHTKKL. 239
5 -15.100[S] KOG4360 Uncharacterized coiled coil protein  ali follow..  11  152.............EQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKT--ETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPTAHLYFSQSYGAFTGESLAAEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRS. 418
6 -14.500[Z] KOG1853 LIS1-interacting protein NUDE  ali follow..  13  3.............................................DSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRL----KDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTP. 244
7 -13.600[S] KOG1103 Predicted coiled-coil protein  ali follow..  56...................................MEGEVQAREDVIDHLKRERTKLLSEAKYGKLNMNDPFAALRRDSAITGEQIDEEKIVQMYESQVDQLDKMMAVQKQSQRNAAVLLVALEKKQYKLVKKLEADREAKIRYAKQGDDLEKERNQLQQQIEFHIEEKRKAEIAKDKMEMTLGN--EKKRHESIVLYLIQERKQMLLKMHELRVKAEQIMLQNQNDPTKPGPSSALSERELIEELKKEVTFLRAERESLTKTQKMVKTENLSLRETVRGQEA 306
8 -13.600[T] KOG2751 Beclin-like protein  ali follow..  17  113................................................................EECADSMLEIMDRELRIAEDEWDVYKAYLDELEQQRV-APNVEALDKELDELKRSEQQLLSELKELKKEEQSLNDAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLRD........................................................................................ 242
9 -13.400[S] KOG4687 Uncharacterized coiled-coil protein  ali follow..  10  17.................................................................ATYNVETSAVHRKLQSKVEALRILRQELEQRVERDQYKLVAETLQLRYSALKSNSELLAVGGCGALSENSSLAALLHETREQNLKLSTEVEALRQRLNELHGDMELLRETEASNKSRVQAMASENAARNKEELQWRRERANFICHLEGLKKRNAQLAF-----------DLKAVIDEKEELITERDAYKCKAHRLNHELFV................. 207
10 -12.900[S] KOG4451 Uncharacterized conserved protein (tumor-associated antigen HCA127 in humans)  ali follow..  48...............................................KQENAEDFELDLGVGLLWNLGHHILSKTFLDILSGIDEFHKLANEIRKDEDCKALEQHITSCNGIKGELDMERRSHAEELRQINQDINTLEDITKSSKTELEKRKMKISVAMGEVARMRGFINENLESMNIIHKLETSEEEELFKVTCARQTTDPPTPSVPR.......................................................................... 210
11 -12.500[UR] KOG4677 Golgi integral membrane protein  ali follow..  10  163.............................................................DSQISVLKTKLSEVERKFEKRSQDYYEMKAEKEMLEKRVENQKVSSHEMDSLQELKLARQKAQDQKEKAVEECNMHKRKIVGLEEEIRAMVEQLRLAKFNLNENKKEFDEYKNKAQKILTAKEKLVESLKSEQGIGSSDRPVHLLQAEVEEIRVERDLTKADLESAQLQV-YTLRSDMEELEAQIRDLQSQLSDQKRTHLEEKQTWDSTIGLLNEK...... 377
12 -12.500[R] KOG4398 Predicted coiled-coil protein  ali follow..  10  87.........................................VRNGNITHSQAERPESLTEKQQRYINLQAGLKTFSTRYERLIGQHRSNE---DRLMAIKAKRKQLELLQQLISGTGQRLRVLGERRDELRRANAEKRKNLPKYPDKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRIQQLVTYVFPIAEVVLKEEQQRRASVERTEEAETIAALADA............................................................ 266
13 -12.400[D] KOG0995 Centromere-associated protein HEC1  ali follow..  15  246.............................................DMTKTAASALEMLNYECDEIEADKGNEASLKEEISRIRDDIRKAKDYLEQLHVKQHMEKELAMVKSEQEEKISENEKVQKMVDDLKNKIELQKQIHGLTGKEVRQMNLDNNKDKEVVLEIQSELDRLSKETWKLKDEDRQLHQRKLELETEQSRFSNKAVTAEERIQIQSETLCEAKKNEAREERIRRNERDSWKDARKHIEQRYEQLLNEKEVLLKQMKLDGSLEKEIEDETARMSA 541
