current user: public




Query: [R] COG3910 Predicted ATPase, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MLFLDSVAMKEKPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLDDLast
1 -102.000[R] COG3910 Predicted ATPase  ali  100  1MLFLDSVAMKEKPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLDD 258
2 -54.000[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  14  1........MSIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFTKTPSDKA-----IRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCPQTEAFKNYLSH....... 242
3 -52.400[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  15  3...........NFKNVSKHFGKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDG---------LDVNSPNIDERQIRLEAGMVFQQFYLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPAELSGGQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDNPPSERLREFLQH....... 238
4 -50.200[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  14  7...........NVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVRDKDLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQGKPVHLSGGQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPENPQSPRLQRFLKG....... 254
5 -50.100[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  14  3...........EARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDS------------YHQNLLWIGHQPGIKTRLTALENLHF-------YHRDGDTAQCLEALAQAGLAGFEDIPVNQLSAGQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQTRAA.......................... 205
6 -48.600[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  13  24VLAVKGLV--------KAYKSQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHEN----DTQNIAALTTKQMRKWRAKCGMIFQDFCLVPRLDVITNVLLGRLSYTKLFSEQDQARAIELLQWLNMLPHALQRAENLSGGQQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVIVNLHSVDLVKDYCTRVIGIAHGRIIFDGPPSMLNDSIIQDIYSDESAEL.. 276
7 -46.600[D] COG2884 Predicted ATPase involved in cell division  ali follow..  17  1MITLDHVS--------KKYKLARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRH--------IPRLRQVIGCVFQDFRLLQQKTVYENVAF-ALEVIGRRSDAINQVVPDVLETVGLSGKANRLPDELSGGEQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDE....................... 220
8 -44.600[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  14  2......ITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDG---DTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFGRLYGL----------NRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALE.................... 222
9 -43.400[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  16  13AIRVSGMQ--------FAYEVEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYLGGSWSKTVGSAGEVPLQGDFSA--EHMIFGVEGTDPVRREKLIDL--------LDINLQWRMHKVSDGQRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQGATIVYATHIFDGLETWATHLAYIQDGELNRLKMTDIEELKTSPNLLSVVESWLRS 255
10 -43.000[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  16  1MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQL-------RAQHVGFVFQSFMLIPTLNALENVEL-PALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREGTTLILVTHDPALAAR-CDRRLRLVNGQLQEEA....................... 228
11 -42.900[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  12  7...........KVENLTVYQGNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPITKLGNLRHLLGYMPQNFIFDRSFPISVEELVGLGWVAEARHQKSSFLSKLRIQSREKSAAIATALKRTDTYHLRNQAIGTLSGGQKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQGWTVLQVSHDIDMVSRHCDRVLCLNQTVVCTGQPEIALSPQNLLATYGPGFSRYEH 255
12 -42.900[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  13  1MINVQNVSKTFILHQQNG---RLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIKHGDEWVDLVTAPARKVVEIRKT---TVGWVSQFLRVIPRISALEVVMQ-PLLDTGVPREACAAKAARLLTRLNVPERLHLAPSTFSGGEQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGASS............................ 226
13 -42.300[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  15  19.....................SYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLAH--------RRKQLGFVFQDFNLLDTLTIGENIML-PLTLEKEAPSVMEEKLHGIAAKLGIENLLNKRTFEVSGGQQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDHVTALMVTHDPVSASY-CRRVIFIKDVVLFNEIYRGENRQVFYEQILD........ 240
