current user: public




Query: [R] COG3910 Predicted ATPase, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MLFLDSVAMKEKPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLDDLast
1 -121.000[R] COG3910 Predicted ATPase  ali  100  1MLFLDSVAMKEKPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLDD 258
2 -47.500[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  13  4...........QLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFTKTPSDKAIRDL-----RRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCPQTEAFKNYLSH....... 242
3 -46.000[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  14  7...........NVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVRDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAGKYPVHLSGGQQQVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPENPQSPRLQRFLKG....... 254
4 -45.700[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  15  3...........NFKNVSKHFGKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNSPNID---------ERQIRLEAGMVFQQFYLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPAELSGGQQQVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDNPPSERLREFLQH....... 238
5 -33.800[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  16  1MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQL-------RAQHVGFVFQSFMLIPTLNALENVE--PALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREGTTLILVTHDPALAA---DRRLRLVNGQLQEEA....................... 228
6 -33.500[D] COG2884 Predicted ATPase involved in cell division  ali follow..  16  15.....................ARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRL--------RQVIGCVFQDFRLLQQKTVYENVA--ALEVIGRRSDAINQVVPDVLETVGLSGKANRLPDELSGGEQQVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVR......................... 218
7 -33.000[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  13  1MINVQNVSKTFILHQQNG---RLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIKHGDEWVDLVTAPARKVVEIR---KTTVGWVSQFLRVIPRISALEVVMQ-PLLDTGVPREACAAKAARLLTRLNVPER-HLAPSTFSGGEQQVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGASS............................ 226
8 -30.900[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  12  2......IEIKSVNKVFYQGDKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLCA--------ARRNIGMIFQHFNLLSSRTVFENVA--PLELAGQSQQHIETKVTELLALVGLSEKRESYPANLSGGQKQVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQNLTILLITHEMDVVKSICHEVAIIGGGELVEGDIFAHPKTELAHQFIRS....... 243
9 -30.800[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  11  7...........QVHELSKSYGGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADH--IAVDHGNVTYISRSGEDLEIFQLAEAKRRLLMRTEWGFVQQRDGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDTRIDDLPAQFSGGMQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTD-PQHPYTQLLVSA....... 253
10 -30.800[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  14  13.......................HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPS-------------RRPVSMLFQENNLFSHLTVAQNIG--GLNPGLKLNAVQQEKMHAIARQMGIDNLMARLPGELSGGQRQVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQTNELLSGKASASALLGITG..... 232
11 -30.500[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  14  19.....................SYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLAHF-------RRKQLGFVFQDFNLLDTLTIGENIM--PLTLEKEAPSVMEEKLHGIAAKLGIENLLNKRTFEVSGGQRQRAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDHVTALMVTHDPVSASY--RRVIFIKDVVL----FNEIYRGENRQVFYEQ....... 237
12 -30.300[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  13  1MLCVKNVSLR----------PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMI---GALAEQFSCTGELW-------LNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLA---PATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRAVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL....................... 216
13 -30.300[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  13  24VLAVKGLV--------KAYKSQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHE---NGDTQNIAALTTKQMRKWRAKCGMIFQDFCLVPRLDVITNVLLGRLSYTSTLKSQDQARAIELLQWLNMLPHALQRAENLSGGQMQVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVIVNLHSVDLVKDYCTRVIGIAHGRIIDGPPSMLNDSIIQDIYSDESAELLH. 278
