current user: public




Query: [M] COG3203 Outer membrane protein (porin), from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MMKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDARHSFSDNNKQDGDKSYVRFGFKGETQITDQLTGYGQWEYNIQANNAEDTGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFMAGRSTGLATYRNNNFFGLVDGLNFALQYQGKNDRSEVKEANGDGFGIGSTYDIGNGINFGAGFSSSNRTLDQKYGSTAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYGSFSDTIANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNDVDANHDLLKYVSVGTYYYFNKNMSTYVDYKINLLDEDEFTIANGLNTDNVVAVGLVYQFLast
1 -159.000[M] COG3203 Outer membrane protein (porin)  ali  100  1MMKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDARHSFSDNNKQDGDKSYVRFGFKGETQITDQLTGYGQWEYNIQANNAEDTGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFMAGRSTGLATYRNNNFFGLVDGLNFALQYQGKNDRSEVKEANGDGFGIGSTYDIGNGINFGAGFSSSNRTLDQKYGSTAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYGSFSDTIANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNDVDANHDLLKYVSVGTYYYFNKNMSTYVDYKINLLDEDEFTIANGLNTDNVVAVGLVYQF 360
2 -19.600[P] COG3746 Phosphate-selective porin  ali follow..  1.MRSIKFLFTLCLTSTASAAVAGLQYTFGNAQASLTGNFAYDYNNFSGDDRLKDRSRKELGISIK-------------VYDAAVAFDFQSKLWLDVFFRFETKALFDQDYGRIRLGYMKTPV----------------------EALASSRAGSFMEAALPVQSIYEGRRTGVEWVLERPGGKDLQGDNPGTTQAIRAIWTP-LHLGVSYSQENPRGYHDSGTLVDVDQIQRNGLEQLWIQGPLLIQSEALHIKVTRNNGLPT----YNGNGQYIYGSWVLTGAVELLARYSRLNLDNGSILGGRQ---HDWTIGANWYLTNYFKFQANYVKVNATR-----LGTRTTPDIVELRAQVHF 389
3 -17.100[S] COG5338 Uncharacterized protein conserved in bacteria  ali follow..  10  34.......SFILKPSLEQGIKATSNGDNSSNGSRAILNETTLRLNALSDSGQDVSEPQANILGRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKRMFDERIDSNGYERSGRQYALGLIFDRGEKFNIAAGYMQADSDDPRLANISG------SINAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQ--HFASLDVTRRVRANLSFNGKLDANIRQNKDGTGTDYTL--GAEIGATYWLNRMVAIDARLRHEFQTSQVADREY---QSNSIYVGMKFQ. 398
4 -14.900[M] COG4571 Outer membrane protease  ali follow..  13  1.MKKSSIVATIITILSGSANAASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRK--------------ISQLDWKIKNVAILKGDISWDPYSFLTLNA------GWTSLASGSGNMDD-------------------YDWMNENQSEWTDHS-------------------SHPATNVNHANEYDLNVKGWLLQDENYKAGAGYQETRFSWTATGGSYSYNNGAYTGNFPKG-------RVIGYNQRFSMPYIG----AGQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDKNSGDVTAGLQYRF 312
5 -13.900[G] COG4580 Maltoporin (phage lambda and maltose receptor)  ali follow..  14  1.MMITLRKLPLAVAVAAGVMSAQA------MAVDFHGYARSGIGWTGSGGETGAQSKYRLGNECETYAELKLGQEVWKEGDKSFVAQQNDWEATDPAFREANVQGKN---STIWAGKRFYQRHDVAGLENIDVGFGKLSLAATRSSEAGGSSSFASNNIYDYTNETGTLELGVDYGRANLRDNYRLVDKDGWLFTAEHTTSQGKGLSQGSGVAFDNEKFAYNINNNGHMLRILDHGAISMGDNWDMMYVGMYQDINWDNDNG-----TKWWTVGIRPMYKWTPIMSTVIGYDNVESQRTGDKNNKITLAQQWQAGDSIWSRPAIRVFATYA---VPADFNGGSFGRGDSDEWTFGAQME. 443
6 -12.900[I] COG2067 Long-chain fatty acid transport protein  ali follow..  13  6LFKKSLLAVTVTLATQQAFAAGFQLNAQSATGL---GRAFAGDAVIADNAAVMSRNPAAMALFDEMALSLGFETI---TTMIDVKNVSYRGVLGNSVSVQDTDDVGGTSV-QFAWG---NAYSNFGTKTEFSDSYPASEYGGLTDVKSFNLGLAGSYRVNKEWSFGAGLDLIPARGTSLLNVDKADGWAVGFNLGTVYEMDENNRFGLSYYSPEFKAKDDYGQEITLPLPDIAEFSGFHKIENTQFAVHYSLVTSRSSVGALTKGSYDKMYEWQIGGTYYLNSDLRAGYMYDTSAQDSRTSISVPDSDRQWLSAGFTYNIDDKSNVDFGFAVSENDAGSKLTATTHADAILLGLQYSRTF 428
7 -12.800[M] COG3248 Nucleoside-binding outer membrane protein  ali follow..  12  1.MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSD-WWHQSVNVVGSYHGPQIRNDTYLEYEAFAKKDWFD----YGYADA-PVFFGGNSDAKGIWNHGSPLFMEIEP----RFSIDKLTNTDLSFGPFKEWYFANNYI-YDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEDGYRFKIKYFVPITTNFDWGSDLGDDSGXAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGLNFGNGNFNVRSTGWGGYLVVGYNF............................................................................... 294
8 -12.400[M] COG3637 Opacity protein and related surface antigens  ali follow..  10  1MFNARKALLALLFAGLASPVFAADLPEPDVGGWYIRGDIDYHKSDVRGGGKSFDYGKLKGGFSLGGGVGYKINDRLRADVTADYWFKSNFNGGTSDLVSTSTEVSKMSALLLLA-----NAYVDIGTWHGITPYVGAGIGGARVKWDTVYDPNTAETNPGASNWRFA-----------------------ALMAGASYCLTDKIILDAGYRFSHIQGGRMFEWDASSANTHEVRGGLRYQFGG..................................................................................................................... 256
9 -10.700[S] COG5455 Predicted integral membrane protein  ali follow..  10  1MFKKTLIAAIAFSFVGASFAQAQDWRPQHGQH---KVEPRRPMPPHKFERNDRRDYGKHNRWSKGQRYNDWRRHQEIRDYRYGLRAPARGQRWIKVDDQFLLITAATGLIVGVLAGR................................................................................................................................................................................................................................................... 115
10 -8.510[P] COG4454 Uncharacterized copper-binding protein  ali follow..  10  1.MTRLKLALLLTALATPAFAGGTHSGGDNVMAIGEPGDKTIQVTMKETPDGKMMFTPAKFEFKKGKTVRFAVKNVGELDHEFILDEQKANLEHKAVMAKA--PEMEHDNPNAISLGESGEIVWKF........................................................................................................................................................................................................................................... 129

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.