14 -12.200[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  10  619.............................................TAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDEREKKKLEEELMELNKELEELGSESVEAAIVRLQEEVKN................. 840
15 -12.100[V] KOG1962 B-cell receptor-associated protein and related proteins  ali follow..  15  114.......................................................................IRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKD.................................................................................................. 227
16 -11.900[R] KOG4403 Cell surface glycoprotein STIM, contains SAM domain  ali follow..  13  112....DKLISVEDLSEVEVVQWLITYVEL-RKLQLSTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIE. 434
17 -11.800[U] KOG4809 Rab6 GTPase-interacting protein involved in endosome-to-TGN transport  ali follow..  414.............................................LSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLK. 651
18 -11.800[D] KOG4438 Centromere-associated protein NUF2  ali follow..  11  140.............................................EFLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLLVVSLKEIQESLKTK-EKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESEL-KKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQ. 381
19 -11.600[Z] KOG1850 Myosin-like coiled-coil protein  ali follow..  11  250.............................................EIQAQLEQHDIHNAKLRQENIELGEKLKKLIEQYALREEHIDKVFKRKELQQQDAKLQQTTQLIKEADEKHQREREFLLKEATESRHKYEQMKQQEVQLKQQLSLYMDKFEEFQTTMAKSNELFTTFRQEMEKMTKKIKKLEKETIIWRTKWENNNKALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKE. 488
20 -11.500[U] KOG4324 Guanine nucleotide exchange factor  ali follow..  11  1.........................................................MVDTISVLNPIHLDLSVDPQDNVRISARSTTSSSASTSSDSAEELLRMQAELRATRTALAEKDKKMTQIQVTVDAEVQELTEKLQEAYKMVNTAEARREKAGKLLTESRLEVEVLQAEVRALKELISAPGMGQNHFKQ........................................................................................ 145
21 -11.400[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  12  727.............................................IQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDH... 961
22 -11.400[U] KOG0999 Microtubule-associated protein Bicaudal-D  ali follow..  11  52..............................................................EEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGL----KHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTS.......... 274
23 -11.400[D] KOG4593 Mitotic checkpoint protein MAD1  ali follow..  11  396.............................................AIQLGRQNAVSEAALAKEKSEALKTDVKRIEVMLTLVTEEKEQLKAVVNERKSNSEGSVSGAADGALIQGFESSLAKKENYIKDLEQDLNQLKDVNNRQRTEIELLNEKLVDEARRNKSLERDSDRLRSEISLLESKLGHGDYSAANTRGVENEAKQTIEALQAELQKTKERLQAVEELKSQSGDAGKLVDSHITGKIAQLKEQNATLEKREERYKTVFADRISVFRR.......... 632
24 -11.300[S] COG3551 Uncharacterized protein conserved in bacteria  ali follow..  188...LSYEGFLVDWR--KHMDRAAEKTGVV----------WPAHPDRSDVKVEQFLTTDLYHERSTPEDMRHHPEVASLVRETYQILSTIAAGDEDNGLLDQLDIMRTRFDDACETFSAAMATEELAVVQLRGELSTRSTETERARQENSKLASFLEQQSLEVRGLAAERDALVGTRGTLIAERDALVNAQASLIAERDALLRDMSCIANERDALLRSRS................................................................ 391
