current user: public




COG4026
Query: [R] COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MTIVDVRILVEGASDVEVISKALQGLALGSEYNITISSIIPTTNVEIAKSAAAGADLLIIATDADRVGRELAERLFNELSEMVGHIERMKIPIGHDLEHIDVELVRKELKNALVRAGLKTLQRVPEYMELRRDYLDLKGKFEELQKEKEELLKRLEELEAKYNEVQDELKRLEVENSRLNEMLKKRPKVYDLKKKWDELFPGVELPEEELFSKAVKTLNLAGKVIVGQGYIYAEDEKLVEDLLKTVYLSLKLREEEEVEVIREGIEEIIPEIDSGGEGGESEGLast
1 -63.600[R] COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease  ali  100  1MTIVDVRILVEGASDVEVISKALQGLALGSEYNITISSIIPTTNVEIAKSAAAGADLLIIATDADRVGRELAERLFNELSEMVGHIERMKIPIGHDLEHIDVELVRKELKNALVRAGLKTLQRVPEYMELRRDYLDLKGKFEELQKEKEELLKRLEELEAKYNEVQDELKRLEVENSRLNEMLKKRPKVYDLKKKWDELFPGVELPEEELFSKAVKTLNLAGKVIVGQGYIYAEDEKLVEDLLKTVYLSLKLREEEEVEVIREGIEEIIPEIDSGGEGGESEG 283
2 -21.000[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  11  19.............................AALGDHLGSKVGKARLRLFKLRPRQTAVLLTVITGTLISASTLFTFSKSLREGVFQLDDILAQLRVKTELEQASQAKEEIESELTAVREEQQLVQERSRELNRNYTKALQLLRRVSEQSRNLRQEVANLSAERAQLNEQKDSLLAESSELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRLEAQRQQLQAEINQRDTKIDQLDQAIAAKDNDIQAREEKLQGLETELSFLQREVEELERYYQDYQ. 278
3 -21.000[YU] KOG4460 Nuclear pore complex, Nup88/rNup84 component  ali follow..  496................STVHPASPPLLCTREDVEVAESSLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEECLQLLSRATQVFREQYIL-KQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKLLHS---FHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVN.................. 740
4 -19.500[S] KOG2216 Conserved coiled/coiled coil protein  ali follow..  3....................................DGEIEEGMVTADEFPTPEVTTIETIQPPREPGKSPLELLRESKTSVEEIVAKMLSMKKQGNHKSEIRELLTQMFLNFVNLRQANRAILTEEDKVKAETERAKAPVDFTTLQLHNLMYEKSHYVKAIKACRDFKSKYPDDLVPEQDFFRHAPEAIKDQSLSSDSSHVLMPKRLNFELHQRKELCKHRARLEQQKKSLLETIAERKKFLSSLPLHLKSLKKASLPVQNHLGIQHTKKLKQHNLAELLPP 250
5 -19.400[D] KOG4438 Centromere-associated protein NUF2  ali follow..  136................ETYMEFLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNSQKKSNISEKTKRL--NELKLLVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIK. 402
6 -18.900[U] KOG4809 Rab6 GTPase-interacting protein involved in endosome-to-TGN transport  ali follow..  13  403................EEIQMLKSNGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALLETLTNQFSDSKQHIEVLKESLTAEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLE. 672
7 -17.600[S] KOG4687 Uncharacterized coiled-coil protein  ali follow..  1...MDLDDVASHHGFGQHMATYNVETSAVHRKLQSKVEALRILRQELEQFRVERDQYKLVAETLQLRYSALKSNS-ELLAVGGCGALSENSSLAALLH--ETREQNLKLSTEVEALRQRLNELHGDMELLRETEASNKSRVQAMASENAARNKEELQWRRERANFICHLEGLKKRNAQLAFDLKAVIDEKEELITERDAYKCKAHRLNHELFVALRAKKTHPRLLD---DGVLLENKYLHERVKIQDSELELTKQSINKYKTMLDA................. 258
8 -17.300[UR] KOG4677 Golgi integral membrane protein  ali follow..  149.............................NDSSPNFKSQLFAKDSQISVLKTKLSEVERKFEKRSQDYYEM----KAEKEMLEKRVENQKVSSHEMDSLQELKLARQKAQDQKEKAVEECNMHKRKIVGLEEEIRAMVEQLRLAKFNLNENKKEFDEYKNKAQKILTAKEKLVESLKS-EQGIGSSDRPVHLLQAEVEEIRVERDLTKADLESAQLQVYTLRSDMEELEAQIRDLQSQLSDQKRTHLEEKQTWDSTIGLLNEKVECSRIENEFTKQEMKR... 394
9 -16.700[S] KOG1103 Predicted coiled-coil protein  ali follow..  30................PEYDNLPEEQGVNDFSSDELMKLLSFMEGEVQAREDVIDHLKRERTKILSEAKYGKLNMNDPFAALRRDSAITGEQIDEEKIVQMYESQVDQLDKMMAVQKQSQRNAAVLLVALEKKQYKLVKKLEADREAKIRYAKQGDDLEKERNQLQQQIEFHIEEKRKAEIAKDKMEMTLGNEKKRHESIQERKQMLLKMHELRVKAEQIMLQNQNDPTKPGPSSALSERELIEELKKEVTFLRAERESLTKTQKMVKTENLSLRETVRGQE. 305