14 -30.200[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  13  2......ITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTVKQPAE-------------KQRIGVLFGGEGLYDRMTAKENLQ---GRLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEV........................... 215
15 -30.200[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  12  19.......................LAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDL--IPRRVGQIEIFGRPITKLGNLRHLLGYMPQNFIFDRSFPISVEELLGWVAEARHQKSSFLSKLRIQSREKSAAIATALKRTDTYHLRNQAIGTLSGGQLKRILAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELQQEGWTVLQVSHDIDMVSRHCDRVLCLNQTVVCTGQPEIALSPQNLLATYGPGFSRYEH 255
16 -30.100[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  15  21.......................ELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLT----LGKSGVELFGQPLRDIKPAEAAKRRAVLPQQTPLSFAY-----------EVLDVVLLGRIPHGQRETVQDRAIAAACLERVGLSGYETRDVLTLSGGEQQRVHFARTLAGERVLLLDEPTASLDLAHQHATLRLARELCREGVGVLAVLHDLNLAAQYADRVLMLAEGHVIAHPAVALTPESIRTAY.......... 240
17 -29.200[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  15  14.......................TRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMA---GMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQH---------------DKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLARREEVLTPPNLAQAY.......... 230
18 -29.200[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  16  16........................LFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDS-------------------YHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAGFEDIPVNQLSAGQQ-VALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQ.............................. 201
19 -28.800[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  15  22.................AYEVEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGKHMVGGKN------VVQVLSRSAFHDTQLVCSGDLSYLGGSWSKTVGSAGEVPLQGDFSAE--HMIFGVEGTDPVRREKLIDLLDINL--QWRMHKVSDGQK-VQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQGATIVYATHIFDGLETWATHLAYIQDGELNRLKMTDIEELKTSPNLLSVVESWLRS 255
20 -28.300[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  19.....................DAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIY-----------RQQVSYCAQTPTLFGD-TVYDNLIFPWQIRNRQPDPAIFLDFLERFA----DSILTKNIAELSGGEKQISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRENIAVLWVTHDKDEINH-ADKVITLQPHAGEMQE....................... 219
21 -28.300[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  14  13.....................GKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVS-----------------PSAERGVVFQNEGLLPWRDVVSNVE--GLQLAGMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIRDTGKQILLITHDIEEAVFLASELLLLSPGP-RYAEGEPCRAIKSDPEFIARREDVLG. 245
22 -28.300[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  14  34.....................RFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQ-----------------LNRKAGYLFQQDALMPWKTVLENVA--GLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLSQDKKAVMFVTHD-IMSAGPRARIMAEYRIPLAR---REISEIRLDNQFHEIHREIWS. 263
23 -28.000[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  14  2.....SIEIANIKKSFGRT----QVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLH-------------ARDRKVGFVFQHYALFRHMTVFDNIATVLPRRERPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEEKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLE....... 235
24 -28.000[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  13  1MPMGVAIEVKGLTKSFGS-----RIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELYEI--------RTLFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLQLVGLGGDEKKFPGEISGGRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPRETSDEPVVRQFLN........ 243
25 -27.000[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  12  14......................LSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQI----------TQMGIARTFQNIRIFKEMTLLENVVVGSLPGYRAAERRARDRALELLSWVKLDHKAGDIADNLSYGDQ-LELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRARGYTIFMIEHDMRFVMGLCERIAVLNFGRIEGPPEAIRNNPQVIEAYLGRDD..... 251
26 -26.900[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  15  1MIEINDVNKK---------YQQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLATILSVLRQENHFTSRLTVSDLVGFGRYPY----------SRGRLNKNDRQHIDAAMEFLNLMPLKDRYLDELSGGQRQRAVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADEHKTIILVIHDINFASAYSDHIIAMKNGEV........................... 214
