current user: public

Query: [R] COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
8 -13.600[T] KOG2751 Beclin-like protein  ali follow..  17  113................................................................EECADSMLEIMDRELRIAEDEWDVYKAYLDELEQQRV-APNVEALDKELDELKRSEQQLLSELKELKKEEQSLNDAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLRD........................................................................................ 242
10 -12.900[S] KOG4451 Uncharacterized conserved protein (tumor-associated antigen HCA127 in humans)  ali follow..  48...............................................KQENAEDFELDLGVGLLWNLGHHILSKTFLDILSGIDEFHKLANEIRKDEDCKALEQHITSCNGIKGELDMERRSHAEELRQINQDINTLEDITKSSKTELEKRKMKISVAMGEVARMRGFINENLESMNIIHKLETSEEEELFKVTCARQTTDPPTPSVPR.......................................................................... 210
15 -12.100[V] KOG1962 B-cell receptor-associated protein and related proteins  ali follow..  15  114.......................................................................IRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKITIGGGGNKD.................................................................................................. 227
20 -11.500[U] KOG4324 Guanine nucleotide exchange factor  ali follow..  11  1.........................................................MVDTISVLNPIHLDLSVDPQDNVRISARSTTSSSASTSSDSAEELLRMQAELRATRTALAEKDKKMTQIQVTVDAEVQELTEKLQEAYKMVNTAEARREKAGKLLTESRLEVEVLQAEVRALKELISAPGMGQNHFKQ........................................................................................ 145
28 -11.100[K] KOG4005 Transcription factor XBP-1  ali follow..  13  71.................................................................................................KKRRLDHLTWEEKVQRKKLKNRVAAQTSRDRK-KARMEEMDYEIKELTDRTEILQNKCDSLQAINESLLAKNHKLDSELELLRQELAELKQ............................................................................................... 160
33 -10.800[S] COG5280 Phage-related minor tail protein  ali follow..  3..........................................................................................................KKISGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKQQLLSKQVELTTKKLDGLKGAQADVDRQFKSGDIGEEQYRAFQREVVATEGRLDHYKQSLKDVESSSGEAGNATKGLGGKFDELGQSVEDVGEAVKGGVLMEAADH................ 163
39 -10.200[S] KOG4657 Uncharacterized conserved protein  ali follow..  15  2..........................................................................VEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANA..................................................................................... 125
41 -9.810[R] COG1579 Zn-ribbon protein, possibly nucleic acid-binding  ali follow..  13  12..........................................................................................................QELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRKVQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKDEFNALTQEMTTANKERRSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKALLEQRTELKHAT................... 171
42 -9.750[N] COG3352 Putative archaeal flagellar protein C  ali follow..  40...............................................................................................PKVIDAMNERMTKIENNLGKMTAELEGQKKSLSDMKNELEGIKENVKMVVSLYELVSRDFNPIRGITEELSDQINNLKRLVESAIKDLRELYGVPDIDQVIQMEEKK................................................................................. 154
47 -9.520[U] KOG1955 Ral-GTPase effector RALBP1  ali follow..  12  596....................................EAEKHPEVLPAEKASDPASSLRVAKTDSKTEEKTAASAPANVSKGTTPLAPPPKPVRRRLKSEDELRPEVDEHTQKTGVLAAVLASQPSIPRSVGKDKKAIQASIRRNKETNTVLARLNSELQQQLKDVLEERISLEVQLEQLRP...................................................................................................... 740
53 -9.200[K] KOG1414 Transcriptional activator FOSB/c-Fos and related bZIP transcription factors  ali follow..  15  253...........................................................................................................................AAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHRS............................................................................................... 317
54 -9.180[T] COG3103 SH3 domain protein  ali follow..  14  1MPKLRLIGLTLLALSATAVSHAEETRYVSDELNTWVRS--PGDHYRXVGTVNAGEEVTLLQTDANTNYAQVKDSSGRT---------PLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLDDKQRTII.......................................................................................................... 170
60 -9.040[K] KOG3915 Transcription regulator dachshund, contains SKI/SNO domain  ali follow..  13  560.................................................................PDGLSSIETLLTNIQGLLKVAIDNARA-----QEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQ-AASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTT.................................................................... 703

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]