10 -16.600[K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit  ali follow..  3................................QRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLKREIKKLQKHRDQIKTWLSKEDVK----DKQSVLMTNRRLIENGMERFKSVEKLMKTKQFSKEALTNPDIIKDPKELKKRDQVLFIHDCLDELQKQLEQYEAQENEEQERHEFHIANLENILKKLQNNEMDPEPVEEFQDDIKYYVENNDDPDFIEYDTIYED......................................... 209
11 -16.500[T] KOG3872 FOG: FHA domain  ali follow..  10  396.........................................NNSAGTSINLINMIKTLTTELSLEKQELEKLHSMQNFMQNYTINLDFINKHMIDMNEKHLLKLSTALQKTLSENNDALLKESEDQLKEIKQQNNKVK---SACSLKEKQNHEKLQELESELRELNLQIEEERGKNLVLTQSNFNGGINNDNNAKVKQNDSREEKKDTEDTLISTEELGVVEGKRTRVSKGMLFGVVAIS........................................... 591
12 -16.300[R] KOG0804 Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein)  ali follow..  340................RHWELTSHTYSLKVGGERVWDYAGDNYVHRLIENGADGKLVEYQRESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFE-----GLRHDMEQTMSKMEKTAYAQVENLEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQVNDLLMHF----ETQNKLKEQLDAGKITQEEITESQVELDSSSSSSRKLNRKKKK....... 590
13 -16.200[U] KOG0999 Microtubule-associated protein Bicaudal-D  ali follow..  11  1.....................................................................................................MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELE. 185
14 -16.000[S] COG5293 Uncharacterized protein conserved in bacteria  ali follow..  12  193.............................................EDARELQLLNDKQKLITDIKKLKKDTESGVAIGILGSLGELEALKVQVEAQLRERKETLNNFRVAEQYHELEERVNFLTSQIHEATNKNITDQKLLEFYQSSLKSIENRREFLGSEIKRLRRDLVSRENFIREKSNERAELLEVLKTHGALEEY--TMLQEIYLDNVANLNEINKRIEELKQFEEERSSLKIEKELLLQRARRDYGERNEQAERAIDLFRINSRFLYDTPGR...... 460
15 -15.900[S] KOG4360 Uncharacterized coiled coil protein  ali follow..  11  105........MTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHE----LQDRNMECLGMLHESQEEIKELRSRSGPTAHLYFSQSYGAFTGESLAAEIE. 379
16 -15.800[D] KOG4593 Mitotic checkpoint protein MAD1  ali follow..  11  364................MRFSVLQNEVVQSTMKIGEASTRIKQLEETLEAIQLGRQNAVSEAALAKEKSEALVKRIEVMLTLVTEEKEQLKAVVNERKSNSEGSVSGAADGALIQGFESSLAKKENYIKDLEQDLNQLKDVNNRQRTEIELLNEKLVDEARRNKSLERDSDRLRSEISLLESKLGHGDYSAANTRGVENEAKQTIEALQAELQKTKERLQAVEELKSQSGDAGKLVDSHITGKIAQLKEQNATLEKREERYKTVFADRISVFRR.......... 632
17 -15.700[R] KOG4398 Predicted coiled-coil protein  ali follow..  12  87................................................................................................VRNGNITHSQAERPESLTEKQQRYINLQAGLKTFSTRYERLIGQHRSNEDAIKAKRKQLELLQQLISGTGQRLRVLGERRDELRRANAEKRKNLPKYPDKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRSIQQLVTYVFPIAEVVLKEEQQRRASVERTEEAETIAALADAKNTSYIRGK. 275
18 -15.700[Z] KOG1853 LIS1-interacting protein NUDE  ali follow..  10  2..........................................................................................................EDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAE---LETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEAR. 174
19 -15.700[T] KOG2751 Beclin-like protein  ali follow..  14  64...................YRLTDSINGTGFMLVSDGRDNKKMSAAFKLKAELFDCLSSNSEIDHPLCEECADSMLEIMDRELRIAEDEWDVYKAYLDELEQQRVAPNLDKELDELKRSEQQLLSELKELKKEEQSLNDAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLRD........................................................................................ 242