27 -26.400[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  19  102..................................PGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPDWEEILTHFRGSELQSYFIRVVEENLKTAIKPQHVDYIKEVVRGNLGKMLE-----KLDERGLMEEICADMELNQVLEREARQVSGGEQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRHDSYVIVVEHDLSVLDYLSDFVCCLYGKPGA.......................... 295
28 -26.000[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  18  3...........SFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIM----------RKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPR--LKERYEQRAGTMSGGEQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNAALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLG........ 232
29 -25.900[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  15  5......VHFKNVNKYYG----GLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLP-------------PNRRNVNIVFQDYALFPHLNVGRNIA--GLELKGLSSDAIHKRTMELLALVKLQDFADRMPDQLSGGQRQVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVAN....... 233
30 -25.800[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  13  5LLEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMI----------FQDPSTSLNPRQRISQILDFPLRLNTDEPEQRRKQIIETMRMVGLLDHVSYYPHMLAPGQQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADPLHELTKRLIAG....... 253
31 -25.500[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  12  1.MNMSFLKITDLYKSYG----SVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ-------------RDIAMVFQSYALYPNMTVAGNIA--GMEIRKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNNPANMFVAD....... 234
32 -25.500[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  12  24...................................NGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKG-------ICLTPEKRRVGYVFQDARLFPHYKVRGNLRYG-------MAKSMVDQFDKLVALLGIEPLLDRLPGSLSGGEQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRENIPMLYVSHSLDEILHLADRVMVLENGQVKAF........................ 210
33 -25.300[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  14  27.....................EVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGL--EKPSCGEIRIDGEMIAAGAHS-------RAHGKKVQMVFQNPGSSLNPRRTVGQSVAVPLDAHGFPSLQRAKRISELLEMVQLPNFAERFPHELSGGQQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDRPQHAYTQLLLA........ 253
34 -24.600[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  13  5ILEIQDLTVS-----------GFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRI----------ARLGVGRKFQTPRVYLNLTVAENLDLAVNRKKSQATGAEQRSVGGLLETIGLTPKAHLAAALLSHGEQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAESHS-IIVIEHDMEFVRQIARKVTVLHQGSVEGNMDQIQNDPKVIEVYLGEAPS.... 248
35 -23.900[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  13  5......LDVKDLRVEFSTQDGIVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAI---MGLLAKNGKITGSAK-FEGKEILNLPERELNKVRAEQIAMIFQMTSLNPYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIRKRITMYPHEFSGGRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRENTAIIMITHDLGVVAGSCDKVLVMYAGRTME......................... 234
36 -23.900[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  14  1MLTIDHVT---------KTFGDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVNYHISNKI---------------GYLPEERGLYPKMKVRDQLV---ARLKGMEKREAVKELGTWLERFNITDYENKKVEELAKGQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKP........................... 207
37 -23.800[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  13  1MIELDKLSKTFTQKNGK----EFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTL-----------RRHIGYVIQQIGLFPNMTIEENIMVVP-RLLGWDKARCKEKARELMSMVKLEQYLQRYPRELSGGQQQVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPADEFVSA....... 239
38 -23.500[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  14  1MIRLQDIQVTFNPGTILE-----RALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANLCARVFQDPLAGTCGALTIEENMALAYMRGKKRGWSLALSNQRRKLFQERISIL--GLGLEDRLGDNIGLLSGGQQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKENLTVMMVTHSMKDALACGDRTVMLHQGQI........................... 227
39 -23.500[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  17  20........................IIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVAKELAILPQGPSAPEGL-LVKQGRYPYQNWLKQWSKEDEEA-----------VERALKATKLEDMADRAVDSLSGGQRQRAIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIAEGRPEEVITCDLVQNVFSMNCQVTQD 248