14 -41.300[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  13  8...........EVKGLTKSFGSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELYEI--------RTLFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLQLVGLGGDEKKFPGEISGGRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPREVSDEPVVRQFLNG....... 244
15 -41.200[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  3...........CVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSC----------TGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLA---PATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL....................... 216
16 -41.200[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  13  1MIRLQDIQVTFNPGTIL----ENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANLCARVFQD--PLAGTCGALTIEENMALAYMRGKKRGWSLALSNQRRKLFQERISILGLGLEDRLGDNIGLLSGGQQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKENLTVMMVTHSMKDALACGDRTVMLHQGQIVLDVTGEMGVPELLEMFSKVRGEELAD 258
17 -41.100[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  14  14........................LPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPSR-------------RPVSMLFQENNLFSHLTVAQNIGLG-LNPGLKLNAVQQEKMHAIARQMGIDNLMARLPGELSGGQQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTN.................... 215
18 -41.000[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  3...........TIDHVTKTFGDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRP---------------VNYHISNKIGYLPEERGLYPKMKVRDQLVYLA-RLKGMEKREAVKELGTWLERFNITDYENKKVEELAKGQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLK.................... 214
19 -41.000[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  1...MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEI-----------YRQQVSYCAQTPTLFGD-TVYDNLIFPWQIRNRQPDPAIFLDFLERFA--LPDSILTKNIAELSGGEQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRENIAVLWVTHDKDEINH-ADKVITLQPHAGEMQEARY.................... 222
20 -40.800[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  15  5...........TAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNRAQRG----------IGYLPQEASIFRRLTVYENLMAVLEIRKDLTPQQRREKADELIEEFNISHIRDNLGQALSGGERRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEMNDEQVKRVYLGE....... 237
21 -40.700[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  12  3...........KLASISKRFGGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQITQMG----------IARTFQNIRIFKEMTLLENVVVGMHRHLDAAERRARDRALELLSWVKLDHKAGDIADNLSYGQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRARGYTIFMIEHDMRFVMGLCERIAVLNFGRIIAEGPPERNNPQVIEAYLGRDDD.... 252
22 -39.900[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  23............QHFWQRRYRQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPFRRQTA-------------LRRTSLVMGQKQQLIWDLPTLDSLRINGAIYEIPDQVFEQRLGELSEMLDLTTELKQPVRKLSLGRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRQATVLLTSHYMADITTLCERVLLIHQGQLMYDGDLE.................... 238
23 -39.800[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  12  1...MTASSPSIRVTDLSYSVAGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGEL--GKSGVELFGQPLRDIKPAEAAK-----------RRAVLPQQTPLSFAYEVLDVVLLGRIPHGQRETVQDRAIAAACLERVGLSGYETRDVLTLSGGEQRVHFARTLAQGERVLLLDEPTASLDLAHQHATLRLARELCREGVGVLAVLHDLNLAAQYADRVLMLAEGHVIACD-AVALTPESIRTAYGHEVLVTQH 249
24 -39.500[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  13  12................KTYATGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGKDYRAA------------RSLIGLVPQELTIDAFESVWATVNYSR-----FGKPPNHGFVEKVLRDLSLWDKKDAKAITLSGGKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLREDGVTIILTTHYIEEAEAMADRVGVINRGEIILVENKA.................... 219
25 -39.500[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  12  2......IEIKSVNKVFYQGDKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQL--------CAARRNIGMIFQHFNLLSSRTVFENVAL-PLELAGQSQQHIETKVTELLALVGLSEKRESYPANLSGGQQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQNLTILLITHEMDVVKSICHEVAIIGGGELVEKG--AHPKTELAHQFIRS....... 243
26 -39.400[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  13  7...........QVHELSKSYGGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLAEAKRRLLMRTEWGFVQQNPRDGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDTRIDDLPAQFSGGMQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTD--------QVLDDPQH.... 244