25 -11.300[D] COG5185 Protein involved in chromosome segregation, interacts with SMC proteins  ali follow..  13  265.............................................QQNQDLYNQTEALKSTNEELINQIKSAEELDSAIQVLEERYRTMQRDEVKFQSASGMKSKMESRTNLMKQLQVNIEEKESQLQLLKEKRDSLKYEFEKMVSEREQLDRNLNMIGSKISELRKEVFDTDLLIQASIDSLEKKVQKFDLKNKVRPFINEVRRSITLEFHEEQNKSLKLQEHVDTVNDLIAELQDELRGIESRLTSVLSECNMLRETASEEKNAFDAESDKLERELQQLK. 548
26 -11.300[K] KOG0963 Transcription factor/CCAAT displacement protein CDP1  ali follow..  290.............................................LNKKLSTELESIKEASRKEMETHCATIQTLENEVKEARKVKEESLTLANKFSDYDEIKRELSVLKQIEFSGEHATHENTSLESQLLKREKQLSEELAKLRSTNAQLTDRITQESKKASFLEQKASEQEEVIRKLEKDLADVDVE---GSVYLSNTTYRREGTSGQLSPTSSIMGGNPSLFNGSVLSRNSVNETGSAIVDVIKQQRDRFRRANVTLVNQVSAANDKIALLESKLEEVEK 524
27 -11.100[S] COG5283 Phage-related tail protein  ali follow..  6VDSVTTGIDLNETK----AVEAINR----------LKSAVKDSTREWQINEAQ------------KSAGDAVSASKYRYEGLSEAMEKQKAYI-------------ANLSEGMKTINRNTDAGEKAYQKYNAQLTTAERSLASMTGQLNRAKSAYEYQQTGIEDLNKSLSANDKLMQSQIDLYEKTRNKMGAAKAEVSGLSTSYAKQTEIYRAQVTELKRLEAAEGTSSETLVKQKTRVNEAASSLMNYRNKLLEANLAVTKMQPFNSESLIGKGLNTVYQTT 250
28 -11.100[K] KOG4005 Transcription factor XBP-1  ali follow..  13  71.................................................................................................KKRRLDHLTWEEKVQRKKLKNRVAAQTSRDRK-KARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQELAELKQ............................................................................................... 160
29 -11.000[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  12  66.................................................................DVSHIDVGSLQEQLDNAMLSMKMVE------KERNKDEQQIRDLKETQKKCLKTIAGLEQKVQKKDFLISSYVEQIGVLKSDAHVV----DGLRKENKTLKSQIQSMEGISAILAAGSADADRLLKNEADPHVLANWVSTLKRELRQCESKKTELRNVVKVVQNDLRKEIEKRYAHNIPNVVFIIDMCSFDCSKLEERVSHLESDLYQAQEKLQAFE. 273
30 -11.000[R] COG2409 Predicted drug exporters of the RND superfamily  ali follow..  10  450....DMR---ADFLVLDKLAKGIFRVGISRVQAITRPEGTTMDHTSIPFQISMQNAGQLQTIKYQRDRANDMLKQADEMATTIAVLTRMHSLM-------------AEMASTTHRMVGDTEEMKEITEELRDHVADFDDFWRPIRSYFYSFRSIFDALDG-IDKLSEQIGVLLGDLREMDRLMPQMVAQIPPQIEAMENMRTMILTMHSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNKDFQRAMKSFLSSDGHAARFIILHRGDPQSPEG 726
31 -10.900[R] KOG0804 Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein)  ali follow..  11  402............................................................................EGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVENLEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQVNDLLMH------------ETQNKLKEQLDAGKITQEEITESQVELDSSSSSSRKLNRKKKK....... 590
32 -10.900[T] KOG3872 FOG: FHA domain  ali follow..  14  404..................................NLINMIKTLTTELSLE---------------KQELEKLHSMQNFMQNYTINLDFINKHMIDMNEKHLLKLSTALQKTLSENNDALLKESEDQLKEIKQQNNKVKSACSLKEKQNHE---KLQELESELRELNLQIEEERGKNLVLTQSNFNGGINNDNNAKVKQNDSREEKKDTEDTLISTEELGVVEG............................................................ 574
33 -10.800[S] COG5280 Phage-related minor tail protein  ali follow..  3..........................................................................................................KKISGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKQQLLSKQVELTTKKLDGLKGAQADVDRQFKSGDIGEEQYRAFQREVVATEGRLDHYKQSLKDVESSSGEAGNATKGLGGKFDELGQSVEDVGEAVKGGVLMEAADH................ 163