20 -15.500[S] COG4913 Uncharacterized protein conserved in bacteria  ali follow..  11  213........LFHQTVSMKSVGNLTDFVCSHMLEPCDVGSRIEALICHFDDLDRAHQAVLTAKQQVKL---VPLVDDVQKHQTQLASIQALEAGRD-TLRPYFAQLKGELLKHRLDALAAEAAQLTVEIQHLEEQRKAADSEVTQLRQALRDNGDRLEELAAEIEQLEQAKAQRQKKSDRYQTLLTKIDETAPADAIGFLTQQQRFAQHTEELNAAIERLHNDKSEKDRALYDAREKHTTLLAEINSLQQRQSNISAAQIRIRHDLCM................. 468
21 -15.500[R] KOG4403 Cell surface glycoprotein STIM, contains SAM domain  ali follow..  12  230.......................................................................AYIQNRYSKEHMKKMMKDLEGLHRAEQSLH------DLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIE. 434
22 -15.400[S] KOG0992 Uncharacterized conserved protein  ali follow..  12  254................KQLIQAKDDKHIIQQYEVKLQTSTAELERRLRESEHDVERLRTSQLEMATKFEEASREN-TDLLSKIDILQDQLSLEEDRRKLCEEQIDRKGVESFVESSSHRIEETEKERETAEEDREQAELEAAEYREQVEKMLKLTQELTERNMELQRKLKDEEGKNTSHNSTIEKLQVELTTSLELCKSFEETNLKISEELENLKTEMQKPVTLESLEENFYRDKYDEASRKLEQTEAKLAEEKNNFSAFKKKLKELKSELSGYRKNNGAGD. 523
23 -15.200[U] KOG0993 Rab5 GTPase effector Rabaptin-5  ali follow..  12  534................DMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEE---QQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGK-SLQQAEDFILPDTTEALRELVLKYREDIEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSE. 815
24 -15.200[Z] KOG1003 Actin filament-coating protein tropomyosin  ali follow..  12  1...............MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDKSLMASEEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIH. 271
25 -15.200[M] COG3264 Small-conductance mechanosensitive channel  ali follow..  1.....MRLIIATAPDSKQITQELEQAKAAKPAQPEVVEALQSALNALEERKGSLERIKQYQEVIDNYPKLS-----ATLRAQLNNMRDEPRSVSPGMSTDALNQEILQVSSQLLDKSRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLGTLTGNTPLNQAQNFALQSDSARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYLQALRNQLNSQRERALESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDLVASQQRQAAS 291
26 -15.100[Z] KOG1850 Myosin-like coiled-coil protein  ali follow..  10  235..........................ERRKEATAHFQITLDEIQAQLEQHDIHNAKLRQENIELGEKLKKLIEQYALREEHIDKVFKRKELQQ--QLVDAKLQQTTQLIKEADEKHQREREFLLKEATESRHKYEQMKQQEVQLKQQLSLYMDKFEEFQTTMAKSNELFTTFRQEMEKMTKKIKKLEKETIIWRTKWENNNKA------------LQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVM. 477
27 -15.100[R] KOG1899 LAR transmembrane tyrosine phosphatase-interacting protein liprin  ali follow..  15  54...............IEDLRLALEMLELPQERAALLSQIPGPTAAYIKEFEESLSQVNHHSAASNETYQERLARLEGDKESLILQVSVLTDQVEAQGEKRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTEVSELKLKLVGMEKEQREQEEKQRKAEQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSRTAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRIEELTGLLNQYRKVKEIVMVTQGPSE. 325
28 -15.000[R] KOG2896 UV radiation resistance associated protein  ali follow..  12  197............................................................................................................................LRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSN----ELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYI....................... 328
29 -15.000[A] KOG2991 Splicing regulator  ali follow..  1..............................................MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSN-DVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQAS. 247
