current user: public




Query: [S] COG3126 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MKPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVALPPDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAATIQLast
1 -78.700[S] COG3126 Uncharacterized protein conserved in bacteria  ali  100  1MKPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVALPPDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAATIQ 173
2 -12.600[M] COG3065 Starvation-inducible outer membrane lipoprotein  ali follow..  13  3QSKKFRNHKWMYGWLGLGALLLSGCVTIPPAIQGTNLIRSAPKLFIGQEARFGGTVVNVKN--EPNRTRLEIASVPLDSGARPEPSQGRVIAYVDGFLEPVDF----------RGHLVTVVGPIV................................................ 126
3 -12.100[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  2.....VKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQ---SWRGVL-IETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLT-------DSKGEKSYYRAK-----GDALEMLDREGNPIESQ.............................. 130
4 -12.100[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  11  3FYMKAFNKLFSLVVASVLVFSLAGCGDKEESKK----------SANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDA--VEEKLTYTDTYAQENVTIDMEKVDFKA........................................................... 121
5 -10.600[S] COG1934 Uncharacterized protein conserved in bacteria  ali follow..  11  1MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVSKMIIEGFGNPVTFMQDSGKPVKGHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLLPSQLQDKGPAASGQKKS.. 180
6 -10.600[O] COG3187 Heat shock protein  ali follow..  1M-RLNFSRTLFFAAIMGGFALAMGKAQPFFPS------NSVQAMETSKSQSLQGYISGWPSAPVPGSAPITLQFKGAPHSGSLRDRLTGTA-----NTFNGAYTSGDGNLTINQALATTRKA................................................... 115
7 -10.500[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  1......MRKGCFGLVSLALLLLVGCRSHPEIP------VNDEQSLVMESSLLAAGISAEKPVLSTSDIQPSASSTLYNERQEPVTVHYRFYW--DARGLEMHPLERPRSVTIPAHSAVTLYG................................................... 109
8 -10.300[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  19  1.....MKNVFKTLAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKKVDSQT.......................................................................................................................... 46
9 -10.200[M] COG3056 Uncharacterized lipoprotein  ali follow..  16  32....SPNMFKKILFPLVALFMLAGCAKPPTTIEVSPTITLPQQDPSLMGVTVSINGA---------DQRTDQALAKVTRDNQIVTLTASRDLRFLLQEV-LEKQMTARGYMVGPNGPVNLQIIVS................................................ 142
10 -10.100[M] COG3017 Outer membrane lipoprotein involved in outer membrane biogenesis  ali follow..  11  1...MTLPDFRLIRLLPLASLVLTACTLPGHKGPGKSPDSPQWRQHQQEVRHLNGAFAYISLLTNPLGSTELVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQ.................................................. 154
11 -9.900[R] COG3042 Putative hemolysin  ali follow..  20  1........MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVQTAKLPGGETID...................................................................................................... 70
12 -9.760[R] COG3218 ABC-type uncharacterized transport system, auxiliary component  ali follow..  12  1MRLSNGQKRRALFLAPLFAALMAGCAGAPNNDTFDLSVSSAAVTQGPSLKSRQLLIA-SENIVVRLSGSEVQYLGNSQWSDRLPRMVQSKGVGRPGQGLAIDYQVVSDIRAFENVANIEISVKLLNDRNGTVKAQEVFRASARVSGSGNANFVKALDQAFAAATREIVA.... 195
13 -9.600[S] COG4259 Uncharacterized protein conserved in bacteria  ali follow..  12  1...MMNPKTLSRLSLCAAVLALTACGGNGQKSTVYEGLKNDDTSLGKQTEKMEKYFAGNKKMNAAPGAHAHLGLLLSRSGDKEG---AFRQFEEEKRLFP......................................................................... 105
14 -9.590[R] COG5645 Predicted periplasmic lipoprotein  ali follow..  11  23.EFIMIRNVLLAFMICSGMALLGGCSS-------------VMSHTGGKEGTYPGTRASATMIGDDETNWGTKSLAIL---DMPFTAVMDTLL------LPWDVFRKDSSVRSRVEK......................................................... 115
15 -9.260[S] COG4925 Uncharacterized conserved protein  ali follow..  18  9....GIKWMLICLGVFLLAILATGCIEQNNIDQRAISNQSEMNSSEKTVSTEPEHGLALSEMSV-QGHIATFQLYDTVAAKELYEQL------------PLELDLT................................................................... 101
16 -9.060[M] COG1462 Uncharacterized protein involved in formation of curli polymers  ali follow..  14  1MSH-SAKKALLPLLAVATLAGLAGCATETSTALPVQQVESVNRPYSGVRSPIA-FSDGVDRLGGQAKTILITHLQQVLDRDNMSEIQQEAAIKGQAQRL--------------KGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVA................... 157

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]