34 -10.700[U] KOG0993 Rab5 GTPase effector Rabaptin-5  ali follow..  641.............................................ELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRT--AADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTD..................... 855
35 -10.500[S] COG4913 Uncharacterized protein conserved in bacteria  ali follow..  10  202......RFGIQHEQALELFHQTVSMKSVGN-----LTDFVCSHMLE-PCDVGSRIEALICHFDDLDRAHQAVLTAKQQVKLLVPLVDDVQKHQTQLASIQALEAGRDTLQLKGELLKHRLDALAAEAAQLTVEIQHLEEQRKAADSEVTQLRQALRDNGDRLEELAAEIEQLEQAKAQRQKKSDRYQTLLTKIDETAPADAIGFLTQQQRFAQHTEELNAAIERLHNDKSEKDRALYDAREKHTTLLAEINSLQQRQSNISAAQIRIRHDLCMA......... 469
36 -10.300[S] COG1511 Predicted membrane protein  ali follow..  10  88............SNDLDQSLKDLLNVEIPEDFSKNASTVLDKNPKKVGATIGEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAKGLSDASSGAKKIDDTKDAKNGSAQLKENLAKLKESTATISDKTAQLADGAAQVTSGIQSLDSSLGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQEGSEKAAKAEKIIALDLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVINSSDFLTAEQKSQLINS.. 377
37 -10.300[Z] KOG1003 Actin filament-coating protein tropomyosin  ali follow..  14  2.................................................................DAIKKKMQMLKLDKENAIDRAEQAE------ADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMASEE. 212
38 -10.200[S] KOG0992 Uncharacterized conserved protein  ali follow..  10  201.................................................................DDLEKTVQNLKVEIEKLKHERFDFENRMKIAEKRESLSSNLSESKQQGDMLRKQLIQAKDDKHIIQQYEVKLQTSTAELERRLRESEHDVERLRTSQLEMATKFEEASRENTDLLSKIDILQDQLSLEEDRRKLCEEQIDRLKGVESFVESSSHRIEETEKERETAEEDREQAELEAAE-YREQVEKMLKLTQELTERNMELQRKLKDEEGKNTSHN. 417
39 -10.200[S] KOG4657 Uncharacterized conserved protein  ali follow..  15  2..........................................................................VEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANA..................................................................................... 125
40 -9.880[OUTIV] KOG3956 Alpha 2-macroglobulin receptor-associated protein  ali follow..  180....................................................................AEELKSLKQEFDHHQDKVDVYYSLLE------NIGTVDTDKHENAINTEDLDTYNLISNDVNENDIKTHAQNVKSFENDLNTLRGHHTGIKDHYDRLERLVSSGPHSQDFIEPKVQGLWRVAQASNFTVKELESIKTELHHFESRLLKLRHLHAEHALQKEKYKGEKVKDKSSRFEEMEDQLKKQTRKVEKLQENIEKTIFKHTE.......... 378
41 -9.810[R] COG1579 Zn-ribbon protein, possibly nucleic acid-binding  ali follow..  13  12..........................................................................................................QELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRKVQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKDEFNALTQEMTTANKERRSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKALLEQRTELKHAT................... 171
42 -9.750[N] COG3352 Putative archaeal flagellar protein C  ali follow..  40...............................................................................................PKVIDAMNERMTKIENNLGKMTAELEGQKKSLSDMKNELEGIKENVKMVVSLYELVSRDFNPIRGITEELSDQINNLKRLVESAIKDLRELYGVPDIDQVIQMEEKK................................................................................. 154