27 -39.100[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  14  3...........NVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNI----------------PVSGPSAERGVVFQNEGLLPWRDVVSNVEFG-LQLAGMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNAIKSDPEFIARREDVLG. 245
28 -38.600[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  13  9...........QILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVS------------DEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGITPLLDRRFKYLSTGERKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKE.................... 224
29 -38.500[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  12  16...........................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGICLT-------PEKRRVGYVFQDARLFPHYKVRGNLRYG--------AKSMVDQFDKLVALLGIEPLLDRLPGSLSGGEQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRENIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALE.................... 214
30 -38.400[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  13  34.....................RFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQ----------------RLQGLNRKAGYLFQQDALMPWKTVLENVAIG-LEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLSQDKKAVMFVTHDLEEAIALADRVVIMSAGPIPLARPREISEIRLDNQFHEIHREIWS. 263
31 -38.200[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  15  15........................RLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTS-GKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVW-----------------HYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASG-EEVLTPPNLAQAYGMNFRRLDI 239
32 -37.700[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  18  3...........SFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIMRKSIAVV-----------EGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPR--LKERYEQRAGTMSGGEQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGALTNPKVRDAYL......... 231
33 -36.300[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  15  1MIEINDVNKK---------YQQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLATILSVLRQENHFTSRLTVSDLVGFGRYPY----------SRGRLNKNDRQHIDAAMEFLNLMPLKDRYLDELSGGQQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADEHKTIILVIHDINFASAYSDHIIAMKNGEVIYRG-AEIMQPSILEEIFD........ 234
34 -36.100[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  13  1......MQPVVHFKNVNKYYGGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKP-------------ITHLPPNRRNVNIVFQDYALFPHLNVGRNIAFG-LELKGLSSDAIHKRTMELLALVKLQDFADRMPDQLSGGQQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPSRPRSRFVANFIGQSNFL... 241
35 -36.100[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  13  1........MSIEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTD-------------VSRLHARDRKVGFVFQHYALFRHMTVFDNIAFGLPRRERPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEEKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPREPATRFVLEFMGEVNRL... 243
36 -36.100[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  17  7...........STETLSLGYGDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVAKELAILPQGPSAPEG--LTVHQLVKQGRYPYQNWLKQWSKEDEEAVERA------LKATKLEDMADRAVDSLSGGQQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEG-EEVITCDLVQNVFSMNCQVTQD 248
37 -35.900[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  16  7...........ELIGINKSFGAVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPNDAIALGIGMVHQHFMLVDNFSVLENII--------LGAESDALLKSSIAKARSELERLEREYGLEVDPDAIIEELPVGQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQGKTVVLITHKLREIMAITDNVSVMRQGTVATRETSKTTVGELAELMVGR....... 240
38 -35.800[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  11  7...........EIQDLTVSFDGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIARLG----------VGRKFQTPRVYLNLTVAENLDLAVNRKKGQATGAEQRSVGGLLETIGLTPKAHLAAALLSHGEKQLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLAL-AESHSIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQNDPKVIEVYLGEAPS.... 248
39 -35.600[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  13  5LLEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDL---------EPEQRRKQIIETMRMVGLLDHVSYYPHMLAPGQQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTASPLHELTKRLIAG....... 253
40 -35.000[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  17  69AIQIINLPKDLAKDTTHRY-GANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPDWEEILTHFRGSELQSYFIRVVEENLKTAIKPQHV-----DYIKEVVRGNLGKMLEKLDERGLMEEICADMELNQVLEREARQVSGGEQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRHDSYVIVVEHDLSVLDYLSDFVCCLYGKPGA.......................... 295
41 -34.000[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  15  323.LELRNVTF--------AYQDNAFSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDY-----------RKLFSAVFTDVWLFDQLLGPEGKPANPQLVEKWLAQLKMAHKLELSNGRIVNL-------KLSKGQKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEGKTIFAISHDDHYFIH-ADRLLEMRNGQLSELTGEE.................... 534
42 -33.900[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  16  337...........SFNSFSKQYGDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEVKISYKPQY------------------------------IKADTPVSVQDFLRGITKRFGTSYYEVEIANPLQLERIYESLLTELSGGEQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENQKTAMVVDHDIYMIDMLSQRLLVFEGKPSVYEAHGPFSMESGMNRFLENLGITFRR 556
43 -33.700[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  14  5MLEIRNLSRCFPIHNLGRQTGEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGAHSRAHGKKVQMVFQN---------PGSSLNPRRTVGQSVAVPLDAHGFPSLQRAKRISELLEMVQLPNFAERFPHELSGGQQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDRPQHAYTQLLLAS....... 254
44 -33.300[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  13  1MIELDKLSKTFTQKNGK----EFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTL-----------RRHIGYVIQQIGLFPNMTIEENIMVVP-RLLGWDKARCKEKARELMSMVKLKQYLQRYPRELSGGQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPADEFVSA....... 239
45 -33.100[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  13  22...FKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV-------RRKKIAMVFQSFALMPHMTVLDNTAFG-MELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDNPANDYVRTFFRGVDI.... 270
46 -32.900[S] COG4938 Uncharacterized conserved protein  ali follow..  15  1M--INEVTLR-----------NFKCYKNQLFEL--ANLTVFCGNNSSGKSTVIQSLLLILQNNFSNKLELRGDYVQPGSYNDLRRRSQNWLGTNGEYAPQVLELVVKNIQTMPSDDVRIHPNLTDGSVVGIAQNLFEWMGEIYTFGGESYRAVNVGFGSYVLPIVLALLKPGGLVIIENPEAHLHPRGQSYLGRLIALAAEAGVQVVVETHSDHIINGIRLMPRLGGTTTVKKIIVNAQGQFSEWDGFFDQQVLDMQV 367
47 -32.500[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  13  1.MNMSFLKI----TDLYKSYGSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ-------------RDIAMVFQSYALYPNMTVAGNIAFG-MEIRKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPNNPANMFVADFMGSPAMNL.. 243
48 -32.300[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  13  239........................GGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDDALMRGIGLLPESR-------KEEGLITSFSILQNISLNNYRKYRKDLKKELEHTTKAMAQVQVKAQGYARVDTLSGGQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAARGHSIIMISSELPEVIGMSDRVCVFRSGGVATVEGEDINSETIMTNATTGRVEHVA. 472
49 -32.100[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  15  19....HSLPAAMATEDLHVYYGDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDEIDGCRMEG----QILYDGININRKEVDLYNVRKEIGMVFQKPNPFT-KSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKLSGGQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINEL-KNKYTIIIVTHNMQQAARVSDYTSFFYLGEVVEFSGTSNPQEKQTEDYIS........ 267
50 -31.600[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  15  7LIELRVDKY--------TYPNGRVGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVNGLIPNFLGGTLEG-------------KVRVFGEKPNPRIAFFVKQNPEEMITSTQVIDELVFPLIQQGFGWGEAKREAEEVCEELGIGGLLERKTYELSTGEQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILRDY-----PHLVSEHRLEFSSFFEKTINLGLECEDFEIPEVEPGEAVYDGLIELREGELI.. 235
51 -30.700[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  16  8...........VNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFPD-------------------------KDTLRTCFVEHKLQ----GEEGDLDLVSFIALDEELQSTSREEIAAALESVGFDERRAQTVGSLSGGWKKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEH--TDITSLIVSHDSGFLDTVCTDIIHYENKKLAY......................... 200
52 -30.600[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  13  5......LDVKDLRVEFSTQDGIVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNGKTGSAKFEGKEILNLPERELNKVRAEQIAMIFQDPMTSLNPYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIPEARKRITMYPHEFSGGRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRENTAIIMITHDLGVVAGSCDKVLVMYAGRTMEYG---------VNDIFYNPSH.... 247