30 -14.900[S] KOG4421 Uncharacterized conserved protein  ali follow..  12  1.......................................................................................................MAEKSLAMDGTVPEAKYQKLATEYSKLRAQATVLKKAVLEEQSKEASLREQLQQYATSLRRTEQEVDSLGFRNKQLESRVSQLQQEISVHEQPKDSGGRRGVQSNSRPDADPSLDAAQEALIFEELQKKIMENAQLTSLIDDKQRDLLLHTERIASLEQKLEKRIGDQNELEKRLRK... 181
31 -14.800[OUTIV] KOG3956 Alpha 2-macroglobulin receptor-associated protein  ali follow..  180....................................................................AEELKSLKQEFDHHQDKVDVYYSLLE------NIGTVDTDKHENAINTEDLDTYNLISNDVNENDIKTHAQNVKSFENDLNTLRGHHTGIKDHYDRLERLVSSGPHSQDFIEPKVQGLWRVAQASNFTVKELESIKTELHHFESRLLKLRHLHAEHALQKEKYKGEKVKDKSSRFEEMEDQLKKQTRKVEKLQENIEKTIFKHTEL......... 379
32 -14.700[K] KOG3915 Transcription regulator dachshund, contains SKI/SNO domain  ali follow..  10  448................EGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLSPNVLPG-----PKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAAST-----DSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTT. 703
33 -14.300[KT] KOG3667 STAT protein  ali follow..  41.......................QDWAYAASKESHATLVFHNLLGEIDQQYSRFLQKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQ--ANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELF. 313
34 -14.100[T] KOG2008 BTK-associated SH3-domain binding protein SAB  ali follow..  10  1..................MIVCLKLILNLYSNYKFFLLLLQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGNCIEKARPYYEALD---KAREAQIECQKAAVKFQRANEIHAAAKETVALAEQRFMSNSHEWQAWQEMLNHATQKVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPYFEEKQVCQDQLQTQKNRIQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGP................. 248
35 -14.100[S] KOG4657 Uncharacterized conserved protein  ali follow..  14  3...........................................................................EDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKR................................................................................ 130
36 -14.000[K] KOG2150 CCR4-NOT transcriptional regulation complex, NOT5 subunit  ali follow..  1MA--EVDRVFKKINELEIFNSYYERHESCTNNPSQKDKLESDLKREVKKLQRLREQIKSWQSSPDIKDKDSLLDYRRSVEIAMEKYKAVEKASKEKAYSNISLKKSETLDPQERERRDISEYLSQMIDELERQYDSLQVEIDKLLLLNKKKKTSSTTNDEKKEQYKRFQARYRWHQQQMELALRLLANEELDPQDVKNVQDDINYFVESNQD....................................................................... 217
37 -13.900[D] COG5185 Protein involved in chromosome segregation, interacts with SMC proteins  ali follow..  11  352.............EKRDSLKYQVENQDISISEFEKMVSEREQLDRNLNMIGSKISELRKEVFDTDLLIQASIDSLEKKVQKFNSLAYRIGIV---PIAAIRSANNDFELEINPEGPNYINLDLKNKVRPINEVRRSITLEFHEEQNKSLKLQEHVDTVNDLIAELQDELRGIESRLTSVLSECNMLRETASEEDAESDKLERELQQLKLSSHNSMLQLDQRIQSINIEADQIAHACMEYKNNIKEVAFVLGEIIHFKLHVQDSLEDLKMDYQKELDDLSRSE. 623
38 -13.600[T] COG5585 NAD+--asparagine ADP-ribosyltransferase  ali follow..  10  1.........MSNSEYYEELTDLSVRIALGIK---NRTEPLDELNQAMTQLSQTNAIKGNAANAMKAYISEVHMTLIQTLELILNNYEMALGKYVKGYLEVDSDESFKLIKEDFDAHKHNLSSHQSDFTSIGNKLKAISDEAEDIIPLRGAGSKRLFNVAKDMGTMKEIVSNLNNKWNDYEQADPGFNQVQDLIAQTTSLLKSTLSV--------PRGYSYSPGSFSKLISKDFVNAFEVNANYAQNADNQKAFKANWDRISKNYTTDQNRMAEEAKKEAQKEG 264