40 -23.300[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  15  7LIELRVDKY--------TYPNGRVGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVN-------------GLIPNFLGGTLEGKVRVFGEKPNPRIAFFVKQNPEEMITSTQVIDELVFPLIQQGFGWGEAKREAEEVCEELGIGGLLERKTYELSTGELQVQIAAALASKARILVFDEPFANLSRKNVLKVIKILR-----DYPHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEPGEAVYDGLIELREGELI.. 235
41 -23.300[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  16  17.......................KVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLP----------MHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEIRKDLTPQQRREKADELIEEFNISHIRDNLGQALSGGER-VEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNRGLGVLITDHNVTLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFKL... 241
42 -23.300[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  16  350........................SLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEVKISYKPQYIKADTPVSVQDFLRGITKRFGTSYYE------------------------------VEIANPLQLERIYESLLTELSGGEQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENQKTAMVVDHDIYMIDMLSQRLLVFEGKPSVYGEAHGPFSME-MNRFLENLGITFRR 556
43 -22.900[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  17  26...........ATEDLHVYYGDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDIDGCRMEGQILYDGININRKEVDLYNV-----RKEIGMVFQKPNPFT-KSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKLSGGQQQLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINEL-KNKYTIIIVTHNMQQAARVSDYTSFFYLGEVVE--------FSGTSELFTNPQEKQTE 263
44 -22.700[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  1...MPLLDIRNLTIEFMTSEGPVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAI---CGVSKDNWRITADRFRFNDIDLLQLTPRQRRKVIGHNISMIFQQSCLDPSESIGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGHSYPYELTEGCQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNTTILLISHDLQMMSKWATRVNVLYCGQTVESA....................... 241
45 -22.700[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  14  12................KTYATGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGKDYRAA------------RSLIGLVPQELTIDAFESVWATVNYSR-----FGKPPNHGFVEKVLRDLSLWDKKDAKAITLSGGKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLREDGVTIILTTHYIEEAEAMADRVGVINRGEIILVE....................... 216
46 -22.300[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  17  17.....................AVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPNDAIAL----------GIGMVHQHFMLVDNFSVLENIGAESDALLKSSIAKARSELERLEREYGLEVDPDAIIEELPVGQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQGKTVVLITHK--IMAITDNVSVMRQGTMVATRETSKTTVGELAELMVGRRVLLRVE 247
47 -22.300[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  14  19.....................DTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEW------------QRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGITPLLDRRFKYLSTGET-TLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKE.................... 224
48 -22.200[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  14  331.................AYQDNAFSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDY-----------RKLFSAVFTDVWLFDQLLGPEGKPANPQLVEKWLAQLKMAHKLELSN-------GRIVNLKLSKGQKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLPLMQEMGKTIFAISHDDHYFIHAD-RLLEMRNGQLSELTGEE.................... 534
49 -22.200[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  13  44.........................VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV-------RRKKIAMVFQSFALMPHMTVLDNTA--GMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRT....... 263
50 -22.100[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  12  358.................LSPQGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTIL---GFMPYQGSLTIN----------IELRELDHAQWRQTISWVGQNPLLLY-GTIRDNVTLGKHNIADEQVTQTLQAAQEFVEQQGLDYPISDRSAGLSVGQAQLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ-QRTALFVTHQLQPLQSVEQILVMENGLLVQAGHFEDL................... 568
51 -22.000[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  17  354.......................QALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVV-----PQRVHLFSATLRDNLLLASPGSSDEAL-----SEILRRVGLEKLLEDAGLNSWLGEGGRQLSGGEL-LAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR-EKTVLMVTHRLRGLSRFQ-QIIVMDNGQIIE......................... 552