53 -30.400[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  11  5LLEVKNLTKSFDINGFSRKVGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSS-----DHATRYPHQFSGGQQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENPKHPYTR........ 253
54 -30.000[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  1...MPLLDIRNLTIEFMTSEGPVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVS---KDNWRITADRFRFNDIDLLQLTPRQRRKVIGHNISMIFQEQSCLDPSESIGLQLIQAIPQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGCQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNTTILLISHDLQMMSKWATRVNVLYCGQTVESA---------CEDLLSTPHH.... 252
55 -30.000[R] COG3950 Predicted ATP-binding protein involved in virulence  ali follow..  17  62.IRLRNISLY-----------DYKKFSKLKFTSSEKNTTIIIGNNGSGKSTILESISKCLQFLSDNIRIQNNNNYKFQDSEDNKEKIGSLISQLLEKKNNYNNNEDREFLIRQQKVIQESIKTFVSDIDQVKISRTPHLDMTVIKNGSEISIFNLSQGEKTLIALVSDINGYGIVLIDEIDLHLHPKWQQTIVQKLENTFPN-IQFILSTHSPLVLTTVTEQIKIINELD............................ 442
56 -29.800[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  15  42..IFNWFSRKSKTNEGQEESKIVWPLRNLDFTGYKGEILGIIGSNGAGKTTLCKMLSGILKPDEGELYVDGRVSALFS-----------------------LGMGFKKELTGRENAYLNG-MMLGIEKDQIDQFIDEIHEFSGLGSFIDQPMKYYSSGKARLGFSVAAFLEPEILILDEALNTGDAAFGKKAAAKMKELVSKAKMVILVTHSLRYARKNCDRLLWLDRGEIRAIGEPA.................... 254
57 -29.200[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  11  7ILSVKDLRVRFRTLD-----GAVEAVKGINIHVNAGETVAVVGESGSGKSQTMMAAMSLLASNGATGSVDYRGRNLLTLSKSDLNKVRGAKISMIFQEPMTSLDPLYSIGNQLIEPIRRHRGLNAAEAREEALKLLRLVHIPDPERRMKSYPHEMSGGQQRVMIAMALANDPDILIADEPTTALDVTIQAQILMLLAELQRKGMAIVFITHDLGIVRRFADRVYVMRQGEVVEEGEAGNPQHAYTKMLLAA....... 259
58 -29.200[R] COG4637 Predicted ATPase  ali follow..  16  7.KQLSRIVLK-----------GFKSIAKCDLEI--SRVNILIGANGAGKSNFIGFFRMVGQLVEENLQVFVSRQVYHFHDTSESAYIKQPHGINDNAYLRPDARNLASFLYLLRNSYPASYQRIVKTIRLVAPFFGDELEWFERGQDIPFKAYLLSDGTLRFVFLQPEDLQPETILVDEPELGLHPYAITVLASLMRTA---SKQVIVSTQSIELLNQFEKDVIVVSEGSSYLRRLNQGDRIHFTGYSL......... 345
59 -29.100[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  18  1MLEIRNLHARIVDDGTE-------IIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREDYEVTEGDILYNGQSILEDPAERATSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARGEEPLKIPEFLKRVKEAAASLN----MAMLKRPLNVFSGGEKK-EILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVDSVHVLYRGQVIKSGDKSLALDLEANGY.......... 243
60 -28.800[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  10  316...........EVKDLSMHFGEMKALDGVSIKLLPGETLGIVGESGSGKTTMGRSIMRLYDPTAGEMLYRRAD---GSVVDLSKIEGKELKAARRELRMVFQDGSLNPRMTVAQVIGEPLLVNGIAKGKELEERVCSLMEQVGLPSGRERYPHAFSGGQQRIGIARAITLRPRIIVADEATSALDVSVRFQVLDLLMKLQDEGLAYIFISHDIGVIRYMCDRVGVMYRGKLVEVG---------AEKVCNAPDH.... 552
61 -28.500[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  13  349.....................RKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETL-----------GRHIGYLPQGVELFD--TIGENISRFDDNPDPEAIIAAARAAGAHELILRFEKGYDSDIGELSAGQQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKARGGIAVVVAHRPSAIGAV-DYILMMEDGRMKAFGPRD.................... 557
62 -28.300[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  14  359..................SPQGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFMPYQ-GSLTINGIELRELDHAQWRQTIS------------WVGQNPLLLYGTIRDNVTLGKHNIADEQVTQTLQAAQEFVEQQGLDYPISDRSAGLSVGQQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ-QRTALFVTHQLQPLQS-VEQILVMENGLLVQAGHFE.................... 566
63 -28.300[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  12  75...........KIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDAMQQKQAKDFSGGWRRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKR---ILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNW 320
64 -28.300[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  16  408.....EVRTVLESFGVRQRVVERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIPSELEPQITEKSILEQIFDI----------------------TGDIHLAVEVLNRAGISDAVRARFNELSTGQERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREKITLIAVTHRKEVIALSPDRILYVGYGGVTES........................ 619