39 -13.500[Z] KOG0980 Actin-binding protein SLA2/Huntingtin-interacting protein Hip1  ali follow..  12  298.............TSLNGHDGELLNLAEAEPQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENRLLQMQGEFDHAKREADENREEAQKNELALRDASRTQTDDARVKEAELKATAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSKFDKDEEITALNRKVEEAQREAGRALTKAEGDAGAVDEMRTQLVKADIEVEELKRTIDHLRESHANQLVQSSAELEVAKESGVGITQMFDHCEDALQNATSITYPPHLAQSAMN. 577
40 -13.500[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  13  699.............DQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEK----DSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI.. 962
41 -13.400[K] KOG0963 Transcription factor/CCAAT displacement protein CDP1  ali follow..  281....................................KQQLDFMDSLNKKLSTELESIKEASRKEMETHCATIQTLENEVKEARKVKEESLTLANKFSDYDEIKRELSVLKQIEFSGEHATHENTSLESQLLKREKQLSEELAKLRSTNAQLTDRITQESKKASFLEQKASEQEEVIRKLEKDLADVDVEGSVYLSNTTYRREGTSGQLSPTSAIVDVIKQQRDRFRRANVTLVNQVSAANDKIALLESKLEEVEKSNTLLYEQMRFRDHYQKHVEPSSSHLQ. 551
42 -13.400[V] KOG1962 B-cell receptor-associated protein and related proteins  ali follow..  14  119.............................................................................NLICTQANLMAQSEASFKQAQSATAAARSLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKD.................................................................................................. 227
43 -13.300[S] KOG4451 Uncharacterized conserved protein (tumor-associated antigen HCA127 in humans)  ali follow..  10  48...............................................KQENAEDFELDLGVGLLWNLGHHILSKTFLDILSGIDEFHKLANEIRKDEDCVK------ALEQHITSCNGIKGELDMERRSHAEELRQINQDINTLEDITKSSKTELEKRKMKISVAMGEVARMRGFINENLESMNIIHKLETSEEEELFKVTCARQTTDP.......................................................................... 203
44 -13.300[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  10  509................EQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLASICTRECNDEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVS. 779
45 -13.200[R] KOG2010 Double stranded RNA binding protein  ali follow..  114................ESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSKEL-ERQKHMCSVLQHKMEELKEGLRQRDELI--EKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEME. 376
46 -13.200[S] COG3551 Uncharacterized protein conserved in bacteria  ali follow..  187..ILSYEGFLV--DWRKHMDRAAEKTGVVWPAHP---DRSDVKVEQFLTTDLYHERSTPEDMRHHPEVASLVRETYQILSTIAAGDEDNGLLDQLDIMRTRFDDACETFSAAMATEELAVVQLRGELSTRSTETERARQENSKLASFLEQQSLEVRGLAAERDALVGTRGTLIAERDALVNAQASLIAERDALLRDMSCIANERDALLRSRS....................................................................... 391
47 -13.100[R] KOG2220 Predicted signal transduction protein  ali follow..  392................QTLNAVLASLNLPADGNSGLPPSLKEKANEVRQKIENVQTMLKDLPELLNRNREILDETERLLDEERDSDNQLRAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKDVETIKAEREAIESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSG 668
48 -13.000[A] KOG4849 mRNA cleavage factor I subunit/CPSF subunit  ali follow..  476.............................................................SSAIETLVTAISLIKQSKVAHDERCKILISSLQDTLHGIEAKSYNRRERSRSRERSHRSRQRRERSTSRYRERSRERERDRDRERERDGGRSVRPRKSPEPVVAEAAEAPSSKRYYEDRERYRSSDRERRDRDRDRDRERERDRDRHFTNDGRGLPLDPSNFTSQNPGNIKTGRPKSAAVAGGSMEKPRGQSAWDIIDTDAHWIIKQQTTSIPAPPSSQQN. 696