43 -9.730[R] COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains  ali follow..  379.................................................................KVYKAEIQQRREAFNRAKMDYDHLVSQIQQLGGLEGFIAKRAMLEKMKDEILGLPEEEKRALAALHDTAREKQKFLEGFFIDAASIPGVGPARKAALRSTRRGVKQVKGFGDHLTQAVIDWKASCERRFVFRPNEAVTPAERQAVMAKMAAKRHRLESALTVGATELQRFRLHAPARTMPLMEPLRQAAEKLAQAQADLSR................. 590
44 -9.660[KT] KOG3667 STAT protein  ali follow..  27..PMELR---------QFLAPWIESQD-ESHATLVFHNLLGEIDQQYSRFLQESNVLYFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSA........ 320
45 -9.610[S] COG5293 Uncharacterized protein conserved in bacteria  ali follow..  11  227....................................................................LGSLGELEALKVQVEAQLRERKETLNNAEQYHELEERVNFLTSQIHEATNKNITDQKLLEFYQSSLKSVVRRLEEVEIFHRRLENRREFLGSEIKRLRRDLVSRENFIREKSNERAELLEVLKTHGALEEYTMEIYLDNVANLNEINKRIEELKQFEEERSSLKIEKELLLQRARRDYGERNEQAERAIDLFRI..................... 449
46 -9.560[T] KOG3759 Uncharacterized RUN domain protein  ali follow..  1.........................................................MEMKMAEAQETKDSCSTIEGQLPAGPVRAEDEE------EEVEVEQEQQELLSERWSPLGANYDDANSASSGVDCELEPGLEKSEARRGSTGSELARLRSIEEEQELLTSSLLALTSHFAHVQLRVRQIVEA-ERDQLLRDLEDFAFQGIPDAVQSKESHPDKPASDGEKDHGPDSQLIQQLKSQLTELEQIAYEAGEPGILPQHVLLEKQKFILDELRAKLNLQ. 221
47 -9.520[U] KOG1955 Ral-GTPase effector RALBP1  ali follow..  12  596....................................EAEKHPEVLPAEKASDPASSLRVAKTDSKTEEKTAASAPANVSKGTTPLAPPPKPVRRRLKSEDELRPEVDEHTQKTGVLAAVLASQPSIPRSVGKDKKAIQASIRRNKETNTVLARLNSELQQQLKDVLEERISLEVQLEQLRP...................................................................................................... 740
48 -9.490[D] COG1196 Chromosome segregation ATPases  ali follow..  14  100...VTRRIYRNGDSELKDIVDLFMDSGLGREFSIIIDEILNSKPEERRSIFEEAAGVLKYKHRKKQAENKLFERVQDILYELEGQLEPLEMQASIAKDYLFQQEELEKYE-EISSLTEKLAEVRKEFGENQTVLIKLREELHAEEAIVSREKQALNETDIALDNLQERLLVETEKLEQLEGERNLQLERKKHSSENEQVYAETLAAITEKITALEEQREVLSSSKLEKQTALEIAVKAKKELEATLSKYDDLSEEAIENRKSDYIDLRHTQTTINND...... 398
49 -9.480[D] COG4942 Membrane-bound metallopeptidase  ali follow..  37............................................................AFSAHADERDQLKSIQADIAAKERAVRQKQ------QQRASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQQETIAQLKQTREEVAMQRAELEEKQSEQQTLLYEQRAQQAKLTQALNERKKTLAGLESSIQQGQQQLSELRANESRLRNSIARAEAAAKARAEREAREAQAVRDRQKEATRKGTTYKPTESEKS. 291
50 -9.440[S] KOG3990 Uncharacterized conserved protein  ali follow..  14  165.............................................SAAAKKPSRNELGKSGSGANNSGVNAVSGAGLDLPDKISRGNGGNGTIAADTNSSDHVVAITYLKERIASLEKRLNQKDKELLEKDKQLTELKGKNFEKENDRNRLKEVERLHDMKVDNLNRKIASVLKELAVLKKSSNKKTAAISKAEKEIIKRENLSPKEEILATTGPEKPTKASSEPADLDKDEKSRDRDEERSEQGDRASVRSRSASSSPTPSS.................... 389
51 -9.430[A] KOG2991 Splicing regulator  ali follow..  14..............................................................SETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGK-KLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASA 248
52 -9.290[T] KOG4637 Adaptor for phosphoinositide 3-kinase  ali follow..  13  444.............................................AVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEE--QCQTQERYSKEYIEKFKREGNE--KEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNELGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQ........................ 654
