current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG3203
Query: [M] COG3203 Outer membrane protein (porin), from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MMKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDARHSFSDNNKQDGDKSYVRFGFKGETQITDQLTGYGQWEYNIQANNAEDTGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFMAGRSTGLATYRNNNFFGLVDGLNFALQYQGKNDRSEVKEANGDGFGIGSTYDIGNGINFGAGFSSSNRTLDQKYGSTAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYGSFSDTIANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNDVDANHDLLKYVSVGTYYYFNKNMSTYVDYKINLLDEDEFTIANGLNTDNVVAVGLVYQFLast
1 -135.000[M] COG3203 Outer membrane protein (porin)  ali  100  1MMKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDARHSFSDNNKQDGDKSYVRFGFKGETQITDQLTGYGQWEYNIQANNAEDTGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFMAGRSTGLATYRNNNFFGLVDGLNFALQYQGKNDRSEVKEANGDGFGIGSTYDIGNGINFGAGFSSSNRTLDQKYGSTAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYGSFSDTIANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNDVDANHDLLKYVSVGTYYYFNKNMSTYVDYKINLLDEDEFTIANGLNTDNVVAVGLVYQF 360
2 -30.300[P] COG3746 Phosphate-selective porin  ali follow..  10  1.MRSIKFLFTLCLTSTASAAVAGD--FGNATQASLTGNFAYDYNNFSGDDRLKDRRRKELGISIK--KKDVYDAAVAFDFQ--------SKLWLDVFFRFETKALFDQDYGRIRLGYMKTPV--------------EALASSRAGSFMEAALPVQSIYEGRRTGVEWVLEYLLQTGAYGGKDLQGDNPGTTQAIRAIWTTGDVLHLGVSYSQENPRGYHDSGTLVDVDQIQRNGLEQLWIQGPLLIQSEALHIKVTRNNGLPT----YNGNGQYIYGSWVLTGAVELLARYSRLNLDNGSILGGRQ---HDWTIGANWYLTNYFKFQANYVKVNATRL-----GTRTTPDIVELRAQVHF 389
3 -25.400[G] COG4580 Maltoporin (phage lambda and maltose receptor)  ali follow..  12  1MMITLRKLPLAVAVAAGVMSAQA-------MAVDFHGYARSGIGWTGSGGEQGAQSKYRLGLGQEVWKEGDKSFYFDTNVAYSVAQQNDWEATD-PAFREANVQGKNLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLENIDVGFGKLSLAATRSSEAGG---SSSFASNNIYDYTNETANDVFDVRLAQMEVNPGGT-LELGVDYGRANLRDNYRLVDGASKDGWLF-KFVVQYATDSMTSQGKGLSQGSGVAFDNEKFAYNINNNGILDHGAISMGDNWDMMYVGMYQDIN---WDNDNGTKWWTVGIRPMYKWTPIMSTVMEIGYDNVESQRTGDKNNQYK............ 369
4 -23.800[I] COG2067 Long-chain fatty acid transport protein  ali follow..  11  1.MNNKKSLLAVTVTLATQQAFAAGFQLNAQSATGL-GRAFAGDAVIADNAAVMSRNPAAMALFDEMALSLGFETI-TTMIDVKNVSYRGVLGNSVSVQDTDNIHLIVPVNEQFAWG---NAYSNFGTKTEFSDSYPASEYGGLTDVKSFNLGLAGSYRVNKEWSFGAGLDLIYGQGTSLLNVDKADGWAVGFNLGTVYEMDENNRFGLSYYSPEFKAKDDYGQEITLPLPDIAEFSGFHKIENTQFAVHYSSVGALTKGSYDKMYEWQDGWHYSIGGTYYLNSDWTLRAGYMYDTSDSRTSISVPDSDRQWLSAGFTYNIDDKSNVDFGFTYLMGKDVAVSENDAHADAILLGLQYSRTF 428
5 -19.700[S] COG5338 Uncharacterized protein conserved in bacteria  ali follow..  10  34.......SFILKPSLEQGIKATSNGDNSSNGSRAILNETTLRLNALSDSGQDVSEPQANILGRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKRMFDERIDSNGYERSGRQYALGLIFDRGEKFNIAAGYMQADSDDPR--------ANISGPSINAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDANIRQ---KDGTGTDYTLGAEIGATYWLNRMVAIDARLRHEFQTSQVADRE----QSNSIYVGMKFQ. 398
6 -17.600[M] COG3637 Opacity protein and related surface antigens  ali follow..  11  1MFNARKALLALLFAGLASPVFAADLPEPQVEE---------------APPPVYEQPVDVGGW---------------------------------------YIR---GDID-----------------------------------------HKSDVRGIDYMTYGIDPCNCTVIPGGKSFDYGKLKGGFSLGGGVGYKINDRLRADVTADNGGTSDLVSTSTEVSKMSALLLLANAYVDIGT-YVGAGIGGARVKWDTVYDPNTAETNPGASNWRFAYALM-------------------------------AGASYCLTDKIILDAGYRFSHIQGGRMFEWDASSNTHEVRGGLRYQF 254