52 -21.500[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  15  408.....EVRTVLESFGVRQRVVERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVE-----------------VVDSIAAMIPSELEPQITEKSILEQIFDITGDIHLAVEVLNRAGISDAVLYRAR----FNELSTGQKEFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREKITLIAVTHRKEVIALSPDRILYVGYGGVTESP....................... 620
53 -21.300[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  11  31......LEVRNLVTEFPLRTGVFRAVNDISFSIEPGKTLCVVGESGSGKSVILQIIDSPGYITSGSIILNKADGSSVDLAKLDPRGRAIRAVRGADIAMIFQ-SSLSPVHTVGDQITEVLRLHLKMSKAQARAEAIELLRQVEIPNALDRYAFQYSGGMQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLISRLQKAGMAVLFITHDMGVVAQIADDVLVMHHGVVKEYG--HKPQDPYTRMLIG........ 289
54 -21.200[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  11  28.....................EVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKR--------RRDMQIIFQ-ASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSDHATRYPHQFSGGQQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQPKHPYTRALLS........ 257
55 -20.800[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  16  1MLEIRNLHARIVDDGT-------EIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREDYEVTEGDILYN----------GQSILEMDPAERATSGIFLAFQ--VATMEFLKVAMNEQRKARGEEPLKIPEFLKRVKEAAASLNMDMAMLKRPSGGEKKREILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVPDSVHLYRGQVIKSGDKSLALDLEANGY.......... 243
56 -20.600[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  13  8......LSVKDLRVRFRTLDGAVEAVKGINIHVNAGETVAVVGESGSGKSQTMMAAMSLLASNGEATGS----VDYRGRNLLTLSKSDLNKVRGAKISMIFQETSLDPLYSIGNQLIEPIRRHRGLNAAEAREEALKLLRLVHIERRMKSYPHEMSGGQQRVMIAMALANDPDILIADEPTTALDVTIQAQILMLLAELQRKGMAIVFITHDLGIVRRFADRVYVMRQGEVVEEG--ANPQHAYTKMLLA........ 258
57 -20.300[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  14  21........................LLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIA------------NGQLDGFPDKDTL-------------RTCFVEHKLQ----GEEGDLDLVSFIALDEELQSTSREEIAAALESVGFEERRAQTVGSLSGGWKMLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEH--TDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDSN 225
58 -20.300[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  15  32.....................QILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLT----IKPSGGKVRVAGFDPFRRQTAFLRRTSLVMGQKQQLIWDLPTLDSLRINGAIYEIPDQVFE----------QRLGELSEMLDLTTELKQPVRKLSLGQRMKELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRQATVLLTSHYMADITTLCERVLLIHQGQL........................... 231
59 -20.000[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  17  109........................LLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTV------------KLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAE--RSLPKSKKKLRVQALIDQLGIRN-GDEGHRGISGGER-VSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPLIFLSRGHTVYS................................. 315
60 -19.900[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  12  87.......................ELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLG-------------GREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILKDFSGGWRMIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTY---KRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNW 320
61 -19.600[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  12  239........................GGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDDALMRGIGLLPESR-------KEEGLITSFSILQNISLNNYRKYRKAHWFLDLKKELEHTTKAMAQVQYARVDTLSGGQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAARGHSIIMISSE--VIGMSDRVCVFRSGGIVATVEGEDINSETIMTNATTGR...... 467
62 -19.500[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  14  351.......................PTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETLGRHI-----------GYLPQGVELFD-GTIGENISRFDDNPDPEAIIAAARAA-----EKGYDSDIGEAGSTLSAGQQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKARGGIAVVVAHRPSAIGAVD-YILMMEDGRMKAFGPRD.................... 557
63 -19.400[R] COG4637 Predicted ATPase  ali follow..  13  6DKQLSRIVLKG--------------FKSIAKCDLESRVNILIGANGAGKSNFIGFFRMVGQVSRQGSPDALLHFGRKTTEHLEFQLYFIKQPHGINDNAYLRARNLASFLYLLRNSYPASYQRIVKTIRLVAPFFGDFYLRPAPQNKEVIELYLLSDGT-ATVFLQPEDLQPETILVDEPELGLHPYAITVLASLMRTASK---QVIVSTQSIELLNQAKDVIVVDRSEGSSYLRRLNQGDRIHFTGY.......... 343