49 -12.900[L] COG0419 ATPase involved in DNA repair  ali follow..  10  86....HLETLTKTFKNLSEAKPIFDEIELLDKRLSETKTELSDLQGDLQGLDIRKDEIQSELDTLYLRRANLEKLQLSNLEEEIRTIDRETEVLRIELPSSIAHHNLDEIYAEREKLLEKRGYLRKQIERTKLEETSFKKKIDDAVLANNEQKLKLTKLNFQVNELEQLEKDINKSSEDCDLQKKKLLEVSSKQGSQAPFLNELESEYEKLEADIQEMAQKSRTEILEANEYLHQLNEWNSELRIDVSTKFKCIKEKKSNIGEEVRIIASKIESTDDNLRKLQ. 368
50 -12.700[D] KOG0995 Centromere-associated protein HEC1  ali follow..  12  253.............SALEMLNYECDEIEADKGNEASLKEEISRIRDDIRKAKDYLEQNLHVKQHMEKE----LAMVKSEQEEKISENEKVQKMVDDLKNKIELQKQIHGLGKEVRQMNLDNNKDKEVVLEIQSELDRLSKETWKLKDESRQLHQRKLELETEQSRFSNKAVTAEERIQIQSETLCEAKKNEAREERIRRNERDSWKDARKHIEQRYEQLLNEKEVLLKQMKLDGSLEKEIEDETARMSATGEEHIQKRSQLEAGIRQILDLMVVEIAEIENKK. 575
51 -12.700[OU] KOG2391 Vacuolar sorting protein/ubiquitin receptor VPS23  ali follow..  206........................................................................................................................GDIVLMRSAREVETEGLLSLQSDLKRREEEINNGFKEMVIEKETLEQQLQVIAMNTDVLGSWIRENQGKAKDLLVDLDV---------DDSFECIDSLSKQMLECTALDLAIEDVVYSMDKSFRDGSLPFDQYLRNVRLLSREQFFHRATAEKVREIQMDAQ. 358
52 -12.500[U] KOG4324 Guanine nucleotide exchange factor  ali follow..  13  1..............................................MVDTISVLNPIHLDLSVDPQDNVRISARSTTSSSASTSSDSELMSPRAEELLRMQ-----AELRATRTALAEKDKKMTQIQVTVDAEVQELTEKLQEAYKMVNTAEARREKAGKLLTESRLEVEVLQAEVRALKELISAPGMGQNHFKQTTSPEHKS................................................................................ 153
53 -12.500[Z] KOG2685 Cystoskeletal protein Tektin  ali follow..  82.............................EDWDYNNKIKFRITCDQEKLAERIVEESRRVVDETKDTTKNWQREVEHHMRERTSEIRFLVDELNRQKKTAALED--EALNTYRNRVLNCIEFLKDKSLAICKQCLILREG-RSLRRELKVIKGCQGLADAALKEAEEQIRKLRAAIYLLDQDLAAKDKSLAIDEKNLKLKEEWQAQTYENLEANAKALVSAGQLRAYIDLLLKQVCEDMQNQTDRFERRISETKHVKQCLENKHKDTMDHIHQVQRNMTELE. 368
54 -12.300[S] COG5280 Phage-related minor tail protein  ali follow..  3..........................................................................................................KKISGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKQQLLSKQVELTTKKLDGLKGAQADVDRQFKSGDIGEEQYRA----FQREVVATEGRLDHYKQSLKDVESSSGEAGNATKGLGGKFDELGQSVEDVGEAVKGG.................... 155
55 -12.300[R] COG1579 Zn-ribbon protein, possibly nucleic acid-binding  ali follow..  13  12..........................................................................................................QELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRKVQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKDEFNALTQEMTTANKERRSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKALLEQRTELKHATNP................. 173
56 -12.200[S] COG1340 Uncharacterized archaeal coiled-coil protein  ali follow..  14  1..............................................................................MTDLLQEFEEKRDILRKAIE--EHIKKRDEAAQQSRNYAEQRDQLNAKAHEMRDQVKQKISQKNALIEEVQKIRTEKEEHFQKLSELRKEYKKITEEANYASVNQRDIKAKERELQKLIKKQETMQLPKAEEDKVVQEIKRLSNKEDREKQLSENEKVKALLAEIDKEKTLARDLKKRAEEISNQISEISNDINKSLQELDEVR. 207
57 -12.200[D] COG4942 Membrane-bound metallopeptidase  ali follow..  42..........................................................................................................ADERDQLKSIQADIAAKERAVRQKQQQRASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQNQARQETIAQLKQTREEVAMQRAELEEKQSEQQTLLYEQRAQQAKLTQALNERKKTLAGLESSIQQGQQQLSELRANESRLRNSIARAEA 253
