current user: public




COG3126
Query: [S] COG3126 Uncharacterized protein conserved in bacteria, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MKPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVALPPDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAATIQLast
1 -82.400[S] COG3126 Uncharacterized protein conserved in bacteria  ali  100  1MKPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVALPPDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAATIQ 173
2 -13.600[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  11  2.....VKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQ---SWRGVLPCADSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTEMLDREGNPIESQFNYTLETPMTLRGMYFYMADAA.................................... 160
3 -12.100[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  11  3FYMKAFNKLFSLVVASVLVFSLAGCGDKEESKK----------SANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAA-VEEKLTYTDTYAQENVTIDMEKVDFKA........................................................... 121
4 -11.200[R] COG3042 Putative hemolysin  ali follow..  20  1........MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVQTCKLPGGETID...................................................................................................... 70
5 -11.200[M] COG1462 Uncharacterized protein involved in formation of curli polymers  ali follow..  12  1MSH-SAKKALLPLLAVATLAGLAGCATETSTALPVQQVESVNRPYSGVRSPIA-----VDRLGGQAKTILITHLQQLDRDNMSEIQQEAAIKGQAQRLKGADYVVTGDVTEFGRKAYAKVALNIISTSEVVYSTQ...................................... 173
6 -11.000[R] KOG4745 Metalloproteinase inhibitor TIMP and related proteins  ali follow..  1MPGSPRPAPSWVLLLRLLALLRPACSCAPAHPQQH----------CHSALVIRAKISSEKVVPASADPRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEA-------NSQKQYLLTGQVLSDGKV........................................... 126
7 -10.900[S] COG1934 Uncharacterized protein conserved in bacteria  ali follow..  11  1MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTPVKGHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLLPSQLQDKGPAASGQKKS.. 180
8 -10.700[S] COG4925 Uncharacterized conserved protein  ali follow..  19  1MKMIPIKWMLICLGVFLLAILATGCIEQNNIDQRAISNQSEMNSSEKTVSTEPEHGLALSEMSV-QGHIATFQLYDTVAAKE--------------EQLPLELDLT................................................................... 101
9 -10.700[M] COG3017 Outer membrane lipoprotein involved in outer membrane biogenesis  ali follow..  1...MTLPDFRLIRLLPLASLVLTACTLPGHKGPGKSPDSPQWRQHQQEVRHLRGAFAYISLLTNPLGSTENVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEVNYRQDGKNWKVVYGGYDSKTQPAMANMELSDGSQRIKLKMDNWI 205
10 -10.500[M] COG3065 Starvation-inducible outer membrane lipoprotein  ali follow..  14  8.....RNHKWMYGWLGLGALLLSGCVTIPPAIQGTNLIRSAPKLFIGQEARFGGTVVNVKN--EPNRTRLEIASVPLDSGARPEPSQGRVIAYVDGFLEPVDF----------RGHLVTVVGPIV................................................ 126
11 -10.400[M] COG3056 Uncharacterized lipoprotein  ali follow..  15  32....SPNMFKKILFPLVALFMLAGCAKPPTTIEVSPTITLPQQDPSLMGVTVSINGA---------DQRTDQALAKVTRDNQIVTLTASRDLRFLLQEV-LEKQMTARGYMVGPNGPVNLQIIVSQ-----LYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRAS... 182
12 -10.400[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  19  1.....MKNVFKTLAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKKVDSQT.......................................................................................................................... 46
13 -10.100[P] COG4454 Uncharacterized copper-binding protein  ali follow..  14  1.....MTRLKLALLLTALATPAFAGGTHSGGDNVMAIGEPGDKSKVTQTIQVTGKMMFPAKFEFKKGKTVRFAVKNVGELDHEFIL-ANLEHKAVMAKAPEMEHDNPNAISLAPGESGEIVWKFTNDGMFEF......................................... 137
14 -9.890[R] COG3895 Predicted periplasmic protein  ali follow..  13  1MKNSYSALWGRPAKVVLVALILGGLGLAIPSYAQETQTYY------SPTETLTIKMVEGSAIQVTLPDGRTVVLPQAESASGNKYSNGFITVWSKGNTALV........................................................................ 96
15 -9.880[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  1......MRKGCFGLVSLALLLLVGCRSHPEIPVNDEQSLVMESSL------LAAGISAEKPVLSTSDIQPSASSTLYNERQEPVTVHYRFYW--DARGLEMHPLERPRSVTIPAHSAVTLYG................................................... 109
16 -9.600[R] COG3218 ABC-type uncharacterized transport system, auxiliary component  ali follow..  12  1MRLSIGQKRRALFLAPLFAALMAGCAGAPNNDTFDLSVSSAAVTQGPSLKSRQLLIA-SENIVVRLSGSEVQYLGNSQWSDRLPRMVQSKGVGRPGQGLAIDYQVVSDIRAFENVANIEISVKLLNDRNGTVKAQEVFRASARVSGSGNANFVKALDQAFAAATREIVA.... 195
17 -9.500[S] COG4259 Uncharacterized protein conserved in bacteria  ali follow..  12  1...MMNPKTLSRLSLCAAVLALTACGGNGQKSTVYEGLKNDDTSLGKQTEKMEKYFAGNKKMNAAPGAHAHLGLLLSRSGDKEG---AFRQFEEEKRLFP......................................................................... 105
18 -9.250[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  15  5IKRIKNNRIPVSITVLTLAMSLAACGGQQGSDNTATQDGSSGTAKDATASSPAKLDLGGNVSLTGAGASFPAPLYASVGSGAGVEQFIQGTVDFGASDVAMK------DEEIQKVQRGVLLLPVTAGGIVLAYNLPGVTELNLPRVVYTDILLGKI-------------KTWD 176
19 -9.070[M] COG2980 Rare lipoprotein B  ali follow..  11  1......MRYLATLLLSLAVLITAGCGTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQT.. 174

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.