65 -28.000[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  16  442.IRFDNVPL--------VTPNGDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPAKGKLFYVPQRPYMTLGTL--------------RDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHILEREGGWSAVQDWMDVLSGGEQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK---NITLFTVSHRKSLWKYHEYSLYMDGRGSYRFEQIDDQ................... 655
66 -27.400[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  12  477.VELKNITFGYSRLEA-------PLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLLTNSVAMVEQEI------LLFGGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSM--SGGYDAELIEGAANLSGGQQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR---GCTCIIVAHRLSTIRD-CDQIIVLERGKVVQQGTHQ.................... 695
67 -27.300[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  16  673ILGVHNVTF--------AFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNHR----------------------------LHVGRFDQHSGEHLTAEESAAEYLQRLFNLPHEKARKALGSFGLSHAHTIKMKDLSGGKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEYEG---GVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVLDSLGEVVNNPSV 893
68 -26.900[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  17  339.LTLRDVQFTYPEQSQ-------QALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAAL-----------RQTISVVPQRVHLFS--TLRDNLLLASPGSSDEALSEILRRVEKLLEDAGLNSWLGEGGRQLSGGERRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR-EKTVLMVTHRLRGLSR-FQQIIVMDNGQIIEQGTHA.................... 557
69 -26.200[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  17  505.ISLRAVPV--------VTPNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPVKDVPC--------------------FYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHIAQRD-DILSGGEQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM---GITLLTITHRPTLWKYHTHILEFDGLGNWQFRKMNSDE--EQKGQFLS........ 730
70 -26.000[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  14  1...MSSQFVYTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDKEFEGEARPQPGIKIYLPQEPKLEPQQTVREAVEEAVSEVKNALTRLDEVYALYADPDADFDKLAAEQANLEAIIQAHDGHNLDNQLEDAKIEHLSGGERRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYE----TVVAITHDRYFLDNVAGWILELDRGEGIPWE---------YSSWLEQKEKRLEQ 258
71 -25.700[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  16  109........................LLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVKLNGETLQSRM-------------KVISAYVMQDDLLFPMLTVEETLMFAAEFRRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDISGGERRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPS-VLGLLDRLIFLSRGHTVYSG-----SPASLPRFFTE....... 327
72 -25.300[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  11  426.VHVVAVEV--------RTSAGEQLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTLSRP-------------------------KNETMFLSQLPYVPLGNLRGVVCYPNAPADIPE----DTVRDTLTKVALNPLCDR--KILSPGEQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELP-DCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEK.................... 633
73 -23.800[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  17  355.....................DTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVALVSQN------VHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEH-GLDTVIGENGIMLSGGQQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIA-HRLSTIEK-ADEIVVIEDGRIVERGVHA.................... 563
74 -23.500[L] COG3593 Predicted ATP-dependent endonuclease of the OLD family  ali follow..  11  1.MHLRQLDVL-----------GFRGIHRLSIHF--SADMVLIGENMWGKSSLLSALSLIFNPEKALYQFTLRDFHIPAEQTEPVRHLILLDDINNLVFSLIARHPVYRFRDARLNRAHHSFRFIRTEVQDETQDEIRAVSDLLCYYFLNHQDETHRLRKKLFFSLASLFFTRPIILFEDPDARLHPRMVAIMWELVSYL---PVQRITTTNSVELLSQVNNAICRLVRTP............................ 314
75 -23.200[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  15  371.................AYDPQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFI-------------MVPQDTVLFNDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGELSGGEQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSR-GRTTLVIAHRLSTVI--ADEIIVLKDGLIAERGTHR.................... 582

FFAS is supported by the NIH grant R01-GM087218-01
5 7 0 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.