7 -17.000[M] COG3047 Outer membrane protein W  ali follow..  16  1.MKKITLALLAVASLVPTAASA-----HEAGDYIFRAGTATVRPNAGSDDV-------------------------------------------------------------------------------------------------------------------------------LGNGSFKVDNNTQLGLTFSYLITDNIGVELLAAPFNHKVGLAGVGTIADVKQLPPTLMAQYYFRDKQ----------------------------------KLRPYLGIGLNYTKFFDEKFNATGSDIGLTNAGQAGMDYMVSENWMLNMSVWWMNIESDVKFNLAGEEAPWVFMFGAGYRF 211
8 -14.300[C] COG4313 Protein involved in meta-pathway of phenol degradation  ali follow..  1.MTLKLLLKTTLLAACLSAGTARAEYLTHYSASRMMDNGGNTAASPPSQTFDLTVPVSQLIYVPEGARWGNTQLGFQALLPWVAQASVNDGMGNAMLKGER--GI-----GDLAAGVWLQFDPIMGEQGP---------------------------------LFSQRFELQVIAPTGHYDRTAAVSPGSNFYWAVTVWASPKLSFSGRFNYLWNARNSDPNAAFGSGATS-------TQAGQAL--------------------------HGNFAVEYEIRQGLVAGLSLKQISDTRVNGVAVPGRREQVVALGAMVALSPKDFLFFNYYREFAARNR-------TQGDKFQIRYDHHF 319
9 -13.600[M] COG4571 Outer membrane protease  ali follow..  11  1.MKKSSIVATIITILSGSANAASSQLIPNISPDSFTVAASTGMLSGKSHDAETGRKISQLKGDISWDPYSFLTLNARGWTSLASGSGNMDDYD--------WMNENQSEWTDHS------------------------SHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFS----TATGGSYSYNNGAYTGNFPKGVRVIGYNQ-------------------------RFSMPYIGLAGQY------------------RINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGDAAGISNKNYTVTAGLQYRF 312
10 -11.600[M] COG3248 Nucleoside-binding outer membrane protein  ali follow..  10  1.MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWF-DFYGYADA-PVFFGGNSDAKGIWNHGSPLFMEIE-----RFSIDKLTN--------------------------------------TDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKY---QWQNYGAANENEWDGYRFKIKYFVPITDLW---GGQLSYIGFTNFDWGSDLGDDSGXAINGIKTRTNNSIASSHIL--------------NYDHWHYSVVARYWHDG---GQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF 294
11 -10.700[M] COG3137 Putative salt-induced outer membrane protein  ali follow..  11  6TVPAIVMLAGGMFASLNAAADDSVF-DPASAKKPFEGNLNAXYLAQS-----GNTKSSSLTADTTMTWGQTTAWSLWGNASNTSSNDERSSEKYAAGGRSRF-----------NLTDYDYLF------------------------------GQASWLTDRYNG---------------------------------YRERDVLTAGYGRQFLNGPVHS-----------------------RFEFGPGVRYDKYTDNASETQPLG-----YASGAYAWQLTDNAKFTQGVSVFGAEDTTLNSE---------SALNVAINEHFGLKVAYNVT---NSEPPESAPEHTDRRTTLSLGYSM 252
12 -9.830[M] COG3713 Outer membrane protein V  ali follow..  11  1MLINRNIVALFALPFMAGAAYNESPYRGYNENTKAIPLISY-------EGDTFYVRQTTLGFILSQSEKNELSLTASWMPLEFDPTDNDDYAMQQLDKRDS-AGVAWYHERWGTV--KASAAADVLDNSNGWVGELSVFHKMQIGRLSLTPALGVLYYDENFSDYYYGISESESRRSGLASYSAQDAWVPYVSLTAKYPIGEHVVLMASAGYSELPEEITDSPMIDRNESFTFVTGVSWRF....................................................................................................................... 246
13 -9.690[N] COG5571 Autotransporter protein or domain, integral membrane beta-barrel involved in protein secretion  ali follow..  3......................................................................................................VGVDYQLNEQVLLG--------------LIAGSLDKQHPDDNYRYDARGFQAAVFSHLRAGQAWLDSDLHFLSAKFSNIQRSITLGALRRVEEGETN-GRLWGARLTSGYDFVMVPWLTTGPMLQYAWDYSHVNGYSEKLNTSTSMRFGDQNAHSQVGSAGWRLDLRHSIIHSWAQINYDDTYVANGGLKSTALTFSRDGKTQDKNWVDIAIGADFPLSATVSAFAGLSQTAGLSDG--------NQTRYNVGFSARF 243

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.