58 -12.200[S] COG3074 Uncharacterized protein conserved in bacteria  ali follow..  20  9..........................................................................................................EKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEEV........................................................................................................ 81
59 -12.100[R] KOG2135 Proteins containing the RNA recognition motif  ali follow..  392.TVDNIQVRYNGEIDSALVT-----YASKFDAGKAYKSPTPVLNNRFIKVFWHNPGGEGSENATGKPSSPTSPPKPVEKPKIATVQESKFVSVAAQNYRKQIQDAKERLTKEKSILSTLVQAQNQHNIILDKWMVKQKELLIKARTSTDE--TDKKNATKLVKHLHKKIKACKEEVDGILLKISEKSMVVDEIAAQIEELKNPQKSDDSTRKRKAGSDGDEPQSKMSSVVIVRGVTDELVTDLMAHMEKFGEVFDHSVKADDDGLITAVFPFRKTGDALK... 663
60 -12.000[U] KOG3838 Mannose lectin ERGIC-53, involved in glycoprotein traffic  ali follow..  262.............................................................QVQEQPKVENQEKLTQEYKEYQDKLEKQKQEYKKDHPDEHKDEEDWE-EFYESENQRELRQIWQGQSQIADHLRELSRKVDEIIGRQETTLSLVSRNAGQALPPPAAGGVPQQQLPVGAVSRSDVDLLLTNQNMLLSSIREIRQLVGDINVRTDNIQTNQKHAPTAQIQSTG---YDVQTLIAEMRDGMNQVKQGITHVGQRLAAPQGA............. 466
61 -12.000[K] KOG4005 Transcription factor XBP-1  ali follow..  18  76...............................................................................................DHLTWEEKVQRKKLKNRVAAQTSRDRK--------KARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQELAELKQQQQ............................................................................................ 163
62 -11.900[S] KOG4725 Uncharacterized conserved protein  ali follow..  61...................................VHGEGPTSSATLKDLESPCQEPAVVPDSRSVKISQLKNTIKSLEKKANNEKQKAERELEVQIQRLNTQK--GKLNMDLYHTKRSLKYFEDESKGLAIRLQHSLQRIAELERALFAVTTTQEKKEDSVHTLKKEPLLPEPPGVPSEVELQHLRKEVERVAAELQAQVDNNKRMSVLILGQKERLQEQDERLREQDARPQQLAEPQSSFEENKNKSALQLEQQVEELQEKLGEVELKSREAQSLQQHPD. 329
63 -11.900[S] KOG3096 Spliceosome-associated coiled-coil protein  ali follow..  98....................................QEAIENSMAQLEHQWVRSLNLELMLDYGTEAWKSYLEVFTAMQAKAQLQLQQLKKDIQD---NWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVELEKIVHAARQQLRKITPPPSANDTAPTPEYTNGFDQNDLAESNGSSSSNPDPSQPGDDGTDADGDSKEEDKSEAQEESSNG.................................................................. 276
64 -11.800[UD] KOG2218 ER to golgi transport protein/RAD50-interacting protein 1  ali follow..  55.............................LEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSL-KKLDKLIEQRTVSKMQLEEQVLTIS-----SEIPKRIRSALKNAEESKQFLNQFLEQETHLFSAINSHLLTAQPWMDDLGTMISQIEEIERHLAYLK-WISQIEELSDNIQQYLMTNNVPEAASTLVSMAELDIKLQESSCTHLLGFMRATVKFWHKILKDKLTSDFEEILAQLHWPFIAPPQSQTVGLSRPASAPEIYSYLETL.. 299
65 -11.700[D] COG4477 Negative regulator of septation ring formation  ali follow..  11  198.........................................EAAEVLETAEEHTIALRAITEQIPSFIKTIEKDVPKRLEELQEASDKFVAEEYILPDNVNIKERMDDLHDHLVESSSLLEQF--ELDRVEAELGLIQEKVEELYAIFEREYSARRNVEKRSSVLKEYIEHIRANNKNLLLEIDHVTQAYILSGNEKGYVRGYQEHLES-LDSDVDEILGNIQAKTMPYSILSRRVNSVVNALEDIEKNQIKISDTLTGLRDEERAAQEIAERFDSELRTIK. 435
66 -11.500[R] KOG4331 Polytopic membrane protein Prominin  ali follow..  174................................SQYAQIGLDKLPNRMNQCVDDLQSY------KRDSDMRIRKLLIDDYQVLNSTITKQLSTAGYNVVDRVKKLTGAHVIDVFMNISKVAQEMHDGLESVHGKVRFLNEEGSRFEAEFSRLRNTANELVKCLENELEPVRSMCAKAERLLESLAVTQFKIDQKFLPDATETGLSEIVNANITQVLAASNNQFEQLESRIQ--HEIDKETYSAQNMLKQIGDDLFLVAETISTQLRKVTFEALYSTVSY..... 412