53 -9.200[K] KOG1414 Transcriptional activator FOSB/c-Fos and related bZIP transcription factors  ali follow..  15  253...........................................................................................................................AAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHRS............................................................................................... 317
54 -9.180[T] COG3103 SH3 domain protein  ali follow..  14  1MPKLRLIGLTLLALSATAVSHAEETRYVSDELNTWVRS--PGDHYRXVGTVNAGEEVTLLQTDANTNYAQVKDSSGRT---------PLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLDDKQRTII.......................................................................................................... 170
55 -9.160[Q] COG1463 ABC-type transport system involved in resistance to organic solvents, periplasmic component  ali follow..  10  62.SKITYNVKIGRVADISETVRNGRPAEFTLDVYPRYLSLIPANNADIKATTVFGGKYVSLTTPEHPSQKRLTPQTVIDARSVTTEINTLFQTITLIAEKVDPIKLNLTLSAAAQSLAGLGERFGQSIVNGNSVLDDVNSQLPQARHDIQQLASLGDTYANSASDFFDFLNNSIVTSRTINQQQKDLDQVLLAAVGFGNTGADIFSRSGPYLARGAADLVPTAQLLDT........................................................ 290
56 -9.140[R] KOG1899 LAR transmembrane tyrosine phosphatase-interacting protein liprin  ali follow..  12  1........MASDAS--HALEAALEQ----------MDGIIAGTKADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERLLSQIPGPTAAYIKEWFEESLSQVNHHSAASNETYQERLARLEGDKESLILQVSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTEVSELKLKLVGMEKEQREQEEKQRKAEELLQELRHLKIKVEELENERNQ-YEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSRTAA 266
57 -9.130[R] KOG2896 UV radiation resistance associated protein  ali follow..  110VSCFVVKIWGGKENIYQLL----------IEWKVCLDGLKYLGQSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIR.............................................................................................. 317
58 -9.120[S] KOG4421 Uncharacterized conserved protein  ali follow..  11  4........................................................................KSLAMDGTVPEAKYQKLA------TEYSKLRAQATVLKKAVLEEQSKEASLREQLQQYATSLRRTEQEVDSLGFRNKQLESRVSQLQQEISVHEQPKKKDKDSGGRRGVQSNSRPDA-SLDAAQEALIFEELQKKIMENAQLTSLIDDKQRDLLLHTERIASLEQKLEKRIGDQNELEKRLRKEVETLQHRNSELETKLVDAASMLGSED. 208
59 -9.120[D] COG5244 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B  ali follow..  10  424.......................................LTEEIQDLETLNQLNTEIEARQSEKLNEVQEETQRLSQLLISSQPALTEVK---HLKLCLSDSQEELLQLNAKLEKANIVIDELNSAKLKLSKQVEEESSMKDDLTEMNQRLKEQIESYENEVNSTSRTLKEFETLKTQYEKNLCNLREQLKTARMKLADKYPQGDNTSENIDWLKHSLRDSNTENSIPSPLTFACKEKLVADIKPVSVEKQLALNWKKDIERPSFHHNQQLFNYCQLTDILS. 667
60 -9.040[K] KOG3915 Transcription regulator dachshund, contains SKI/SNO domain  ali follow..  13  560.................................................................PDGLSSIETLLTNIQGLLKVAIDNARA-----QEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQ-AASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTT.................................................................... 703

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 3 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.