64 -19.100[S] COG4938 Uncharacterized conserved protein  ali follow..  13  1..MINEVTLRN--------------FKCYKNQLFEANLTVFCGNNSSGKSTVIQSLSLSILIDTSVGAVSWGYSEDEFSSQKRKEVEEAPLPLLDFSDKTVLHKLRELYEDEFIYLHAERWGPRSSYPYSTRRRSQNWLGTNG-FGGESYRAVNVGFGLSYIVLALLVTKPGGLVIIENPEAHLHPRGQSYLGRLIALAAEAGVQVVVETHSDHIIQDKNLLFYQVINEDVKKIIVNAQGQFSEWDGFFDQQVLDMQV 367
65 -18.500[R] COG3950 Predicted ATP-binding protein involved in virulence  ali follow..  17  62.IRLRNISLY-----------DYKKFSKLKFTSSEKNTTIIIGNNGSGKSTILESISKCLQ-KNRENISRKVSSELEEFKALARMYQRSNELDNNTLSYPLLANDFFSWYKEIDDIINEFKANDSITKEEIEYLLSKTDNKEKIGSLISQSIFNLSQGKTLIALVENPLNGYGIVLIDEIDLHLHPKWQQTIVQKLENTFPN-IQFILSTHSPVLTTVTSEQIKIINELDYRFKLLSPTSN................. 453
66 -18.200[L] COG3593 Predicted ATP-dependent endonuclease of the OLD family  ali follow..  11  1.MHLRQLDVLG--------------FRGIHRLSIHSADMVLIGENMWGKSSLLSALSLIFNPEKA--EKGEPIVVDDINNLVFSLIARHPVYRFRDARLNRAHHSFRFIRTEVQDETQDEIRAVSDLLCYYFLNHKNMTEIKQDTTLLWHKAKSLCLRKKLFFSLASLFVRNQIILFEDPDARLHPRMVAIMWELVSYL---PVQRITTTNSVELLS......................................... 300
67 -18.200[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  12  492.......................PLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLLTNSVAMVEQEILLFGGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSM--------SGGYDAELIEGAANLSGGQQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR---GCTCIIVAHRLSTIRDCDQIIVLERGKVVQQGTHQELWQVEGAYSRLIRTE..... 711
68 -16.500[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  15  357.......................PALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGAL-----------RNQVALVSQNVHLFN--TVANNIAYARNEQYSRAEIEEAARMAYAMDEHGLDTVIGENGIMLSGGQQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIA-HRLSTIEKADEIVVIEDGRIVERGVHAEL................... 565
69 -15.900[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  15  452...................PNGDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLG-----------------------ELWPLFGGTLTKPAKGKLFYVPQRPYMTLGTLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHILERE-DVLSGGEKQIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK---NITLFTVSHRKSLWKY-HEYSLYMDGRG............................ 645
70 -15.800[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  16  673ILGVHNVTF--------AFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLL---ELEPQEGEQRKNHR--------------------------LHVGRFDQHSGEHLTAEESAAEYLQRLFNLPHEKARKALGSFGLVSHAHTIMKDLSGGKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEY---EGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVLDSLGEVVNNPSV 893
71 -15.600[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  16  371.................AYDPQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMV-----PQDTVLFNDTIAYNIR--YGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGERGL-KLSGGEKQVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIG--ADEIIVLKDGLIAE......................... 577
72 -15.400[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  18  515...................PNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAG-------------------ELHIPRPVKDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHIAQRD-DILSGGEKQMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM---GITLLTITHRPTLWKY-HTHILEFDGLG............................ 711
73 -15.300[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  13  436...................SAGEQLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGT----------------------LSRPDGKNETMFLSQLPYVPLGNLRGVVC-----YPNAPADIPEDTVRDTLTKVALNPLCDR--KILSPGEQQIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSEL-PDCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEK.................... 633
74 -15.200[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  14  512.................TYR-HTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYL-----------HRVISLVSQEPVLFA-RSITDNISYGLPTVPFEMVVEAAQKANAH--QDGYSTETGEKGAQLSGGQQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIA-HR--LSTVEHAHIVVLDKGRVVQQGTHQ.................... 725
75 -15.000[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  15  447.................SYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESLRSSIGVV-----PQDTVLFNDTIFHNIH--YGNLSATEEEVYNAARRAAIHDTIMKFPDKYSTAVGERGL-MLSGGEKQVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLASNRTCIFIA-HR-LTTAMQCDEILVMEKGKVVE......................... 653

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.