67 -11.500[K] KOG1414 Transcriptional activator FOSB/c-Fos and related bZIP transcription factors  ali follow..  14  243..........................................................................................................NRRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHRSHSSLAGV............................................................................................... 324
68 -11.500[S] KOG1043 Ca2+-binding transmembrane protein LETM1/MRS7  ali follow..  476................SSTTEAKEPAAKPSEAKEEKKEDITVDKKDLSHIEEIIVG------GPIKEAKHDILGLREKVLEHKEDLMEINSLDGAFAETKIAKRLRHKLNSMIEDVDSMVDKLEDEKRNIRERIQDVIDSLAKLKESKGEQADDGEQRERKHTDVHVSAAQMASMIGTLKKEDEVAGLTEEIRKVQSGNYQMPILPTGPSSADAFNQPQGVYTASKQVPARSEQEGVEQKQQVENGPVGIPDVDTKVTSTLQQNSSKTSSSSTTKSTSDSKSA 784
69 -11.400[T] KOG3759 Uncharacterized RUN domain protein  ali follow..  10  1..................MEMKMAEAQETKDSCSTIEGQLPAGPVRAEDEEEEVEVEQEQQELLSERWSPLGANYDDANSASSGVDCELEPGLEKSEARRG---STGSELARLRSIEEEQELLTSSLLALTSHFAHVQLRVRQIAEERDQLLRDLEDFDKPASDGEKDHGPDSQLIQQLKSQLTELEQIAYEAGEPGILPQHVLLEKQKFLDELRAKLNLQVEQHELPALSTEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAIEGS. 282
70 -11.400[S] COG1511 Predicted membrane protein  ali follow..  10  111................EDFSKNASTVLDKNPKKLDLKYHTNAGSNYVGATIGEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAKGLSDASSGAKKIDDGTDAKNGSAQLKENLAKLKESTATISDKTAQLADGAAQVTSGIQSLDSSLGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQEGSEKAAKAEKIIALDLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVINSSDFLTAEQKSQLINS.. 377
71 -11.400[D] COG5244 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B  ali follow..  10  414....................................NALLSHKVLKLTEEIQDLETLNQLNTEIEARQSEKLNEVQEETQRLSQLLISSQ---PALTEVKHLKLCLSDSQEELLQLNAKLEKANIVIDELNSAKLKLSKQVEEESSMKDDLTEMNQRLKEQIESYENEVNEFETLKTQYEKNLCNLREQLKTARMKLADKYPQGDNTSENIDWLKHSLRDSNTSIPSPLTFACKEIRKLVADIKPVSVEKQLALNWKKDIERPSFHHNQQLFNYCQLTDILS. 667
72 -11.200[DZ] KOG4302 Microtubule-associated protein essential for anaphase spindle elongation  ali follow..  12  1.........................MLEIGSPNALFFRTNTTCNNLLRELQKIWVEIGETETEKDRMLMELERECLQIYQRKVDEAANSKAKLHQSVASIEAEV--ASLMAALGVLNINSPKLDKGSKSLKEKLAAVTPLVEELRIQKEERMKQFSDIKAQIEKISGEISGYSDHLNKAMRNLNEYQTHLRTLQKEKSDRLNKVLGYVNEVHALCGVLGVDFSQTVSARTDQEQSTNISDSTLEGLEHMIQKLKTERKSRFQKLKDVVASLFELWNLMDTPQ. 275
73 -11.100[S] COG4467 Uncharacterized protein conserved in bacteria  ali follow..  14  2.............................................................................................................................NKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHLEHETVAKNPSKQRKDHLEGIYDE................................................................................. 78
74 -10.900[S] KOG2701 Uncharacterized conserved protein  ali follow..  10  275................KHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAEELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPARQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKEEGRKNE. 564
75 -10.800[S] COG3883 Uncharacterized protein conserved in bacteria  ali follow..  10  23.............................................................................................................TNVFADVNTDIQNQDKKINDIKSKKTGLQSDLSSLVADLEKAQEKAKSLQGEFDQTGKELKQLNQDIKDINERIKERETVLKERARAMQKTSNSNAGRVSAVNQLVDSDKSILEDQQKDEKALKTKQTAVKKKQEEQATAIHEFEAQQNKIEAQKAEKEAIVAQLAADQA.... 207

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.